4E81A

Crystal structure of the substrate binding domain of e.coli dnak in complex with a short apidaecin peptide
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
214
structure length
214
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Api88 is a novel antibacterial designer Peptide to treat systemic infections with multidrug-resistant gram-negative pathogens.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 63
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4e81A02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4e81A01
4HYBA 1U00A 4PO2A 4R5GA 4F00A 4H6IA 4JWEA 3C7NA 3L3OM 4EZOA 3D2EA 2QXLA 3T46A 4EZUA 4EZYA 4JWCA 7HSCA 1Q5LA 4JNEA 3T48A 3OHXM 3T49A 3T47A 1YUWA 4R5LA 1DKZA 3DPPA 4EZTA 4B9QA 4JWDA 4EZWA 4EZZA 4WV5A 1DG4A 4EZPA 4R5KA 3QNJA 3T4AG 4EZNA 4EZSA 3H0XA 4HY9A 2OP6A 4E81A 4F01A 3DOBA 1DKXA 3DPOA 5TKYA 1BPRA 2V7YA 1DKYA 5E84A 4EZQA 2BPRA 3D2FA 4R5JA 3C7NB 4JWIA 4WV7A 4EZRA 4JNFA 4EZVA 4EZXA 3DQGA 3DPQA 2KHOA 1CKRA 2QFFA 3N8EA 2WINM 4FL9A 4H6HA 4R5IA 4JN4A
chains in the Genus database with same CATH superfamily
1MJGA 4H6IA 4IW0A 1TQUA 4ILGA 1YUWA 4WPEA 2F1AA 2F7QA 2MI7A 1R33A 3HAIA 2ZXQA 2Z0VA 3D52A 2YI9A 3D2FA 3ERCC 1URUA 2D4CA 3CVRA 3ABHA 3BLBA 3BVWA 1UPXA 3ER9B 4AZ7A 3CAZA 1LQ7A 3B53X 4FZSA 3EJQA 1Q5LA 3OHXM 1TQVA 4HY9A 1YWMA 2C08A 2V7YA 4D8JA 2WYHA 5E84A 1I4TA 2RT6A 2F7PA 3G9GA 3BVXA 3DYTA 4BNEA 2V0OA 4IWPA 4MQDA 5FLEX 4G6QA 4EZSA 4IWOA 3D4YA 4IWQA 2EFLA 3B51X 3QE6A 3DPQA 4AZHA 3CZSA 1SU6A 3ZEFA 3O3OB 3VEAA 4UDXX 2RAJA 2EX3B 2O0I1 2X5CA 3BUPA 3PLTA 3SBTB 3BUQA 3DDFA 3ACOA 3BUBA 1E2UA 2YKTA 3DX2A 3BUDA 2YLAA 3ER8C 2WINM 1HWWA 4ILHB 1U00A 2OBMA 2X3XA 3D2EA 4EZUA 1O7DC 2OW7A 5FIGA 1DG4A 2YIBA 4B9QA 3RV1A 1TQWA 4AZ6A 3O3NB 4JLCA 3SYVA 2F1BA 1I4DA 3C7NB 1GNTA 3I2WA 4HR1B 3CKDA 4EZXA 1HTYA 2JNSA 3OWGA 3Q0KA 3M3WA 3F7WA 3T47A 3T49A 4JWDA 2YL5A 3LLLA 3RV0A 1QWNA 1BPRA 3VEBA 4WV7A 4KIKB 4I43A 2EFKA 2D1LA 4R5IA 2QXLA 1QX1A 4AZCA 3KAWA 4H8SA 2GF4A 1I4LA 4E81A 3DX1A 4FM3A 