4E81A

Crystal structure of the substrate binding domain of e.coli dnak in complex with a short apidaecin peptide
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
214
structure length
214
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Chaperone protein DnaK
publication title Api88 is a novel antibacterial designer Peptide to treat systemic infections with multidrug-resistant gram-negative pathogens.
pubmed doi rcsb
source organism Escherichia coli
total genus 63
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4e81A02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4e81A01
4EZQA 3T47A 4R5JA 4HYBA 1DKZA 2OP6A 3N8EA 1CKRA 4WV7A 4EZUA 4JNFA 4JNEA 4F01A 4WV5A 4JN4A 2QXLA 4R5KA 3T49A 4EZPA 4HY9A 4JWDA 3T4AG 3T48A 5E84A 1DKXA 4EZVA 1YUWA 4E81A 3C7NA 4H6HA 3DPPA 2WINM 2V7YA 3OHXM 3C7NB 1DKYA 4EZWA 4JWIA 4EZRA 7HSCA 4EZZA 4EZNA 4PO2A 1Q5LA 4B9QA 3H0XA 3DOBA 2KHOA 3T46A 4R5IA 4JWEA 2QFFA 4EZSA 3L3OM 2BPRA 3DQGA 4R5GA 3D2EA 4R5LA 5TKYA 4H6IA 4EZYA 1U00A 3DPOA 4EZOA 4JWCA 4EZTA 4EZXA 1BPRA 4FL9A 1DG4A 3DPQA 3QNJA 3D2FA 4F00A
chains in the Genus database with same CATH superfamily
1GNLA 2QKWA 1R33A 4F01A 2OW6A 2F7QA 3O3OB 4ILGA 2D1LA 4JWIA 2ZXQA 2LXYA 1X04A 4B9QA 4G6QA 2JNSA 4R5LA 2ALWA 1DG4A 3D50A 2ND0A 3EJPA 4EZUA 4WPEA 4JNEA 4UDXX 3ACOA 4I1QA 2OBLA 3C7NA 2Z8YA 2D4CA 2V0OA 4H8SA 3EJRA 4EZYA 4EZTA 3L3PA 1SU6A 2FICA 3DX0A 4JNFA 5C5BA 2QXLA 4AZ5A 1YWMA 2PMRA 3BLBA 3OWGA 3DPPA 3DX1A 3OK8A 7HSCA 4EZZA 4EZNA 4PO2A 1E9VA 2RAJA 3H0XA 2KHOA 2X3WA 3I39X 1HTYA 3B52X 2YIVX 3LMFA 2X3VA 3QWEA 3N8EA 3F7WA 1MJGA 3KAVA 3D52A 3DX2A 4EZPA 5E84A 4D8JA 2YL8A 2GAFD 4JL9A 4AKVA 4NQIA 1TQWA 2Z0NA 4KIKA 1GN9A 3A98A 2GA9D 4DYLA 4EZQA 3SOGA 4ATMA 4WV7A 1O7DC 4DCNC 2YI9A 1ZYLA 4JLCA 1SUFA 3OHXM 4AZIA 1E2UA 2YLLA 3CAZA 3BUBA 4JWEA 3DQGA 3EJQA 3EJUA 5FIGA 4HR1B 2OO2A 2YL9A 3B51X 3ER9B 4F00A 3T47A 2YIAA 3VEBA 3BVXA 4R5KA 4EZVA 2F7PA 2LM0A 1OA1A 1Q5LA 3BUDA 2Q13A 2N3KA 2BPRA 2C08A 3CV5A 3KAWA 3I01A 3D4YA 1OAOA 4BNEA 2WINM 3BUPA 