4F01A

Crystal structure of an artificial dimeric dnak complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
218
Chain Sequence
GRHMVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
total genus 67
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4f01A02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4f01A01
3T47A 1YUWA 3DOBA 3DQGA 3T4AG 4EZXA 1DKXA 4EZWA 4EZVA 4EZOA 4EZQA 4R5IA 3T49A 1Q5LA 2OP6A 3H0XA 4HYBA 4FL9A 7HSCA 4JWEA 2BPRA 4E81A 4HY9A 4PO2A 4EZNA 3C7NA 4EZZA 3N8EA 4JN4A 4EZTA 4H6IA 2QFFA 1DKYA 2WINM 1BPRA 4H6HA 5E84A 4B9QA 3D2FA 5TKYA 4R5JA 4F00A 4JWDA 4EZPA 4JNFA 4R5LA 3DPPA 1DKZA 4EZUA 4EZRA 4JNEA 3C7NB 3QNJA 3T46A 4JWIA 4F01A 4EZSA 2QXLA 4R5GA 4JWCA 4R5KA 3OHXM 4WV7A 1CKRA 3DPOA 4WV5A 1U00A 3T48A 3D2EA 3L3OM 1DG4A 2KHOA 3DPQA 4EZYA 2V7YA
chains in the Genus database with same CATH superfamily
3T4AG 4EZNA 4BNEA 3N8EA 1TQTA 3Q84A 2Z0OA 1HXKA 3KDRA 4D8JA 4JN4A 3LVTA 4E3CA 1HWWA 2F7RA 4AZCA 4AZBA 3QNIA 4ILHB 3C7NB 1E9VA 1GNLA 3BLBA 1PS3A 2Z0NA 2YIAA 4EZVA 4EZOA 4M0MA 3VEBA 2YLLA 2GAFD 3I2WA 2X3XA 2FYVA 2Q13A 2YIVX 3QA8A 3ACOA 5FLEX 3ZEDA 3BUIA 1SU7A 3BUBA 2Z0VA 1DG4A 2OO2A 3T48A 2RAKA 2V0OA 3B52X 4I43A 4ILIA 3D4ZA 2YL5A 3CZNA 1HTYA 2ALWA 3T46A 3GI7A 4AZGA 1GNTA 4FM3A 1U00A 4UDYX 2JNKA 3D2EA 5E84A 3OWGA 3DOBA 3DQGA 3SYVA 1O7DB 4NQIA 3EJTA 1QX1A 3SBTB 3OK8A 4KIKB 3D52A 1UPXA 1QWNA 4ILGA 4B9QA 2O0I1 4JNFA 4R5LA 3BUQA 4EZSA 2QXLA 4R5KA 3DPOA 5C5BA 2ND1A 3O3MB 3DX2A 1DKXA 4EZWA 3H0XA 2BPRA 4PO2A 3C7NA 1ZYLA 4G6QA 3O3NB 3CZSA 3EJPA 4DCNC 3DX1A 4WPEA 2PMRA 3HAIA 4IM0A 1I4TA 3A98A 1CKRA 2EFKA 4WPCA 4AZHA 1YUWA 2YL9A 2OP6A 3T49A 4JWEA 3FD9A 3CV5A 2F7PA 3BVUA 2F1AA 4NPHA 4IWQA 2YKTA 4EZRA 3EJSA 3ZEFA 1TQUA 3ABHA 3RV0A 4AZ6A 2EX3B 3DX4A 4AZ5A 3RV1A 4JWIA 3QE6A 4JWCA 1GN9A 4IW0A 3LLLA 3DPQA 3DYTA 3UITA 2EWFA 4R5IA 3VKHA 1Q5LA 4FL9A 2LM0A 2F7OA 2QFFA 3BVXA 3G9GA 4FZOA 4HR1B 3EJQA 2ELBA 1TQSA 2C08A 1E2UA 3EJRA 3RPMA 2F1BA 4WV7A 2X3WA 1URUA 