4EZQA

Crystal structure of the substrate binding domain of e.coli dnak in complex with the c-terminal part of pyrrhocoricin (residues 12 to 20)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
216
structure length
216
Chain Sequence
b'VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
total genus 63
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezqA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezqA01
3T48A 3T4AG 2BPRA 1BPRA 1DKZA 3D2EA 4E81A 3T49A 3C7NB 3C7NA 4JNFA 3OHXM 4JWCA 2OP6A 1U00A 4R5LA 4H6IA 3DPPA 4EZOA 4WV7A 3D2FA 3DQGA 4FL9A 4EZTA 4R5GA 2WINM 2KHOA 3DPOA 4R5JA 5TKYA 4EZUA 3QNJA 1YUWA 1DG4A 2QXLA 4B9QA 4EZNA 2V7YA 1CKRA 4PO2A 3DPQA 4JNEA 3T46A 4HY9A 4F01A 4EZRA 3N8EA 3T47A 4R5KA 5E84A 4EZYA 3DOBA 7HSCA 4JWEA 4EZXA 4EZQA 4F00A 1DKYA 4JWDA 4EZWA 4H6HA 4HYBA 4R5IA 4EZSA 1Q5LA 4WV5A 1DKXA 4EZPA 3L3OM 4JWIA 4EZZA 3H0XA 2QFFA 4EZVA 4JN4A
chains in the Genus database with same CATH superfamily
1E9VA 1QWNA 2F1AA 3CAZA 3T48A 2F1BA 1DKZA 4JLCA 3SYVA 4KIKB 3OWGA 1QWUA 4AZCB 2OW6A 1E2UA 3QWEA 3BUBA 3O3MB 3ZEDA 1E1DA 4DCNC 3BUDA 4JWCA 2RT6A 4ILHB 1TQWA 2FYVA 2YI9A 3I04A 4F01A 4ILIA 4JWDA 4HYBA 4HR1A 2FICA 3CVRA 4AZ5A 2GF4A 4JNFA 3D4ZA 2PMRA 2YIBA 2YL5A 2Z0VA 3ABHA 3BVXA 4AZHA 4I1QA 2Q12A 4FZSA 3DPQA 4HY9A 3PLTA 4EZWA 4HR1B 4EZPA 3D50A 3I2WA 4G6QA 4ILGA 3D2EA 3SOGA 1U00A 4WPCA 4IWPA 2QKWA 1DG4A 1W9MA 2YLLA 1I4DA 1I4TA 4R5IA 3EJPA 3KDRA 4AZ7A 4EZZA 1PS3A 3I01A 2X3VA 4IM0A 2PY6A 3I39X 4IWOA 4E81A 2WYIA 4D8JA 3SBTB 3B52X 4NPHA 4KIKA 4FL9A 1TQTA 1YUWA 1R33A 4FZOA 4F00A 4ATMA 3GI7A 3DYTA 3LVTA 3H0XA 2QFFA 1OA0A 2V0OA 2EFKA 1URUA 3CZNA 2YIVX 4H8SA 3LLLA 4AZ6A 4EZUA 3DX3A 1GN9A 2WYHA 3ACOA 2F7PA 2ND1A 4UDXX 3EJUA 4EZXA 4EZQA 1DKYA 1O7DB 3RV1A 3D4YA 4I43A 3BVVA 3DPPA 1HWWA 3EJSA 2WINM 3DX1A 3HAIA 4B9QA 2V7YA 3DDFA 2JNSA 2D1LA 4EZRA 3B53X 3DOBA 2YLAA 2D4CA 2ND0A 3L3OM 3BVTA 2Z0NA 3M3WA 3A98A 4H6IA 1SU6A 1UPXA 3ERCC 5TKYA 3QNJA 5FIGA 1O7DC 3QE6A 3D52A 4NSWA 4EZVA 5C5BA 3CKDA 3G9GA 1HXKA 2X3XA 4R5LA 4IM2A 1X04A 1TQVA 2KHOA 1R5EA 3D51A 3BUQA 2ELBA 2LM0A 4JWEA 4H6HA 1Q5LA 3LMFA 1SUFA 2RAJA 5C5BB 4AZBA 2BPRA 3C7NA 4JL9A 2OP6A 2Z8YA 4E3CA 2EX3B 2N3KA 2O0I1 2X5CA 3BUPA 2GA9D 