3SOGA 3D4ZA 3DX4A 1W9MA 4FZOA 2QKWA 2OZNB 1E1DA 3OK8A 2NCZA 4H6HA 3QNIA 3GI7A 2ELBA 3ZEDA 2OP6A 1R34A 4ATMA 1ZWWA 3DX3A 1PS3A 3CZNA 4AKVA 3L3PA 3BVTA 1OA0A 3N8EA 2GAFD 3CV5A 2WYIA 3BVVA 3FD9A 3DDGA 2PMRA 4AVMA 3H0XA 1OAOA 4AZGA 3UITA 4AZIA 2OW6A 2Z0OA 4JWEA 4EZYA 2ALWA 3EJPA 7HSCA 1ZYLA 4EZWA 1JQKA 3Q84A 3T4AG 1TQTA 3LVTA 5TKYA 2BPRA 2N3KA 5C5BB 4JNFA 2ND0A 1Y2OA 3LMFA 2EWFA 2LM0A 3T46A 3D50A 1QWUA 2OBLA 2YL9A 3T48A 4R5LA 4WV5A 4EZTA 3EJRA 4EZZA 2X3VA 4R5KA 3A98A 4NQIA 3HAHA 2YI8A 1TQSA 4E3CA 3DPOA 3EJSA 5KBPA 4JN4A 4PO2A 1OA1A 3I01A 2F7RA 3KAVA 4F01A 2RAIA 4IM2A 3VKHA 3DQGA 2FICA 3HAJA 2F7OA 2Q13A 2Q12A 4R5GA 4UDYX 3BUIA 1SUFA 4NPHA 4JNEA 3EJTA 3DPPA 1GN9A 2X3WA 4EZPA 2ND1A 4I1QA 2Z8YA 4IM3A 4WPCA 4JWIA 1GNLA 4EZVA 4HYBA 2GA9D 5C5BA 3C7NA 4EZOA 4JWCA 4HR1A 3I39X 2YL8A 3I04A 2FYVA 3QNJA 2YL6A 4ILIA 4AZBA 3DOBA 3EJUA 3DX0A 4AZCB 1O7DB 2YIAA 1CKRA 2OO2A 4F00A 3L3OM 4KIKA 1HXKA 4NSWA 1X04A 3B52X 1SU7A 2YIVX 3BVUA 1X03A 1I49A 1E9VA 3KDRA 4FZPA 1DKXA 4DYLA 3QWEA 4JL9A 1SU8A 4EZRA 2YLLA 2KHOA 1WDZA 4FL9A 2JNKA 2F18A 3SBSA 2Z0NA 3RPMA 2PY6A 4DCNC 3D51A 1DKZA 3O3MB 4M0MA 1R5EA 2LXYA 4EZNA 2RAKA 1DKYA 4EZQA 4R5JA 4AZ5A 4IM0A 2QFFA 3QA8A
chains in the Genus database with same CATH topology
1MJGA 1U00A 4R5GA 4H6IA 2OBMA 3D2EA 4UDYX 4EZUA 4IW0A 1SUFA 4NPHA 5FIGA 4ILGA 4JNEA 1YUWA 3FD9A 1DG4A 2YIBA 3DPPA 4B9QA 3RV1A 1GN9A 4EZPA 2ND1A 3H0XA 1OAOA 3O3NB 3UITA 4JLCA 2Z8YA 2YI9A 4IM3A 3D2FA 3ERCC 3C7NB 4JWIA 1GNTA 1GNLA 4EZVA 4HR1B 4EZXA 4HYBA 1UPXA 3ER9B 2GA9D 4JWEA 3C7NA 4EZOA 4EZYA 4JWCA 2JNSA 4HR1A 3OWGA 3B53X 3I39X 7HSCA 1Q5LA 3OHXM 3F7WA 3T47A 1ZYLA 3T49A 4EZWA 4JWDA 1JQKA 3I04A 3QNJA 3T4AG 4HY9A 4ILIA 3DOBA 3RV0A 5TKYA 1BPRA 2V7YA 4D8JA 5E84A 2BPRA 2N3KA 3VEBA 4WV7A 4KIKB 4I43A 4JNFA 2YIAA 1CKRA 2ND0A 3LMFA 2RT6A 2EWFA 2LM0A 4R5IA 4F00A 3L3OM 3T46A 2QXLA 4KIKA 2OBLA 3T48A 3KAWA 4R5LA 4WV5A 4EZTA 3B52X 1SU7A 4EZZA 2YIVX 4IWPA 4MQDA 4R5KA 5FLEX 4G6QA 3A98A 4EZSA 3KDRA 1E9VA 4E81A 2YI8A 4FM3A 1DKXA 4E3CA 3DPOA 