4F01A

Crystal structure of an artificial dimeric dnak complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
218
Chain Sequence
GRHMVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 67
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4f01A02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4f01A01
3DPQA 1BPRA 4WV7A 1DG4A 4R5LA 3T46A 3N8EA 4R5JA 5TKYA 1Q5LA 4EZQA 3H0XA 1DKYA 4EZWA 4EZOA 3T49A 4JWEA 4HY9A 4EZNA 4JWIA 2KHOA 4EZSA 4F00A 4R5GA 1DKZA 2QFFA 2WINM 3DPOA 3QNJA 4JNEA 4EZVA 3D2FA 3T4AG 4EZUA 4PO2A 3D2EA 3OHXM 4H6HA 4JWDA 3T48A 4B9QA 1U00A 1YUWA 7HSCA 1CKRA 1DKXA 3DPPA 4JWCA 4R5IA 3T47A 3C7NA 4EZPA 4R5KA 4H6IA 5E84A 4HYBA 3C7NB 4EZZA 4FL9A 4E81A 4JN4A 3DOBA 4JNFA 2QXLA 4EZRA 2V7YA 2BPRA 3L3OM 4EZXA 4EZTA 3DQGA 4WV5A 2OP6A 4EZYA 4F01A
chains in the Genus database with same CATH superfamily
2LXYA 2X5CA 3VEBA 4ILIA 4EZWA 4JWEA 4AKVA 4G6QA 2QFFA 3DPOA 1SU8A 3LVTA 3T48A 1R5EA 3DDFA 2ELBA 2WYHA 2LM0A 4JN4A 2OZNB 3CAZA 2EX3B 3D50A 3DPQA 1JQKA 3OK8A 3T46A 3KDRA 1QWNA 1O7DB 4HR1A 3BVTA 3DOBA 2Q13A 4EZXA 4NSWA 3HAHA 4WV7A 1DG4A 3DX2A 4ATMA 3D51A 3CZNA 4EZNA 2Q12A 2YL8A 5C5BA 1DKXA 1O7DC 3BLBA 2YIAA 1I49A 4FZOA 2OP6A 4EZYA 4R5LA 3I2WA 1HTYA 1YWMA 4AZCB 4IWPA 4NQIA 1DKZA 4AZBA 4EZVA 3EJTA 3ZEFA 3QE6A 2YIBA 3RV0A 2X3XA 1CKRA 1GN9A 4R5KA 3B52X 1TQTA 4AVMA 1TQUA 3D4YA 3EJPA 4WPEA 4WV5A 2Z8YA 3DDGA 1E1DA 3VKHA 3A98A 3M3WA 4I1QA 4KIKA 2ZXQA 3CZSA 3DX4A 4EZUA 3EJRA 1R34A 4EZPA 3BUDA 3C7NB 1HXKA 4EZZA 2GA9D 1GNTA 4E81A 3KAWA 4ILGA 3DQGA 2F7OA 2OO2A 3ZEDA 3F7WA 2Z0VA 4EZQA 3D52A 2YI8A 2Z0NA 3QNJA 3DX0A 2GF4A 2X3VA 3ERCC 7HSCA 3BUIA 4BNEA 4JWCA 3BVXA 4H6IA 3D4ZA 3VEAA 1OA1A 4M0MA 2YL9A 3I01A 1E9VA 5FIGA 4R5JA 4JLCA 3SYVA 3KAVA 1SU6A 4DYLA 3T4AG 4PO2A 4H8SA 4JL9A 1SU7A 3HAIA 3O3OB 3L3PA 4FZPA 4FZSA 2RAKA 1URUA 3H0XA 4HY9A 4JWIA 3EJSA 3O3MB 4AZGA 2F7QA 1MJGA 2YIVX 3PLTA 3QA8A 4HR1B 4WPCA 3BUPA 3LMFA 1I4TA 4AZ7A 1R33A 1ZYLA 3BUBA 2KHOA 3Q84A 3CVRA 5C5BB 