1R5EA 7HSCA 3HAJA 4HY9A 3CVRA 4FZPA 1OA1A 4EZZA 2FICA 4H6HA 4AZ7A 3EJUA 3I01A 4R5JA 4EZPA 1DKZA 2OBLA 2WYHA 1QWUA 4H8SA 3DX0A 2RAJA 4IM2A 1W9MA 3I39X 3DX3A 2N3KA 3SOGA 1JQKA 2GA9D 4JLCA 5KBPA 1ZWWA 3BUDA 3Q0KA 4IWOA 1I4LA 4R5GA 1SUFA 3L3PA 3VEAA 3DDGA 2YIBA 2RAIA 3DDFA 4DYLA 3D4YA 3ERCC 4IWPA 3CAZA 2MI7A 2RT6A 1I4DA 3BVVA 3ER8C 3D2FA 2Q12A 1OAOA 4F00A 2WYIA 2JNSA 3QNJA 4UDXX 4AKVA 1Y2OA 2F18A 3BUPA 2Z8YA 2KHOA 2QKWA 2D1LA 4HR1A 3PLTA 5C5BB 3KAWA 4EZTA 1WDZA 4H6IA 4AZIA 1DKYA 2WINM 2X3VA 4AVMA 4NSWA 1X03A 2YL6A 2EFLA 4EZUA 4I1QA 4JNEA 2LXYA 3D50A 2F7QA 4KIKA 2NCZA 4JWDA 3ER9B 4EZYA 1I49A 4EZQA 1TQWA 2OZNB 3KAVA 1BPRA 2X5CA 4JL9A 3QWEA 2D4CA 3BVTA 2YI9A 1R33A 5FIGA 3OHXM 2GF4A 4WV5A 3D51A 4AZCB 1X04A 2YI8A 4EZXA 2ZXQA 2ND0A 4MQDA 3CKDA 1E1DA 1TQVA 2OBMA 1LQ7A 1OA0A 5TKYA 3LMFA 1SU8A 4F01A 3O3OB 3L3OM 3BVWA 3T47A 1O7DC 2PY6A 4HYBA 4E81A 2OW7A 3F7WA 2OW6A 3B51X 1YWMA 4FZSA 3M3WA 2YL8A 1MJGA 3I04A 3DPPA 4ATMA 1R34A 2YLAA 3HAHA 3B53X 4IM3A 1SU6A 3SBSA 2V7YA
chains in the Genus database with same CATH topology
3DOBA 3DQGA 3T4AG 3UITA 3SBTB 2EWFA 4R5IA 3VKHA 4HR1A 1Q5LA 4FL9A 2LM0A 4EZNA 4KIKB 3KAWA 3N8EA 4EZTA 4H6IA 2QFFA 1UPXA 1DKYA 2WINM 4ILGA 4B9QA 4HR1B 4JNFA 4R5LA 2KHOA 4EZUA 4JNEA 1E2UA 4EZSA 2QXLA 4R5KA 4WV7A 3DPOA 4KIKA 2ND1A 2NCZA 4JWDA 3ER9B 3O3MB 4EZYA 1DKXA 4EZWA 4EZQA 3H0XA 3KDRA 7HSCA 4D8JA 2BPRA 4HY9A 4PO2A 3C7NA 1OA1A 1ZYLA 4EZZA 3KAVA 3SBSA 4JN4A 4G6QA 3O3NB 4E3CA 1BPRA 4H6HA 5E84A 2X5CA 3I01A 4JL9A 4R5JA 4EZPA 4ILHB 1DKZA 3C7NB 1E9VA 2OBLA 2YI9A 4IM0A 1GNLA 3A98A 1CKRA 5FIGA 3OHXM 4WV5A 4IM2A 2YI8A 1YUWA 1W9MA 2YIAA 4EZXA 2OP6A 3I39X 4EZVA 4EZOA 3T49A 2N3KA 2ND0A 4JWEA 4M0MA 4MQDA 1JQKA 3FD9A 2GA9D 4JLCA 1E1DA 3VEBA 2OBMA 2GAFD 1OA0A 5TKYA 4NPHA 4IWQA 3LMFA 1SU8A 2YIVX 3QA8A 4EZRA 4IWOA 5FLEX 4F01A 3O3OB 4R5GA 3ZEDA 1SUFA 1SU7A 3VEAA 3ZEFA 3L3OM 1DG4A 3T48A 3T47A 3RV0A 2YIBA 2PY6A 2EX3B 3B52X 4HYBA 4E81A 3F7WA 4I43A 4ILIA 3ERCC 4IWPA 3B51X 