4IWOA 1W9MA 4IWQA 4JL9A 1SU8A 4EZRA 3B51X 3DPQA 2KHOA 1SU6A 1E1DA 3ZEFA 3O3OB 3VEAA 2NCZA 4H6HA 4JN4A 4FL9A 4UDXX 4PO2A 1OA1A 3SBSA 3GI7A 2PY6A 3I01A 3ZEDA 2OP6A 2EX3B 1DKZA 3O3MB 4M0MA 2X5CA 4EZNA 3KAVA 3SBTB 4F01A 1E2UA 1DKYA 4EZQA 4R5JA 4IM2A 3VKHA 3DQGA 4IM0A 3ER8C 1OA0A 2QFFA 3N8EA 2WINM 2GAFD 3QA8A 4ILHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HYB A;  1U00 A;  4PO2 A;  4R5G A;  4F00 A;  4H6I A;  4JWE A;  3C7N A;  3L3O M;  4EZO A;  3D2E A;  2QXL A;  3T46 A;  4EZU A;  4EZY A;  4JWC A;  7HSC A;  1Q5L A;  4JNE A;  3T48 A;  3OHX M;  3T49 A;  3T47 A;  1YUW A;  4R5L A;  1DKZ A;  3DPP A;  4EZT A;  4B9Q A;  4JWD A;  4EZW A;  4EZZ A;  4WV5 A;  1DG4 A;  4EZP A;  4R5K A;  3QNJ A;  3T4A G;  4EZN A;  4EZS A;  3H0X A;  4HY9 A;  2OP6 A;  4E81 A;  4F01 A;  3DOB A;  1DKX A;  3DPO A;  5TKY A;  1BPR A;  2V7Y A;  1DKY A;  5E84 A;  4EZQ A;  2BPR A;  3D2F A;  4R5J A;  3C7N B;  4JWI A;  4WV7 A;  4EZR A;  4JNF A;  4EZV A;  4EZX A;  3DQG A;  3DPQ A;  2KHO A;  1CKR A;  2QFF A;  3N8E A;  2WIN M;  4FL9 A;  4H6H A;  4R5I A;  4JN4 A; 
#chains in the Genus database with same CATH topology
 1MJG A;  4H6I A;  4IW0 A;  1TQU A;  4ILG A;  1YUW A;  4WPE A;  2F1A A;  2F7Q A;  2MI7 A;  1R33 A;  3HAI A;  2ZXQ A;  2Z0V A;  3D52 A;  2YI9 A;  3D2F A;  3ERC C;  1URU A;  2D4C A;  3CVR A;  3ABH A;  3BLB A;  3BVW A;  1UPX A;  3ER9 B;  4AZ7 A;  3CAZ A;  1LQ7 A;  3B53 X;  4FZS A;  3EJQ A;  1Q5L A;  3OHX M;  1TQV A;  4HY9 A;  1YWM A;  2C08 A;  2V7Y A;  4D8J A;  2WYH A;  5E84 A;  1I4T A;  2RT6 A;  2F7P A;  3G9G A;  3BVX A;  3DYT A;  4BNE A;  2V0O A;  4IWP A;  4MQD A;  5FLE X;  4G6Q A;  4EZS A;  4IWO A;  3D4Y A;  4IWQ A;  2EFL A;  3B51 X;  3QE6 A;  3DPQ A;  4AZH A;  3CZS A;  1SU6 A;  3ZEF A;  3O3O B;  3VEA A;  4UDX X;  2RAJ A;  2EX3 B;  2O0I 1;  2X5C A;  3BUP A;  3PLT A;  3SBT B;  3BUQ A;  3DDF A;  3ACO A;  3BUB A;  1E2U A;  2YKT A;  3DX2 A;  3BUD A;  2YLA A;  3ER8 C;  2WIN M;  1HWW A;  4ILH B;  1U00 A;  2OBM A;  2X3X A;  3D2E A;  