4F01A

Crystal structure of an artificial dimeric dnak complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
218
Chain Sequence
GRHMVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 67
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4f01A02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4f01A01
1DKYA 4JWEA 4EZSA 2V7YA 1YUWA 3DOBA 4JWCA 1Q5LA 3OHXM 4R5GA 1DG4A 4R5LA 4B9QA 4H6HA 4JNFA 4EZXA 4R5JA 3T47A 4JWDA 4EZRA 4EZOA 3QNJA 4HY9A 4HYBA 5E84A 3DPQA 3N8EA 2WINM 4JNEA 4EZZA 3T48A 3DQGA 2KHOA 3L3OM 3H0XA 3DPOA 4JN4A 4R5IA 4PO2A 4FL9A 7HSCA 4WV5A 1U00A 3DPPA 4EZPA 3T49A 1BPRA 3T46A 4EZVA 1CKRA 3C7NA 4EZYA 3D2EA 4E81A 4EZNA 4EZWA 3D2FA 4EZQA 2BPRA 4EZUA 3C7NB 4EZTA 4JWIA 4R5KA 2QXLA 1DKZA 4F01A 1DKXA 2QFFA 4F00A 2OP6A 3T4AG 5TKYA 4WV7A 4H6IA
chains in the Genus database with same CATH superfamily
2PMRA 2V7YA 1R5EA 4JWCA 4JNFA 3GI7A 3CZNA 4EZOA 2JNSA 3DDFA 4KIKA 1U00A 3G9GA 2Z0NA 3DX3A 4EZWA 1JQKA 2X3VA 1I4DA 3ABHA 4UDYX 4B9QA 4AZ5A 2YL8A 1TQUA 1ZYLA 4R5JA 1UPXA 3D4ZA 3OK8A 3QE6A 4R5IA 3VEBA 3CV5A 2D1LA 2RAKA 2Z0VA 4EZYA 4E81A 2OBLA 3D2FA 1PS3A 3QA8A 1LQ7A 4AZCB 1X04A 1URUA 2EWFA 5TKYA 2ND0A 3ZEDA 4H6IA 1I49A 3BUQA 1E9VA 3BVUA 2YIAA 3LMFA 4NSWA 2V0OA 4UDXX 7HSCA 3HAHA 4EZPA 2RAJA 1DKXA 1O7DB 2ALWA 4FZPA 1R33A 2GA9D 3DOBA 1Q5LA 3OHXM 3M3WA 2N3KA 2OBMA 3EJRA 1SU7A 3D50A 3DQGA 3H0XA 5KBPA 2OW6A 5FIGA 2EX3B 3EJTA 3O3NB 4AZCA 2GAFD 4WV7A 4I43A 4IM2A 3BVVA 3B51X 3L3PA 3DYTA 4EZXA 3ER9B 5E84A 4E3CA 3DPOA 2F7PA 4IWPA 3D52A 4AZ7A 4BNEA 3QNIA 3C7NB 2LXYA 4FM3A 4WPEA 1TQVA 1SU8A 3BVXA 2ELBA 4JWDA 4FL9A 3KAVA 2FICA 4AKVA 4EZVA 4IWOA 4EZTA 1DKZA 4ILGA 3EJQA 1I4LA 3RPMA 4JWEA 3BUDA 1OA1A 2Q12A 3Q0KA 4H6HA 1E1DA 4R5LA 3QNJA 3I04A 3BVWA 3LVTA 3BUPA 3T49A 1CKRA 3C7NA 2JNKA 2EFLA 2QXLA 2Z8YA 3B53X 3BUBA 3OWGA 1GN9A 1HXKA 1I4TA 4EZRA 4WPCA 4G6QA 3T48A 4AVMA 3UITA 3ACOA 2YLAA 4EZQA 3D4YA 4AZGA 4AZ6A 3DX4A 3DDGA 3BVTA 4R5GA 3T47A 2PY6A 2F7RA 2LM0A 1SU6A 4WV5A 