2RT6A 3ER8C 3D2FA 1OAOA 1MJGA 4F00A 2JNSA 3I04A 3DPPA 3QNJA 3RV1A 3T46A 4JWIA 3GI7A 1GNTA 4JWCA 4UDXX 1GN9A 3B53X 4FM3A 4IM3A 1U00A 1SU6A 4IW0A 4UDYX 2Z8YA 3D2EA 3DPQA 3OWGA 2V7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T47 A;  1YUW A;  3DOB A;  3DQG A;  3T4A G;  4EZX A;  1DKX A;  4EZW A;  4EZV A;  4EZO A;  4EZQ A;  4R5I A;  3T49 A;  1Q5L A;  2OP6 A;  3H0X A;  4HYB A;  4FL9 A;  7HSC A;  4JWE A;  2BPR A;  4E81 A;  4HY9 A;  4PO2 A;  4EZN A;  3C7N A;  4EZZ A;  3N8E A;  4JN4 A;  4EZT A;  4H6I A;  2QFF A;  1DKY A;  2WIN M;  1BPR A;  4H6H A;  5E84 A;  4B9Q A;  3D2F A;  5TKY A;  4R5J A;  4F00 A;  4JWD A;  4EZP A;  4JNF A;  4R5L A;  3DPP A;  1DKZ A;  4EZU A;  4EZR A;  4JNE A;  3C7N B;  3QNJ A;  3T46 A;  4JWI A;  4F01 A;  4EZS A;  2QXL A;  4R5G A;  4JWC A;  4R5K A;  3OHX M;  4WV7 A;  1CKR A;  3DPO A;  4WV5 A;  1U00 A;  3T48 A;  3D2E A;  3L3O M;  1DG4 A;  2KHO A;  3DPQ A;  4EZY A;  2V7Y A; 
#chains in the Genus database with same CATH topology
 3T4A G;  4EZN A;  4BNE A;  3N8E A;  1TQT A;  3Q84 A;  2Z0O A;  1HXK A;  3KDR A;  4D8J A;  4JN4 A;  3LVT A;  4E3C A;  1HWW A;  2F7R A;  4AZC A;  4AZB A;  3QNI A;  4ILH B;  3C7N B;  1E9V A;  1GNL A;  3BLB A;  1PS3 A;  2Z0N A;  2YIA A;  4EZV A;  4EZO A;  4M0M A;  3VEB A;  2YLL A;  2GAF D;  3I2W A;  2X3X A;  2FYV A;  2Q13 A;  2YIV X;  3QA8 A;  3ACO A;  5FLE X;  3ZED A;  3BUI A;  1SU7 A;  3BUB A;  2Z0V A;  1DG4 A;  2OO2 A;  3T48 A;  2RAK A;  2V0O A;  3B52 X;  4I43 A;  4ILI A;  3D4Z A;  2YL5 A;  3CZN A;  1HTY A;  2ALW A;  3T46 A;  3GI7 A;  4AZG A;  1GNT A;  4FM3 A;  1U00 A;  4UDY X;  2JNK A;  3D2E A;  5E84 A;  3OWG A;  3DOB A;  3DQG A;  3SYV A;  1O7D B;  4NQI A;  3EJT A;  1QX1 A;  3SBT B;  3OK8 A;  4KIK B;  3D52 A;  1UPX A;  1QWN A;  4ILG A;  4B9Q A;  2O0I 1;  4JNF A;  4R5L A;  3BUQ A;  4EZS A;  2QXL A;  4R5K A;  3DPO A;  5C5B A;  2ND1 A;  3O3M B;  3DX2 A;  1DKX A;  4EZW A;  3H0X A;  2BPR A;  4PO2 A;  3C7N A;  1ZYL A;  