4EZU A;  1O7D C;  2OW7 A;  5FIG A;  1DG4 A;  2YIB A;  4B9Q A;  3RV1 A;  1TQW A;  4AZ6 A;  3O3N B;  4JLC A;  3SYV A;  2F1B A;  1I4D A;  3C7N B;  1GNT A;  3I2W A;  4HR1 B;  3CKD A;  4EZX A;  1HTY A;  2JNS A;  3OWG A;  3Q0K A;  3M3W A;  3F7W A;  3T47 A;  3T49 A;  4JWD A;  2YL5 A;  3LLL A;  3RV0 A;  1QWN A;  1BPR A;  3VEB A;  4WV7 A;  4KIK B;  4I43 A;  2EFK A;  2D1L A;  4R5I A;  2QXL A;  1QX1 A;  4AZC A;  3KAW A;  4H8S A;  2GF4 A;  1I4L A;  4E81 A;  3DX1 A;  4FM3 A;  3SOG A;  3D4Z A;  3DX4 A;  1W9M A;  4FZO A;  2QKW A;  2OZN B;  1E1D A;  3OK8 A;  2NCZ A;  4H6H A;  3QNI A;  3GI7 A;  2ELB A;  3ZED A;  2OP6 A;  1R34 A;  4ATM A;  1ZWW A;  3DX3 A;  1PS3 A;  3CZN A;  4AKV A;  3L3P A;  3BVT A;  1OA0 A;  3N8E A;  2GAF D;  3CV5 A;  2WYI A;  3BVV A;  3FD9 A;  3DDG A;  2PMR A;  4AVM A;  3H0X A;  1OAO A;  4AZG A;  3UIT A;  4AZI A;  2OW6 A;  2Z0O A;  4JWE A;  4EZY A;  2ALW A;  3EJP A;  7HSC A;  1ZYL A;  4EZW A;  1JQK A;  3Q84 A;  3T4A G;  1TQT A;  3LVT A;  5TKY A;  2BPR A;  2N3K A;  5C5B B;  4JNF A;  2ND0 A;  1Y2O A;  3LMF A;  2EWF A;  2LM0 A;  3T46 A;  3D50 A;  1QWU A;  2OBL A;  2YL9 A;  3T48 A;  4R5L A;  4WV5 A;  4EZT A;  3EJR A;  4EZZ A;  2X3V A;  4R5K A;  3A98 A;  4NQI A;  3HAH A;  2YI8 A;  1TQS A;  4E3C A;  3DPO A;  3EJS A;  5KBP A;  4JN4 A;  4PO2 A;  1OA1 A;  3I01 A;  2F7R A;  3KAV A;  4F01 A;  2RAI A;  4IM2 A;  3VKH A;  3DQG A;  2FIC A;  3HAJ A;  2F7O A;  2Q13 A;  2Q12 A;  4R5G A;  4UDY X;  3BUI A;  1SUF A;  4NPH A;  4JNE A;  3EJT A;  3DPP A;  1GN9 A;  2X3W A;  4EZP A;  2ND1 A;  4I1Q A;  2Z8Y A;  4IM3 A;  4WPC A;  4JWI A;  1GNL A;  4EZV A;  4HYB A;  2GA9 D;  5C5B A;  3C7N A;  4EZO A;  4JWC A;  4HR1 A;  3I39 X;  2YL8 A;  3I04 A;  2FYV A;  3QNJ A;  2YL6 A;  4ILI A;  4AZB A;  3DOB A;  3EJU A;  3DX0 A;  4AZC B;  1O7D B;  2YIA A;  1CKR A;  2OO2 A;  4F00 A;  3L3O M;  4KIK A;  1HXK A;  4NSW A;  1X04 A;  3B52 X;  1SU7 A;  2YIV X;  3BVU A;  1X03 A;  1I49 A;  1E9V A;  3KDR A;  4FZP A;  1DKX A;  4DYL A;  3QWE A;  4JL9 A;  1SU8 A;  4EZR A;  2YLL A;  2KHO A;  1WDZ A;  4FL9 A;  2JNK A;  2F18 A;  3SBS A;  2Z0N A;  3RPM A;  2PY6 A;  4DCN C;  3D51 A;  1DKZ A;  3O3M B;  4M0M A;  1R5E A;  2LXY A;  4EZN A;  2RAK A;  1DKY A;  4EZQ A;  4R5J A;  4AZ5 A;  4IM0 A;  2QFF A;  3QA8 A; 