5C5BB 2X3XA 4IM3A 2BPRA 1X03A 4AZBA 3CVRA 1WDZA 3HAJA 4MQDA 2WYHA 3BLBA 4JN4A 2X5CA 3DX2A 3EJUA 4F01A 3VEAA 2OP6A 2MI7A 2QFFA 4NPHA 4ILHB 1QWUA 3CKDA 3DX0A 1HTYA 4FZOA 2RAIA 4JNEA 1OA0A 4IW0A 3RV0A 3SBSA 5C5BA 3SYVA 3CAZA 2EFKA 3I39X 4D8JA 4ILIA 4JWIA 4R5KA 1E2UA 1MJGA 4NQIA 3CZSA 1TQSA 5FLEX 4AZHA 4JLCA 1Y2OA 3O3MB 2YIVX 2YI9A 3QWEA 2F7OA 1TQTA 2KHOA 4PO2A 3Q84A 4EZNA 2OZNB 2RT6A 2YL5A 1OAOA 1R34A 2O0I1 2YL9A 1DG4A 2ZXQA 3A98A 4M0MA 1GNLA 3RV1A 4HYBA 2Z0OA 3L3OM 3DX1A 3SOGA 3T46A 3FD9A 4IWQA 2YKTA 3I2WA 4H8SA 2OW7A 4DCNC 2OO2A 3KAWA 3I01A 2WYIA 4JL9A 1O7DC 2YL6A 4HY9A 3DPQA 1ZWWA 1QX1A 2F1BA 1TQWA 3D2EA 3KDRA 2YIBA 1QWNA 4EZUA 4FZSA 3EJPA 4HR1B 1GNTA 3D51A 3HAIA 1DKYA 2F7QA 3BUIA 3F7WA 4AZIA 1YWMA 3N8EA 3O3OB 4IM0A 4I1QA 4KIKB 2ND1A 2D4CA 2C08A 2GF4A 4ATMA 3EJSA 3ER8C 1W9MA 3LLLA 4F00A 3T4AG 2FYVA 2X3WA 3ERCC 2NCZA 4EZSA 1YUWA 2QKWA 2YI8A 4DYLA 3B52X 2Q13A 2F18A 2WINM 4EZZA 3PLTA 3ZEFA 3DPPA 1BPRA 1HWWA 1SUFA 4HR1A 3VKHA 3SBTB 2F1AA 2YLLA
chains in the Genus database with same CATH topology
4IM2A 2V7YA 3B51X 4JWCA 4R5GA 1DG4A 4JNFA 3A98A 3GI7A 4EZXA 4M0MA 3T47A 1GNLA 4EZOA 3RV1A 2PY6A 4HYBA 5E84A 3ER9B 2JNSA 4E3CA 2LM0A 4KIKA 3L3OM 1SU6A 3DPOA 4IWPA 4WV5A 1U00A 3T46A 3FD9A 4IWQA 4IM3A 4EZWA 2BPRA 3C7NB 1JQKA 4FM3A 1SU8A 4MQDA 4UDYX 4B9QA 3KAWA 3I01A 1ZYLA 4JL9A 4R5JA 4JWDA 4HY9A 3DPQA 1UPXA 4JN4A 4R5IA 4FL9A 3KAVA 3VEBA 4EZVA 4EZYA 3D2EA 3KDRA 4IWOA 2OBLA 2YIBA 3D2FA 4E81A 4EZUA 3QA8A 4EZTA 2X5CA 3VEAA 1DKZA 4HR1B 4F01A 2OP6A 2QFFA 2EWFA 4NPHA 4ILGA 1GNTA 2ND0A 5TKYA 3ZEDA 4ILHB 4H6IA 1DKYA 4JWEA 1E9VA 1OA1A 2YIAA 3F7WA 3LMFA 1E1DA 4H6HA 4R5LA 4UDXX 3N8EA 3QNJA 3I04A 3O3OB 4JNEA 1OA0A 4IW0A 3RV0A 4IM0A 3SBSA 7HSCA 4KIKB 2ND1A 4EZPA 3T49A 1CKRA 3C7NA 3I39X 4D8JA 4ILIA 4JWIA 3ER8C 4R5KA 2QXLA 1E2UA 2Z8YA 1W9MA 1MJGA 1DKXA 3B53X 4F00A 3T4AG 5FLEX 3ERCC 2NCZA 4EZSA 1YUWA 2GA9D 3DOBA 4JLCA 2YI8A 3OHXM 3OWGA 1Q5LA 1GN9A 3B52X 3O3MB 2YIVX 2N3KA 2OBMA 2YI9A 