3B51X 3DX3A 3G9GA 1TQWA 1I4LA 4MQDA 2ND0A 4DCNC 4EZRA 3ER9B 2EFLA 2ND1A 3BVVA 3EJQA 3GI7A 2F1AA 1HWWA 5KBPA 2JNKA 1LQ7A 1UPXA 2OW6A 3CKDA 1Y2OA 2JNSA 4I43A 2YL5A 3B53X 2MI7A 3SBSA 2V7YA 4D8JA 1GNLA 4EZTA 1BPRA 1ZWWA 2F7RA 1OA0A 3BUQA 4KIKB 3RPMA 5FLEX 2FYVA 4AZIA 2D4CA 3DX1A 3LLLA 3ABHA 1WDZA 1QWUA 2C08A 2OBLA 5E84A 4NPHA 4IM0A 4AZHA 1SUFA 1QX1A 2V0OA 3ER8C 4EZOA 2F1BA 4EZSA 2X3WA 4JNEA 2EFKA 4IWQA 3D2EA 4JWDA 3I39X 3OWGA 3UITA 4E3CA 1X04A 1OAOA 2GAFD 4IM3A 1TQSA 3I04A 2PY6A 2EWFA 4R5GA 2QKWA 3SBTB 4IM2A 4H6HA 4AZ6A 2YI9A 2OW7A 3DPPA 2F18A 3CV5A 4UDYX 3QWEA 2QXLA 1I4DA 3ACOA 4AZCA 1DKYA 4IWOA 4F00A 1PS3A 1U00A 2WYIA 2YKTA 2D1LA 4HYBA 2YLLA 4JNFA 2BPRA 3L3OM 4F01A 4AZ5A 3BVWA 1X03A 3N8EA 2F7PA 2RT6A 1Q5LA 3SOGA 3T49A 2YLAA 3RV1A 2WINM 3D2FA 3O3NB 1YUWA 3T47A 3C7NA 2Z0OA 4UDXX 1TQVA 3Q0KA 1E2UA 2OBMA 3FD9A 3BVUA 4FM3A 3QNIA 2FICA 5TKYA 2N3KA 3HAJA 1W9MA 2O0I1 4ILHB 3EJUA 3OHXM 2YL6A 4B9QA 2ALWA 4R5IA 4IW0A 2RAIA 2NCZA 2RAJA 4FL9A 2PMRA 3DYTA
chains in the Genus database with same CATH topology
2X5CA 1E1DA 1OAOA 1ZYLA 3VEBA 4ILIA 3VKHA 2GAFD 4IM3A 4EZWA 3I04A 3A98A 4JWEA 2PY6A 2KHOA 4KIKA 2EWFA 4R5GA 4G6QA 2QFFA 3DPOA 3SBTB 4IM2A 4EZUA 1SU8A 4H6HA 3T48A 2YI9A 3B51X 3DPPA 4EZPA 3C7NB 4UDYX 2ND0A 4MQDA 2LM0A 4EZZA 2GA9D 1GNTA 4JN4A 4E81A 2QXLA 4EZRA 3KAWA 4ILGA 3ER9B 2EX3B 3DQGA 3ZEDA 3DPQA 1JQKA 2ND1A 3F7WA 3T46A 3GI7A 3KDRA 4EZQA 1DKYA 4IWOA 2YI8A 1UPXA 4F00A 2JNSA 3QNJA 4I43A 4HR1A 3B53X 3ERCC 1U00A 7HSCA 4JWCA 4H6IA 4HYBA 3SBSA 3DOBA 4JNFA 2V7YA 2BPRA 3L3OM 4EZXA 3VEAA 4D8JA 1OA1A 1GNLA 4EZTA 4M0MA 3I01A 1E9VA 4F01A 5FIGA 1BPRA 4WV7A 1DG4A 3N8EA 4R5JA 4JLCA 1OA0A 2RT6A 1Q5LA 3T49A 4EZNA 4KIKB 3RV1A 2WINM 3KAVA 1SU6A 5FLEX 3D2FA 3O3NB 3T4AG 4PO2A 4JL9A 1YUWA 1SU7A 1DKXA 3T47A 3C7NA 2OBLA 5E84A 4NPHA 4IM0A 4UDXX 2YIAA 3O3OB 1E2UA 2OBMA 3FD9A 2OP6A 4EZYA 4FM3A 4R5LA 1SUFA 4IWPA 5TKYA 2N3KA 1W9MA 3H0XA 3ER8C 4EZOA 4HY9A 4JWIA 4EZSA 4ILHB 1DKZA 3O3MB 