3ZEFA 2YIAA 3VEBA 3T46A 3OK8A 3F7WA 2NCZA 3O3OB 3O3NB 4JWIA 2F7OA 4IWQA 3KAWA 2EWFA 4DYLA 2OZNB 2JNKA 3L3PA 3BVUA 3VEAA 3C7NB 3BLBA 2YKTA 4IW0A 1GNTA 3D2FA 3DX0A 3DQGA 1R34A 2MI7A 3EJQA 1QX1A 1OAOA 2YI8A 2ALWA 2OBMA 3SBSA 3ER9B 1X03A 2YL8A 4BNEA 2X3WA 3KAVA 4WPEA 1HTYA 1TQSA 2RAKA 3QNIA 4AZGA 4AZIA 3T47A 3HAJA 4EZSA 1SU7A 3DX2A 2F7RA 3FD9A 1ZYLA 3DPOA 1LQ7A 4EZNA 2Q13A 4IM3A 4EZYA 4NQIA 3RV0A 3VKHA 3DDGA 4JN4A 5KBPA 1ZWWA 4AVMA 2YL6A 3CV5A 3EJRA 4R5GA 2RAIA 4FZPA 2QXLA 3EJTA 1CKRA 2F18A 4PO2A 1Y2OA 3QA8A 4UDYX 4JNEA 3Q84A 4AKVA 7HSCA 1DKXA 5FLEX 3Q0KA 3B51X 3T4AG 3UITA 1SU8A 2Z0OA 2C08A 2F7QA 3BUIA 4EZOA 4WV7A 3ER8C 4EZTA 4R5JA 2OBLA 3DX4A 3N8EA 1MJGA 4R5KA 5E84A 2OO2A 4WV5A 3CZSA 1BPRA 3T49A 1I4LA 3BVWA 3OHXM 2LXYA 1OA1A 2ZXQA 4FM3A 4MQDA 2OW7A 3RPMA 1I49A 2YL9A 1JQKA 4AZCA 3HAHA 4M0MA 2EFLA 2GAFD 1TQUA 1WDZA 1GNLA 1YWMA
chains in the Genus database with same CATH topology
1E9VA 3I39X 3T48A 1DKZA 3FD9A 4IWOA 4E81A 4JLCA 4R5LA 1ZYLA 4D8JA 4IM2A 3SBTB 4KIKB 3B52X 4NPHA 4KIKA 4FL9A 3OWGA 2KHOA 3DPOA 1YUWA 4EZNA 2LM0A 4IM3A 4EZYA 4JWEA 4F00A 1E2UA 4H6HA 1Q5LA 3RV0A 3GI7A 3LMFA 1SUFA 3VKHA 3O3MB 3H0XA 2QFFA 1OA0A 4JN4A 3ZEDA 2BPRA 1E1DA 3C7NA 4JL9A 4JWCA 2OP6A 2Z8YA 4E3CA 2YIVX 2RT6A 2EX3B 4ILHB 2N3KA 4R5GA 2X5CA 3ZEFA 2GA9D 4EZUA 2YIAA 1GN9A 2QXLA 1CKRA 2YI9A 4PO2A 3QA8A 4UDYX 3VEBA 4JNEA 3T46A 2ND1A 3I04A 4F01A 4UDXX 4EZXA 3F7WA 4EZQA 2NCZA 1DKYA 4JWDA 4ILIA 7HSCA 4HYBA 4HR1A 3O3OB 4IM0A 1DKXA 3O3NB 5FLEX 4JWIA 4IWQA 3B51X 3KAWA 2EWFA 3T4AG 3UITA 1SU8A 3VEAA 3C7NB 4JNFA 3RV1A 4I43A 2YIBA 4IW0A 3DPPA 4EZOA 1GNTA 4WV7A 3D2FA 3DQGA 3ER8C 4EZTA 2WINM 4R5JA 2OBLA 4B9QA 2V7YA 3DPQA 2JNSA 4HY9A 1OAOA 2YI8A 3B53X 1MJGA 4R5KA 5E84A 4EZRA 3DOBA 3N8EA 2OBMA 4EZWA 4WV5A 4HR1B 3SBSA 3ER9B 2ND0A 4EZPA 3L3OM 4G6QA 4ILGA 1BPRA 3D2EA 3T49A 3KAVA 3A98A 3OHXM 1U00A 1OA1A 4H6IA 1SU6A 4FM3A 4MQDA 4IWPA 1UPXA 3ERCC 5TKYA 3QNJA 1DG4A 1JQKA 5FIGA 1W9MA 4M0MA 3T47A 4R5IA 4EZSA 3KDRA 4EZZA 2GAFD 4EZVA 1GNLA 3I01A 1SU7A 2PY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T48 A;  3T4A G;  2BPR A;  1BPR A;  1DKZ A;  3D2E A;  4E81 A;  3T49 A;  3C7N B;  3C7N A;  4JNF A;  3OHX M;  4JWC A;  2OP6 A;  1U00 A;  