#chains in the Genus database with same CATH homology
 1MJG A;  1U00 A;  4R5G A;  4H6I A;  2OBM A;  3D2E A;  4UDY X;  4EZU A;  4IW0 A;  1SUF A;  4NPH A;  5FIG A;  4ILG A;  4JNE A;  1YUW A;  3FD9 A;  1DG4 A;  2YIB A;  3DPP A;  4B9Q A;  3RV1 A;  1GN9 A;  4EZP A;  2ND1 A;  3H0X A;  1OAO A;  3O3N B;  3UIT A;  4JLC A;  2Z8Y A;  2YI9 A;  4IM3 A;  3D2F A;  3ERC C;  3C7N B;  4JWI A;  1GNT A;  1GNL A;  4EZV A;  4HR1 B;  4EZX A;  4HYB A;  1UPX A;  3ER9 B;  2GA9 D;  4JWE A;  3C7N A;  4EZO A;  4EZY A;  4JWC A;  2JNS A;  4HR1 A;  3OWG A;  3B53 X;  3I39 X;  7HSC A;  1Q5L A;  3OHX M;  3F7W A;  3T47 A;  1ZYL A;  3T49 A;  4EZW A;  4JWD A;  1JQK A;  3I04 A;  3QNJ A;  3T4A G;  4HY9 A;  4ILI A;  3DOB A;  3RV0 A;  5TKY A;  1BPR A;  2V7Y A;  4D8J A;  5E84 A;  2BPR A;  2N3K A;  3VEB A;  4WV7 A;  4KIK B;  4I43 A;  4JNF A;  2YIA A;  1CKR A;  2ND0 A;  3LMF A;  2RT6 A;  2EWF A;  2LM0 A;  4R5I A;  4F00 A;  3L3O M;  3T46 A;  2QXL A;  4KIK A;  2OBL A;  3T48 A;  3KAW A;  4R5L A;  4WV5 A;  4EZT A;  3B52 X;  1SU7 A;  4EZZ A;  2YIV X;  4IWP A;  4MQD A;  4R5K A;  5FLE X;  4G6Q A;  3A98 A;  4EZS A;  3KDR A;  1E9V A;  4E81 A;  2YI8 A;  4FM3 A;  1DKX A;  4E3C A;  3DPO A;  4IWO A;  1W9M A;  4IWQ A;  4JL9 A;  1SU8 A;  4EZR A;  3B51 X;  3DPQ A;  2KHO A;  1SU6 A;  1E1D A;  3ZEF A;  3O3O B;  3VEA A;  2NCZ A;  4H6H A;  4JN4 A;  4FL9 A;  4UDX X;  4PO2 A;  1OA1 A;  3SBS A;  3GI7 A;  2PY6 A;  3I01 A;  3ZED A;  2OP6 A;  2EX3 B;  1DKZ A;  3O3M B;  4M0M A;  2X5C A;  4EZN A;  3KAV A;  3SBT B;  4F01 A;  1E2U A;  1DKY A;  4EZQ A;  4R5J A;  4IM2 A;  3VKH A;  3DQG A;  4IM0 A;  3ER8 C;  1OA0 A;  2QFF A;  3N8E A;  2WIN M;  2GAF D;  3QA8 A;  4ILH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...