4EZVA 4JNEA 3ZEFA 4IWQA 1MJGA 2YIVX 2YIBA 3D2EA 3OHXM 3QA8A 4JWDA 3RV0A 4HR1B 4B9QA 3I39X 3OWGA 1CKRA 4R5IA 3UITA 1GN9A 4IW0A 4R5KA 3B52X 2NCZA 4E3CA 4WV5A 2Z8YA 3LMFA 4FL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DPQ A;  1BPR A;  4WV7 A;  1DG4 A;  4R5L A;  3T46 A;  3N8E A;  4R5J A;  5TKY A;  1Q5L A;  4EZQ A;  3H0X A;  1DKY A;  4EZW A;  4EZO A;  3T49 A;  4JWE A;  4HY9 A;  4EZN A;  4JWI A;  2KHO A;  4EZS A;  4F00 A;  4R5G A;  1DKZ A;  2QFF A;  2WIN M;  3DPO A;  3QNJ A;  4JNE A;  4EZV A;  3D2F A;  3T4A G;  4EZU A;  4PO2 A;  3D2E A;  3OHX M;  4H6H A;  4JWD A;  3T48 A;  4B9Q A;  1U00 A;  1YUW A;  7HSC A;  1CKR A;  1DKX A;  3DPP A;  4JWC A;  4R5I A;  3T47 A;  3C7N A;  4EZP A;  4R5K A;  4H6I A;  5E84 A;  4HYB A;  3C7N B;  4EZZ A;  4FL9 A;  4E81 A;  4JN4 A;  3DOB A;  4JNF A;  2QXL A;  4EZR A;  2V7Y A;  2BPR A;  3L3O M;  4EZX A;  4EZT A;  3DQG A;  4WV5 A;  2OP6 A;  4EZY A;  4F01 A; 
#chains in the Genus database with same CATH topology
 2LXY A;  2X5C A;  3VEB A;  4ILI A;  4EZW A;  4JWE A;  4AKV A;  4G6Q A;  2QFF A;  3DPO A;  1SU8 A;  3LVT A;  3T48 A;  1R5E A;  3DDF A;  2ELB A;  2WYH A;  2LM0 A;  4JN4 A;  2OZN B;  3CAZ A;  2EX3 B;  3D50 A;  3DPQ A;  1JQK A;  3OK8 A;  3T46 A;  3KDR A;  1QWN A;  1O7D B;  4HR1 A;  3BVT A;  3DOB A;  2Q13 A;  4EZX A;  4NSW A;  3HAH A;  4WV7 A;  1DG4 A;  3DX2 A;  4ATM A;  3D51 A;  3CZN A;  4EZN A;  2Q12 A;  2YL8 A;  5C5B A;  1DKX A;  1O7D C;  3BLB A;  2YIA A;  1I49 A;  4FZO A;  2OP6 A;  4EZY A;  4R5L A;  3I2W A;  1HTY A;  1YWM A;  4AZC B;  4IWP A;  4NQI A;  1DKZ A;  4AZB A;  4EZV A;  3EJT A;  3ZEF A;  3QE6 A;  2YIB A;  3RV0 A;  2X3X A;  1CKR A;  1GN9 A;  4R5K A;  3B52 X;  1TQT A;  4AVM A;  1TQU A;  3D4Y A;  3EJP A;  4WPE A;  4WV5 A;  2Z8Y A;  3DDG A;  1E1D A;  3VKH A;  3A98 A;  3M3W A;  4I1Q A;  4KIK A;  2ZXQ A;  3CZS A;  3DX4 A;  4EZU A;  3EJR A;  1R34 A;  4EZP A;  3BUD A;  3C7N B;  1HXK A;  4EZZ A;  2GA9 D;  1GNT A;  4E81 