2OP6A 3I04A 4NSWA 1SU8A 1UPXA 3QNIA 1DKZA 3SBTB 3HAJA 1DKXA 3I2WA 2X3XA 4AZCB 1OA0A 3DOBA 3T46A 4ILIA 1TQTA 4EZSA 5KBPA 1BPRA 2GF4A 1I4LA 4UDYX 3B53X 2JNKA 4JN4A 4E3CA 4HY9A 2YI8A 4H6HA 1QWNA 2ELBA 3DX4A 1HWWA 1U00A 3RV0A 3LLLA 3HAIA 1LQ7A 3M3WA 3PLTA 3FD9A 2WYHA 1QX1A 4JWDA 3D4ZA 2O0I1 2YL5A 3BVTA 4EZWA 2X5CA 4IW0A 3O3NB 3G9GA 4IWQA 4AZBA 4H6IA 1PS3A 4FL9A 3BVUA 2EFKA 3EJTA 1YUWA 4AZ6A 3ERCC 4ILHB 2V7YA 3C7NB 2RAKA 3KDRA 3RV1A 2NCZA 2QFFA 3L3OM 3DDGA 2F18A 3DPQA 1TQVA 3QE6A 3GI7A 3BVVA 4AZGA 3Q0KA 4NPHA 5C5BB 3DDFA 3QA8A 4FZPA 4AZHA 2RT6A 3CZSA 3BUIA 1ZWWA 2F1BA 4AVMA 4EZOA 1QWUA 3BUQA 3QNJA 3D2FA 2Q12A 2YLAA 2F7RA 1URUA 4M0MA 3CKDA 3VKHA 3DX3A 1HXKA 1WDZA 4KIKB 2Z0VA 4JWCA 4FZOA 3HAHA 1TQSA 3T48A 2OW7A 2EX3B 4IWPA 2OBMA 4IM3A 3VEAA 4MQDA 2WYIA 4HR1A 3DYTA 2F1AA 1W9MA 4R5JA 2EWFA 1R34A 3SYVA 4WV5A 3UITA 3T49A 2Z0OA 3T4AG 2FYVA 2F7OA 1DKYA 1I49A 4R5IA 4IWOA 3DPOA 2ND1A 4I43A 4AZ7A 3SBSA 4HYBA 4WPCA 4IM2A 1GNTA 3D51A 1Y2OA 4FM3A 3ER8C 1E1DA 4AZCA 3BVWA 3LVTA 4EZRA 2EFLA 1JQKA 2OZNB 3CVRA 2MI7A 3Q84A 1X03A 5FLEX 2YL6A 3CZNA 2YIBA 1CKRA 2YKTA 4IM0A 3ABHA 4E81A 3RPMA 1TQUA 2RAIA 3ZEDA 1I4TA 3O3MB 2PY6A 3EJSA 4FZSA 3ZEFA 1O7DB 4R5GA 3D2EA 1SU7A 1R5EA 5TKYA 4EZXA 1I4DA
chains in the Genus database with same CATH topology
1GNLA 4EZQA 2EX3B 4IWPA 4WV7A 4F01A 2OBMA 4IM3A 2YI9A 1ZYLA 4JWDA 4JLCA 3VEAA 3O3OB 1SUFA 3OHXM 4ILGA 4MQDA 1E2UA 4EZWA 4JWIA 4B9QA 2X5CA 4IW0A 3O3NB 4JWEA 4G6QA 4HR1A 3DQGA 4IWQA 2JNSA 4R5LA 5FIGA 4HR1B 4H6IA 4FL9A 1DG4A 3B51X 3ER9B 2ND0A 4F00A 1W9MA 3T47A 2YIAA 4R5JA 2EWFA 4EZUA 4WV5A 4JNEA 3VEBA 4UDXX 4R5KA 3T49A 3UITA 4EZVA 3T4AG 2OBLA 1YUWA 3ERCC 3C7NA 4ILHB 2V7YA 3C7NB 1DKYA 2Z8YA 2LM0A 1OA1A 1Q5LA 3KDRA 4R5IA 3RV1A 2N3KA 2NCZA 2QFFA 2BPRA 3L3OM 4IWOA 3KAWA 3I01A 4EZYA 3DPOA 1OAOA 4EZTA 2ND1A 3DPQA 2WINM 1SU6A 4I43A 2OP6A 3I04A 1SU8A 1UPXA 3SBSA 4HYBA 1DKZA 4IM2A 1GNTA 4JNFA 3SBTB 3GI7A 2QXLA 4NPHA 1DKXA 4FM3A 3ER8C 1E1DA 3QA8A 3OWGA 3DPPA 2RT6A 1OA0A 4EZRA 7HSCA 4EZZA 4EZNA 4PO2A 1E9VA 