4G6Q A;  3O3N B;  3CZS A;  3EJP A;  4DCN C;  3DX1 A;  4WPE A;  2PMR A;  3HAI A;  4IM0 A;  1I4T A;  3A98 A;  1CKR A;  2EFK A;  4WPC A;  4AZH A;  1YUW A;  2YL9 A;  2OP6 A;  3T49 A;  4JWE A;  3FD9 A;  3CV5 A;  2F7P A;  3BVU A;  2F1A A;  4NPH A;  4IWQ A;  2YKT A;  4EZR A;  3EJS A;  3ZEF A;  1TQU A;  3ABH A;  3RV0 A;  4AZ6 A;  2EX3 B;  3DX4 A;  4AZ5 A;  3RV1 A;  4JWI A;  3QE6 A;  4JWC A;  1GN9 A;  4IW0 A;  3LLL A;  3DPQ A;  3DYT A;  3UIT A;  2EWF A;  4R5I A;  3VKH A;  1Q5L A;  4FL9 A;  2LM0 A;  2F7O A;  2QFF A;  3BVX A;  3G9G A;  4FZO A;  4HR1 B;  3EJQ A;  2ELB A;  1TQS A;  2C08 A;  1E2U A;  3EJR A;  3RPM A;  2F1B A;  4WV7 A;  2X3W A;  1URU A;  1R5E A;  7HSC A;  3HAJ A;  4HY9 A;  3CVR A;  4FZP A;  1OA1 A;  4EZZ A;  2FIC A;  4H6H A;  4AZ7 A;  3EJU A;  3I01 A;  4R5J A;  4EZP A;  1DKZ A;  2OBL A;  2WYH A;  1QWU A;  4H8S A;  3DX0 A;  2RAJ A;  4IM2 A;  1W9M A;  3I39 X;  3DX3 A;  2N3K A;  3SOG A;  1JQK A;  2GA9 D;  4JLC A;  5KBP A;  1ZWW A;  3BUD A;  3Q0K A;  4IWO A;  1I4L A;  4R5G A;  1SUF A;  3L3P A;  3VEA A;  3DDG A;  2YIB A;  2RAI A;  3DDF A;  4DYL A;  3D4Y A;  3ERC C;  4IWP A;  3CAZ A;  2MI7 A;  2RT6 A;  1I4D A;  3BVV A;  3ER8 C;  3D2F A;  2Q12 A;  1OAO A;  4F00 A;  2WYI A;  2JNS A;  3QNJ A;  4UDX X;  4AKV A;  1Y2O A;  2F18 A;  3BUP A;  2Z8Y A;  2KHO A;  2QKW A;  2D1L A;  4HR1 A;  3PLT A;  5C5B B;  3KAW A;  4EZT A;  1WDZ A;  4H6I A;  4AZI A;  1DKY A;  2WIN M;  2X3V A;  4AVM A;  4NSW A;  1X03 A;  2YL6 A;  2EFL A;  4EZU A;  4I1Q A;  4JNE A;  2LXY A;  3D50 A;  2F7Q A;  4KIK A;  2NCZ A;  4JWD A;  3ER9 B;  4EZY A;  1I49 A;  4EZQ A;  1TQW A;  2OZN B;  3KAV A;  1BPR A;  2X5C A;  4JL9 A;  3QWE A;  2D4C A;  3BVT A;  2YI9 A;  1R33 A;  5FIG A;  3OHX M;  2GF4 A;  4WV5 A;  3D51 A;  4AZC B;  1X04 A;  2YI8 A;  4EZX A;  2ZXQ A;  2ND0 A;  4MQD A;  3CKD A;  1E1D A;  1TQV A;  2OBM A;  1LQ7 A;  1OA0 A;  5TKY A;  3LMF A;  1SU8 A;  4F01 A;  3O3O B;  3L3O M;  3BVW A;  3T47 A;  1O7D C;  2PY6 A;  4HYB A;  4E81 A;  2OW7 A;  3F7W A;  2OW6 A;  3B51 X;  1YWM A;  4FZS A;  3M3W A;  2YL8 A;  1MJG A;  3I04 A;  3DPP A;  4ATM A;  1R34 A;  2YLA A;  3HAH A;  3B53 X;  4IM3 A;  1SU6 A;  3SBS A;  2V7Y A; 