4EZRA 1SU7A 2WINM 4EZZA 4G6QA 3T48A 3DQGA 2KHOA 3H0XA 4PO2A 3UITA 3ZEFA 3DPPA 5FIGA 1BPRA 4EZQA 1SUFA 2EX3B 4EZNA 3O3NB 4HR1A 3VKHA 2RT6A 3SBTB 1OAOA 2GAFD 4WV7A 4I43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DKY A;  4JWE A;  4EZS A;  2V7Y A;  1YUW A;  3DOB A;  4JWC A;  1Q5L A;  3OHX M;  4R5G A;  1DG4 A;  4R5L A;  4B9Q A;  4H6H A;  4JNF A;  4EZX A;  4R5J A;  3T47 A;  4JWD A;  4EZR A;  4EZO A;  3QNJ A;  4HY9 A;  4HYB A;  5E84 A;  3DPQ A;  3N8E A;  2WIN M;  4JNE A;  4EZZ A;  3T48 A;  3DQG A;  2KHO A;  3L3O M;  3H0X A;  3DPO A;  4JN4 A;  4R5I A;  4PO2 A;  4FL9 A;  7HSC A;  4WV5 A;  1U00 A;  3DPP A;  4EZP A;  3T49 A;  1BPR A;  3T46 A;  4EZV A;  1CKR A;  3C7N A;  4EZY A;  3D2E A;  4E81 A;  4EZN A;  4EZW A;  3D2F A;  4EZQ A;  2BPR A;  4EZU A;  3C7N B;  4EZT A;  4JWI A;  4R5K A;  2QXL A;  1DKZ A;  4F01 A;  1DKX A;  2QFF A;  4F00 A;  2OP6 A;  3T4A G;  5TKY A;  4WV7 A;  4H6I A; 
#chains in the Genus database with same CATH topology
 2PMR A;  2V7Y A;  1R5E A;  4JWC A;  4JNF A;  3GI7 A;  3CZN A;  4EZO A;  2JNS A;  3DDF A;  4KIK A;  1U00 A;  3G9G A;  2Z0N A;  3DX3 A;  4EZW A;  1JQK A;  2X3V A;  1I4D A;  3ABH A;  4UDY X;  4B9Q A;  4AZ5 A;  2YL8 A;  1TQU A;  1ZYL A;  4R5J A;  1UPX A;  3D4Z A;  3OK8 A;  3QE6 A;  4R5I A;  3VEB A;  3CV5 A;  2D1L A;  2RAK A;  2Z0V A;  4EZY A;  4E81 A;  2OBL A;  3D2F A;  1PS3 A;  3QA8 A;  1LQ7 A;  4AZC B;  1X04 A;  1URU A;  2EWF A;  5TKY A;  2ND0 A;  3ZED A;  4H6I A;  1I49 A;  3BUQ A;  1E9V A;  3BVU A;  2YIA A;  3LMF A;  4NSW A;  2V0O A;  4UDX X;  7HSC A;  3HAH A;  4EZP A;  2RAJ A;  1DKX A;  1O7D B;  2ALW A;  4FZP A;  1R33 A;  2GA9 D;  3DOB A;  1Q5L A;  3OHX M;  3M3W A;  2N3K A;  2OBM A;  3EJR A;  1SU7 A;  3D50 A;  3DQG A;  3H0X A;  5KBP A;  2OW6 A;  5FIG A;  2EX3 B;  3EJT A;  3O3N B;  4AZC A;  2GAF D;  4WV7 A;  4I43 A;  4IM2 A;  3BVV A;  3B51 X;  3L3P A;  3DYT A;  4EZX A;  3ER9 B;  5E84 A;  4E3C A;  3DPO A;  2F7P A;  4IWP