A;  3KAW A;  4ILG A;  3DQG A;  2F7O A;  2OO2 A;  3ZED A;  3F7W A;  2Z0V A;  4EZQ A;  3D52 A;  2YI8 A;  2Z0N A;  3QNJ A;  3DX0 A;  2GF4 A;  2X3V A;  3ERC C;  7HSC A;  3BUI A;  4BNE A;  4JWC A;  3BVX A;  4H6I A;  3D4Z A;  3VEA A;  1OA1 A;  4M0M A;  2YL9 A;  3I01 A;  1E9V A;  5FIG A;  4R5J A;  4JLC A;  3SYV A;  3KAV A;  1SU6 A;  4DYL A;  3T4A G;  4PO2 A;  4H8S A;  4JL9 A;  1SU7 A;  3HAI A;  3O3O B;  3L3P A;  4FZP A;  4FZS A;  2RAK A;  1URU A;  3H0X A;  4HY9 A;  4JWI A;  3EJS A;  3O3M B;  4AZG A;  2F7Q A;  1MJG A;  2YIV X;  3PLT A;  3QA8 A;  4HR1 B;  4WPC A;  3BUP A;  3LMF A;  1I4T A;  4AZ7 A;  1R33 A;  1ZYL A;  3BUB A;  2KHO A;  3Q84 A;  3CVR A;  5C5B B;  3B51 X;  3DX3 A;  3G9G A;  1TQW A;  1I4L A;  4MQD A;  2ND0 A;  4DCN C;  4EZR A;  3ER9 B;  2EFL A;  2ND1 A;  3BVV A;  3EJQ A;  3GI7 A;  2F1A A;  1HWW A;  5KBP A;  2JNK A;  1LQ7 A;  1UPX A;  2OW6 A;  3CKD A;  1Y2O A;  2JNS A;  4I43 A;  2YL5 A;  3B53 X;  2MI7 A;  3SBS A;  2V7Y A;  4D8J A;  1GNL A;  4EZT A;  1BPR A;  1ZWW A;  2F7R A;  1OA0 A;  3BUQ A;  4KIK B;  3RPM A;  5FLE X;  2FYV A;  4AZI A;  2D4C A;  3DX1 A;  3LLL A;  3ABH A;  1WDZ A;  1QWU A;  2C08 A;  2OBL A;  5E84 A;  4NPH A;  4IM0 A;  4AZH A;  1SUF A;  1QX1 A;  2V0O A;  3ER8 C;  4EZO A;  2F1B A;  4EZS A;  2X3W A;  4JNE A;  2EFK A;  4IWQ A;  3D2E A;  4JWD A;  3I39 X;  3OWG A;  3UIT A;  4E3C A;  1X04 A;  1OAO A;  2GAF D;  4IM3 A;  1TQS A;  3I04 A;  2PY6 A;  2EWF A;  4R5G A;  2QKW A;  3SBT B;  4IM2 A;  4H6H A;  4AZ6 A;  2YI9 A;  2OW7 A;  3DPP A;  2F18 A;  3CV5 A;  4UDY X;  3QWE A;  2QXL A;  1I4D A;  3ACO A;  4AZC A;  1DKY A;  4IWO A;  4F00 A;  1PS3 A;  1U00 A;  2WYI A;  2YKT A;  2D1L A;  4HYB A;  2YLL A;  4JNF A;  2BPR A;  3L3O M;  4F01 A;  4AZ5 A;  3BVW A;  1X03 A;  3N8E A;  2F7P A;  2RT6 A;  1Q5L A;  3SOG A;  3T49 A;  2YLA A;  3RV1 A;  2WIN M;  3D2F A;  3O3N B;  1YUW A;  3T47 A;  3C7N A;  2Z0O A;  4UDX X;  1TQV A;  3Q0K A;  1E2U A;  2OBM A;  3FD9 A;  3BVU A;  4FM3 A;  3QNI A;  2FIC A;  5TKY A;  2N3K A;  3HAJ A;  1W9M A;  2O0I 1;  4ILH B;  3EJU A;  3OHX M;  2YL6 A;  4B9Q A;  2ALW A;  4R5I A;  4IW0 A;  2RAI A;  2NCZ A;  2RAJ A;  4FL9 A;  2PMR A;  3DYT A; 