3H0XA 3DOBA 1JQKA 2KHOA 3T46A 4ILIA 4EZSA 3I39X 3B52X 1BPRA 2YIVX 4EZOA 3LMFA 3QNJA 3D2FA 4UDYX 5FLEX 3B53X 3N8EA 3F7WA 1CKRA 2YIBA 4M0MA 1MJGA 4IM0A 4JN4A 3KAVA 4E3CA 4EZPA 4HY9A 5E84A 4E81A 2YI8A 3ZEDA 4H6HA 4D8JA 3VKHA 2GAFD 3O3MB 2PY6A 4JL9A 3ZEFA 4KIKA 4R5GA 3D2EA 1SU7A 5TKYA 4KIKB 1GN9A 1U00A 3RV0A 4JWCA 4EZXA 3A98A 2GA9D 3T48A 3FD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZQ A;  3T47 A;  4R5J A;  4HYB A;  1DKZ A;  2OP6 A;  3N8E A;  1CKR A;  4WV7 A;  4EZU A;  4JNF A;  4JNE A;  4F01 A;  4WV5 A;  4JN4 A;  2QXL A;  4R5K A;  3T49 A;  4EZP A;  4HY9 A;  4JWD A;  3T4A G;  3T48 A;  5E84 A;  1DKX A;  4EZV A;  1YUW A;  4E81 A;  3C7N A;  4H6H A;  3DPP A;  2WIN M;  2V7Y A;  3OHX M;  3C7N B;  1DKY A;  4EZW A;  4JWI A;  4EZR A;  7HSC A;  4EZZ A;  4EZN A;  4PO2 A;  1Q5L A;  4B9Q A;  3H0X A;  3DOB A;  2KHO A;  3T46 A;  4R5I A;  4JWE A;  2QFF A;  4EZS A;  3L3O M;  2BPR A;  3DQG A;  4R5G A;  3D2E A;  4R5L A;  5TKY A;  4H6I A;  4EZY A;  1U00 A;  3DPO A;  4EZO A;  4JWC A;  4EZT A;  4EZX A;  1BPR A;  4FL9 A;  1DG4 A;  3DPQ A;  3QNJ A;  3D2F A;  4F00 A; 
#chains in the Genus database with same CATH topology
 1GNL A;  2QKW A;  1R33 A;  4F01 A;  2OW6 A;  2F7Q A;  3O3O B;  4ILG A;  2D1L A;  4JWI A;  2ZXQ A;  2LXY A;  1X04 A;  4B9Q A;  4G6Q A;  2JNS A;  4R5L A;  2ALW A;  1DG4 A;  3D50 A;  2ND0 A;  3EJP A;  4EZU A;  4WPE A;  4JNE A;  4UDX X;  3ACO A;  4I1Q A;  2OBL A;  3C7N A;  2Z8Y A;  2D4C A;  2V0O A;  4H8S A;  3EJR A;  4EZY A;  4EZT A;  3L3P A;  1SU6 A;  2FIC A;  3DX0 A;  4JNF A;  5C5B A;  2QXL A;  4AZ5 A;  1YWM A;  2PMR A;  3BLB A;  3OWG A;  3DPP A;  3DX1 A;  3OK8 A;  7HSC A;  4EZZ A;  4EZN A;  4PO2 A;  1E9V A;  2RAJ A;  3H0X A;  2KHO A;  2X3W A;  3I39 X;  1HTY A;  3B52 X;  2YIV X;  3LMF A;  2X3V A;  3QWE A;  3N8E A;  3F7W A;  1MJG A;  3KAV A;  3D52 A;  3DX2 A;  4EZP A;  5E84 A;  4D8J A;  2YL8 A;  2GAF D;  4JL9 A;  4AKV A;  4NQI A;  1TQW A;  2Z0N A;  4KIK A;  1GN9 A;  3A98 A;  2GA9 D;  4DYL A;  4EZQ A;  3SOG A;  