#chains in the Genus database with same CATH homology
 3DOB A;  3DQG A;  3T4A G;  3UIT A;  3SBT B;  2EWF A;  4R5I A;  3VKH A;  4HR1 A;  1Q5L A;  4FL9 A;  2LM0 A;  4EZN A;  4KIK B;  3KAW A;  3N8E A;  4EZT A;  4H6I A;  2QFF A;  1UPX A;  1DKY A;  2WIN M;  4ILG A;  4B9Q A;  4HR1 B;  4JNF A;  4R5L A;  2KHO A;  4EZU A;  4JNE A;  1E2U A;  4EZS A;  2QXL A;  4R5K A;  4WV7 A;  3DPO A;  4KIK A;  2ND1 A;  2NCZ A;  4JWD A;  3ER9 B;  3O3M B;  4EZY A;  1DKX A;  4EZW A;  4EZQ A;  3H0X A;  3KDR A;  7HSC A;  4D8J A;  2BPR A;  4HY9 A;  4PO2 A;  3C7N A;  1OA1 A;  1ZYL A;  4EZZ A;  3KAV A;  3SBS A;  4JN4 A;  4G6Q A;  3O3N B;  4E3C A;  1BPR A;  4H6H A;  5E84 A;  2X5C A;  3I01 A;  4JL9 A;  4R5J A;  4EZP A;  4ILH B;  1DKZ A;  3C7N B;  1E9V A;  2OBL A;  2YI9 A;  4IM0 A;  1GNL A;  3A98 A;  1CKR A;  5FIG A;  3OHX M;  4WV5 A;  4IM2 A;  2YI8 A;  1YUW A;  1W9M A;  2YIA A;  4EZX A;  2OP6 A;  3I39 X;  4EZV A;  4EZO A;  3T49 A;  2N3K A;  2ND0 A;  4JWE A;  4M0M A;  4MQD A;  1JQK A;  3FD9 A;  2GA9 D;  4JLC A;  1E1D A;  3VEB A;  2OBM A;  2GAF D;  1OA0 A;  5TKY A;  4NPH A;  4IWQ A;  3LMF A;  1SU8 A;  2YIV X;  3QA8 A;  4EZR A;  4IWO A;  5FLE X;  4F01 A;  3O3O B;  4R5G A;  3ZED A;  1SUF A;  1SU7 A;  3VEA A;  3ZEF A;  3L3O M;  1DG4 A;  3T48 A;  3T47 A;  3RV0 A;  2YIB A;  2PY6 A;  2EX3 B;  3B52 X;  4HYB A;  4E81 A;  3F7W A;  4I43 A;  4ILI A;  3ERC C;  4IWP A;  3B51 X;  2RT6 A;  3ER8 C;  3D2F A;  1OAO A;  1MJG A;  4F00 A;  2JNS A;  3I04 A;  3DPP A;  3QNJ A;  3RV1 A;  3T46 A;  4JWI A;  3GI7 A;  1GNT A;  4JWC A;  4UDX X;  1GN9 A;  3B53 X;  4FM3 A;  4IM3 A;  1U00 A;  1SU6 A;  4IW0 A;  4UDY X;  2Z8Y A;  3D2E A;  3DPQ A;  3OWG A;  2V7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...