A;  3D52 A;  4AZ7 A;  4BNE A;  3QNI A;  3C7N B;  2LXY A;  4FM3 A;  4WPE A;  1TQV A;  1SU8 A;  3BVX A;  2ELB A;  4JWD A;  4FL9 A;  3KAV A;  2FIC A;  4AKV A;  4EZV A;  4IWO A;  4EZT A;  1DKZ A;  4ILG A;  3EJQ A;  1I4L A;  3RPM A;  4JWE A;  3BUD A;  1OA1 A;  2Q12 A;  3Q0K A;  4H6H A;  1E1D A;  4R5L A;  3QNJ A;  3I04 A;  3BVW A;  3LVT A;  3BUP A;  3T49 A;  1CKR A;  3C7N A;  2JNK A;  2EFL A;  2QXL A;  2Z8Y A;  3B53 X;  3BUB A;  3OWG A;  1GN9 A;  1HXK A;  1I4T A;  4EZR A;  4WPC A;  4G6Q A;  3T48 A;  4AVM A;  3UIT A;  3ACO A;  2YLA A;  4EZQ A;  3D4Y A;  4AZG A;  4AZ6 A;  3DX4 A;  3DDG A;  3BVT A;  4R5G A;  3T47 A;  2PY6 A;  2F7R A;  2LM0 A;  1SU6 A;  4WV5 A;  5C5B B;  2X3X A;  4IM3 A;  2BPR A;  1X03 A;  4AZB A;  3CVR A;  1WDZ A;  3HAJ A;  4MQD A;  2WYH A;  3BLB A;  4JN4 A;  2X5C A;  3DX2 A;  3EJU A;  4F01 A;  3VEA A;  2OP6 A;  2MI7 A;  2QFF A;  4NPH A;  4ILH B;  1QWU A;  3CKD A;  3DX0 A;  1HTY A;  4FZO A;  2RAI A;  4JNE A;  1OA0 A;  4IW0 A;  3RV0 A;  3SBS A;  5C5B A;  3SYV A;  3CAZ A;  2EFK A;  3I39 X;  4D8J A;  4ILI A;  4JWI A;  4R5K A;  1E2U A;  1MJG A;  4NQI A;  3CZS A;  1TQS A;  5FLE X;  4AZH A;  4JLC A;  1Y2O A;  3O3M B;  2YIV X;  2YI9 A;  3QWE A;  2F7O A;  1TQT A;  2KHO A;  4PO2 A;  3Q84 A;  4EZN A;  2OZN B;  2RT6 A;  2YL5 A;  1OAO A;  1R34 A;  2O0I 1;  2YL9 A;  1DG4 A;  2ZXQ A;  3A98 A;  4M0M A;  1GNL A;  3RV1 A;  4HYB A;  2Z0O A;  3L3O M;  3DX1 A;  3SOG A;  3T46 A;  3FD9 A;  4IWQ A;  2YKT A;  3I2W A;  4H8S A;  2OW7 A;  4DCN C;  2OO2 A;  3KAW A;  3I01 A;  2WYI A;  4JL9 A;  1O7D C;  2YL6 A;  4HY9 A;  3DPQ A;  1ZWW A;  1QX1 A;  2F1B A;  1TQW A;  3D2E A;  3KDR A;  2YIB A;  1QWN A;  4EZU A;  4FZS A;  3EJP A;  4HR1 B;  1GNT A;  3D51 A;  3HAI A;  1DKY A;  2F7Q A;  3BUI A;  3F7W A;  4AZI A;  1YWM A;  3N8E A;  3O3O B;  4IM0 A;  4I1Q A;  4KIK B;  2ND1 A;  2D4C A;  2C08 A;  2GF4 A;  4ATM A;  3EJS A;  3ER8 C;  1W9M A;  3LLL A;  4F00 A;  3T4A G;  2FYV A;  2X3W A;  3ERC C;  2NCZ A;  4EZS A;  1YUW A;  2QKW A;  2YI8 A;  4DYL A;  3B52 X;  2Q13 A;  2F18 A;  2WIN M;  4EZZ A;  3PLT A;  3ZEF A;  3DPP A;  1BPR A;  1HWW A;  1SUF A;  4HR1 A;  3VKH A;  3SBT B;  2F1A A;  2YLL A; 