4ATM A;  4WV7 A;  1O7D C;  4DCN C;  2YI9 A;  1ZYL A;  4JLC A;  1SUF A;  3OHX M;  4AZI A;  1E2U A;  2YLL A;  3CAZ A;  3BUB A;  4JWE A;  3DQG A;  3EJQ A;  3EJU A;  5FIG A;  4HR1 B;  2OO2 A;  2YL9 A;  3B51 X;  3ER9 B;  4F00 A;  3T47 A;  2YIA A;  3VEB A;  3BVX A;  4R5K A;  4EZV A;  2F7P A;  2LM0 A;  1OA1 A;  1Q5L A;  3BUD A;  2Q13 A;  2N3K A;  2BPR A;  2C08 A;  3CV5 A;  3KAW A;  3I01 A;  3D4Y A;  1OAO A;  4BNE A;  2WIN M;  3BUP A;  2OP6 A;  3I04 A;  4NSW A;  1SU8 A;  1UPX A;  3QNI A;  1DKZ A;  3SBT B;  3HAJ A;  1DKX A;  3I2W A;  2X3X A;  4AZC B;  1OA0 A;  3DOB A;  3T46 A;  4ILI A;  1TQT A;  4EZS A;  5KBP A;  1BPR A;  2GF4 A;  1I4L A;  4UDY X;  3B53 X;  2JNK A;  4JN4 A;  4E3C A;  4HY9 A;  2YI8 A;  4H6H A;  1QWN A;  2ELB A;  3DX4 A;  1HWW A;  1U00 A;  3RV0 A;  3LLL A;  3HAI A;  1LQ7 A;  3M3W A;  3PLT A;  3FD9 A;  2WYH A;  1QX1 A;  4JWD A;  3D4Z A;  2O0I 1;  2YL5 A;  3BVT A;  4EZW A;  2X5C A;  4IW0 A;  3O3N B;  3G9G A;  4IWQ A;  4AZB A;  4H6I A;  1PS3 A;  4FL9 A;  3BVU A;  2EFK A;  3EJT A;  1YUW A;  4AZ6 A;  3ERC C;  4ILH B;  2V7Y A;  3C7N B;  2RAK A;  3KDR A;  3RV1 A;  2NCZ A;  2QFF A;  3L3O M;  3DDG A;  2F18 A;  3DPQ A;  1TQV A;  3QE6 A;  3GI7 A;  3BVV A;  4AZG A;  3Q0K A;  4NPH A;  5C5B B;  3DDF A;  3QA8 A;  4FZP A;  4AZH A;  2RT6 A;  3CZS A;  3BUI A;  1ZWW A;  2F1B A;  4AVM A;  4EZO A;  1QWU A;  3BUQ A;  3QNJ A;  3D2F A;  2Q12 A;  2YLA A;  2F7R A;  1URU A;  4M0M A;  3CKD A;  3VKH A;  3DX3 A;  1HXK A;  1WDZ A;  4KIK B;  2Z0V A;  4JWC A;  4FZO A;  3HAH A;  1TQS A;  3T48 A;  2OW7 A;  2EX3 B;  4IWP A;  2OBM A;  4IM3 A;  3VEA A;  4MQD A;  2WYI A;  4HR1 A;  3DYT A;  2F1A A;  1W9M A;  4R5J A;  2EWF A;  1R34 A;  3SYV A;  4WV5 A;  3UIT A;  3T49 A;  2Z0O A;  3T4A G;  2FYV A;  2F7O A;  1DKY A;  1I49 A;  4R5I A;  4IWO A;  3DPO A;  2ND1 A;  4I43 A;  4AZ7 A;  3SBS A;  4HYB A;  4WPC A;  4IM2 A;  1GNT A;  3D51 A;  1Y2O A;  4FM3 A;  3ER8 C;  1E1D A;  4AZC A;  3BVW A;  3LVT A;  4EZR A;  2EFL A;  1JQK A;  2OZN B;  3CVR A;  2MI7 A;  3Q84 A;  1X03 A;  5FLE X;  2YL6 A;  3CZN A;  2YIB A;  1CKR A;  2YKT A;  4IM0 A;  3ABH A;  4E81 A;  3RPM A;  1TQU A;  2RAI A;  3ZED A;  1I4T A;  3O3M B;  2PY6 A;  3EJS A;  4FZS A;  3ZEF A;  1O7D B;  4R5G A;  3D2E A;  1SU7 A;  1R5E A;  5TKY A;  4EZX A;  1I4D A; 