#chains in the Genus database with same CATH homology
 2X5C A;  1E1D A;  1OAO A;  1ZYL A;  3VEB A;  4ILI A;  3VKH A;  2GAF D;  4IM3 A;  4EZW A;  3I04 A;  3A98 A;  4JWE A;  2PY6 A;  2KHO A;  4KIK A;  2EWF A;  4R5G A;  4G6Q A;  2QFF A;  3DPO A;  3SBT B;  4IM2 A;  4EZU A;  1SU8 A;  4H6H A;  3T48 A;  2YI9 A;  3B51 X;  3DPP A;  4EZP A;  3C7N B;  4UDY X;  2ND0 A;  4MQD A;  2LM0 A;  4EZZ A;  2GA9 D;  1GNT A;  4JN4 A;  4E81 A;  2QXL A;  4EZR A;  3KAW A;  4ILG A;  3ER9 B;  2EX3 B;  3DQG A;  3ZED A;  3DPQ A;  1JQK A;  2ND1 A;  3F7W A;  3T46 A;  3GI7 A;  3KDR A;  4EZQ A;  1DKY A;  4IWO A;  2YI8 A;  1UPX A;  4F00 A;  2JNS A;  3QNJ A;  4I43 A;  4HR1 A;  3B53 X;  3ERC C;  1U00 A;  7HSC A;  4JWC A;  4H6I A;  4HYB A;  3SBS A;  3DOB A;  4JNF A;  2V7Y A;  2BPR A;  3L3O M;  4EZX A;  3VEA A;  4D8J A;  1OA1 A;  1GNL A;  4EZT A;  4M0M A;  3I01 A;  1E9V A;  4F01 A;  5FIG A;  1BPR A;  4WV7 A;  1DG4 A;  3N8E A;  4R5J A;  4JLC A;  1OA0 A;  2RT6 A;  1Q5L A;  3T49 A;  4EZN A;  4KIK B;  3RV1 A;  2WIN M;  3KAV A;  1SU6 A;  5FLE X;  3D2F A;  3O3N B;  3T4A G;  4PO2 A;  4JL9 A;  1YUW A;  1SU7 A;  1DKX A;  3T47 A;  3C7N A;  2OBL A;  5E84 A;  4NPH A;  4IM0 A;  4UDX X;  2YIA A;  3O3O B;  1E2U A;  2OBM A;  3FD9 A;  2OP6 A;  4EZY A;  4FM3 A;  4R5L A;  1SUF A;  4IWP A;  5TKY A;  2N3K A;  1W9M A;  3H0X A;  3ER8 C;  4EZO A;  4HY9 A;  4JWI A;  4EZS A;  4ILH B;  1DKZ A;  3O3M B;  4EZV A;  4JNE A;  3ZEF A;  4IWQ A;  1MJG A;  2YIV X;  2YIB A;  3D2E A;  3OHX M;  3QA8 A;  4JWD A;  3RV0 A;  4HR1 B;  4B9Q A;  3I39 X;  3OWG A;  1CKR A;  4R5I A;  3UIT A;  1GN9 A;  4IW0 A;  4R5K A;  3B52 X;  2NCZ A;  4E3C A;  4WV5 A;  2Z8Y A;  3LMF A;  4FL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...