#chains in the Genus database with same CATH homology
 4IM2 A;  2V7Y A;  3B51 X;  4JWC A;  4R5G A;  1DG4 A;  4JNF A;  3A98 A;  3GI7 A;  4EZX A;  4M0M A;  3T47 A;  1GNL A;  4EZO A;  3RV1 A;  2PY6 A;  4HYB A;  5E84 A;  3ER9 B;  2JNS A;  4E3C A;  2LM0 A;  4KIK A;  3L3O M;  1SU6 A;  3DPO A;  4IWP A;  4WV5 A;  1U00 A;  3T46 A;  3FD9 A;  4IWQ A;  4IM3 A;  4EZW A;  2BPR A;  3C7N B;  1JQK A;  4FM3 A;  1SU8 A;  4MQD A;  4UDY X;  4B9Q A;  3KAW A;  3I01 A;  1ZYL A;  4JL9 A;  4R5J A;  4JWD A;  4HY9 A;  3DPQ A;  1UPX A;  4JN4 A;  4R5I A;  4FL9 A;  3KAV A;  3VEB A;  4EZV A;  4EZY A;  3D2E A;  3KDR A;  4IWO A;  2OBL A;  2YIB A;  3D2F A;  4E81 A;  4EZU A;  3QA8 A;  4EZT A;  2X5C A;  3VEA A;  1DKZ A;  4HR1 B;  4F01 A;  2OP6 A;  2QFF A;  2EWF A;  4NPH A;  4ILG A;  1GNT A;  2ND0 A;  5TKY A;  3ZED A;  4ILH B;  4H6I A;  1DKY A;  4JWE A;  1E9V A;  1OA1 A;  2YIA A;  3F7W A;  3LMF A;  1E1D A;  4H6H A;  4R5L A;  4UDX X;  3N8E A;  3QNJ A;  3I04 A;  3O3O B;  4JNE A;  1OA0 A;  4IW0 A;  3RV0 A;  4IM0 A;  3SBS A;  7HSC A;  4KIK B;  2ND1 A;  4EZP A;  3T49 A;  1CKR A;  3C7N A;  3I39 X;  4D8J A;  4ILI A;  4JWI A;  3ER8 C;  4R5K A;  2QXL A;  1E2U A;  2Z8Y A;  1W9M A;  1MJG A;  1DKX A;  3B53 X;  4F00 A;  3T4A G;  5FLE X;  3ERC C;  2NCZ A;  4EZS A;  1YUW A;  2GA9 D;  3DOB A;  4JLC A;  2YI8 A;  3OHX M;  3OWG A;  1Q5L A;  1GN9 A;  3B52 X;  3O3M B;  2YIV X;  2N3K A;  2OBM A;  2YI9 A;  4EZR A;  1SU7 A;  2WIN M;  4EZZ A;  4G6Q A;  3T48 A;  3DQG A;  2KHO A;  3H0X A;  4PO2 A;  3UIT A;  3ZEF A;  3DPP A;  5FIG A;  1BPR A;  4EZQ A;  1SUF A;  2EX3 B;  4EZN A;  3O3N B;  4HR1 A;  3VKH A;  2RT6 A;  3SBT B;  1OAO A;  2GAF D;  4WV7 A;  4I43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...