#chains in the Genus database with same CATH homology
 1GNL A;  4EZQ A;  2EX3 B;  4IWP A;  4WV7 A;  4F01 A;  2OBM A;  4IM3 A;  2YI9 A;  1ZYL A;  4JWD A;  4JLC A;  3VEA A;  3O3O B;  1SUF A;  3OHX M;  4ILG A;  4MQD A;  1E2U A;  4EZW A;  4JWI A;  4B9Q A;  2X5C A;  4IW0 A;  3O3N B;  4JWE A;  4G6Q A;  4HR1 A;  3DQG A;  4IWQ A;  2JNS A;  4R5L A;  5FIG A;  4HR1 B;  4H6I A;  4FL9 A;  1DG4 A;  3B51 X;  3ER9 B;  2ND0 A;  4F00 A;  1W9M A;  3T47 A;  2YIA A;  4R5J A;  2EWF A;  4EZU A;  4WV5 A;  4JNE A;  3VEB A;  4UDX X;  4R5K A;  3T49 A;  3UIT A;  4EZV A;  3T4A G;  2OBL A;  1YUW A;  3ERC C;  3C7N A;  4ILH B;  2V7Y A;  3C7N B;  1DKY A;  2Z8Y A;  2LM0 A;  1OA1 A;  1Q5L A;  3KDR A;  4R5I A;  3RV1 A;  2N3K A;  2NCZ A;  2QFF A;  2BPR A;  3L3O M;  4IWO A;  3KAW A;  3I01 A;  4EZY A;  3DPO A;  1OAO A;  4EZT A;  2ND1 A;  3DPQ A;  2WIN M;  1SU6 A;  4I43 A;  2OP6 A;  3I04 A;  1SU8 A;  1UPX A;  3SBS A;  4HYB A;  1DKZ A;  4IM2 A;  1GNT A;  4JNF A;  3SBT B;  3GI7 A;  2QXL A;  4NPH A;  1DKX A;  4FM3 A;  3ER8 C;  1E1D A;  3QA8 A;  3OWG A;  3DPP A;  2RT6 A;  1OA0 A;  4EZR A;  7HSC A;  4EZZ A;  4EZN A;  4PO2 A;  1E9V A;  3H0X A;  3DOB A;  1JQK A;  2KHO A;  3T46 A;  4ILI A;  4EZS A;  3I39 X;  3B52 X;  1BPR A;  2YIV X;  4EZO A;  3LMF A;  3QNJ A;  3D2F A;  4UDY X;  5FLE X;  3B53 X;  3N8E A;  3F7W A;  1CKR A;  2YIB A;  4M0M A;  1MJG A;  4IM0 A;  4JN4 A;  3KAV A;  4E3C A;  4EZP A;  4HY9 A;  5E84 A;  4E81 A;  2YI8 A;  3ZED A;  4H6H A;  4D8J A;  3VKH A;  2GAF D;  3O3M B;  2PY6 A;  4JL9 A;  3ZEF A;  4KIK A;  4R5G A;  3D2E A;  1SU7 A;  5TKY A;  4KIK B;  1GN9 A;  1U00 A;  3RV0 A;  4JWC A;  4EZX A;  3A98 A;  2GA9 D;  3T48 A;  3FD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...