4R5L A;  4H6I A;  3DPP A;  4EZO A;  4WV7 A;  3D2F A;  3DQG A;  4FL9 A;  4EZT A;  4R5G A;  2WIN M;  2KHO A;  3DPO A;  4R5J A;  5TKY A;  4EZU A;  3QNJ A;  1YUW A;  1DG4 A;  2QXL A;  4B9Q A;  4EZN A;  2V7Y A;  1CKR A;  4PO2 A;  3DPQ A;  4JNE A;  3T46 A;  4HY9 A;  4F01 A;  4EZR A;  3N8E A;  3T47 A;  4R5K A;  5E84 A;  4EZY A;  3DOB A;  7HSC A;  4JWE A;  4EZX A;  4EZQ A;  4F00 A;  1DKY A;  4JWD A;  4EZW A;  4H6H A;  4HYB A;  4R5I A;  4EZS A;  1Q5L A;  4WV5 A;  1DKX A;  4EZP A;  3L3O M;  4JWI A;  4EZZ A;  3H0X A;  2QFF A;  4EZV A;  4JN4 A; 
#chains in the Genus database with same CATH topology
 1E9V A;  1QWN A;  2F1A A;  3CAZ A;  3T48 A;  2F1B A;  1DKZ A;  4JLC A;  3SYV A;  4KIK B;  3OWG A;  1QWU A;  4AZC B;  2OW6 A;  1E2U A;  3QWE A;  3BUB A;  3O3M B;  3ZED A;  1E1D A;  4DCN C;  3BUD A;  4JWC A;  2RT6 A;  4ILH B;  1TQW A;  2FYV A;  2YI9 A;  3I04 A;  4F01 A;  4ILI A;  4JWD A;  4HYB A;  4HR1 A;  2FIC A;  3CVR A;  4AZ5 A;  2GF4 A;  4JNF A;  3D4Z A;  2PMR A;  2YIB A;  2YL5 A;  2Z0V A;  3ABH A;  3BVX A;  4AZH A;  4I1Q A;  2Q12 A;  4FZS A;  3DPQ A;  4HY9 A;  3PLT A;  4EZW A;  4HR1 B;  4EZP A;  3D50 A;  3I2W A;  4G6Q A;  4ILG A;  3D2E A;  3SOG A;  1U00 A;  4WPC A;  4IWP A;  2QKW A;  1DG4 A;  1W9M A;  2YLL A;  1I4D A;  1I4T A;  4R5I A;  3EJP A;  3KDR A;  4AZ7 A;  4EZZ A;  1PS3 A;  3I01 A;  2X3V A;  4IM0 A;  2PY6 A;  3I39 X;  4IWO A;  4E81 A;  2WYI A;  4D8J A;  3SBT B;  3B52 X;  4NPH A;  4KIK A;  4FL9 A;  1TQT A;  1YUW A;  1R33 A;  4FZO A;  4F00 A;  4ATM A;  3GI7 A;  3DYT A;  3LVT A;  3H0X A;  2QFF A;  1OA0 A;  2V0O A;  2EFK A;  1URU A;  3CZN A;  2YIV X;  4H8S A;  3LLL A;  4AZ6 A;  4EZU A;  3DX3 A;  1GN9 A;  2WYH A;  3ACO A;  2F7P A;  2ND1 A;  4UDX X;  3EJU A;  4EZX A;  4EZQ A;  1DKY A;  1O7D B;  3RV1 A;  3D4Y A;  4I43 A;  3BVV A;  3DPP A;  1HWW A;  3EJS A;  2WIN M;  3DX1 A;  3HAI A;  4B9Q A;  2V7Y A;  3DDF A;  2JNS A;  2D1L A;  4EZR A;  3B53 X;  3DOB A;  2YLA A;  2D4C A;  2ND0 A;  3L3O M;  3BVT A;  2Z0N A;  3M3W A;  3A98 A;  4H6I A;  1SU6 A;  1UPX A;  3ERC C;  5TKY A;  3QNJ A;  5FIG A;  1O7D C;  3QE6 A;  3D52 A;  4NSW A;  4EZV A;  5C5B A;  3CKD A;  3G9G A;  1HXK A;  2X3X A;  4R5L A;  4IM2 A;  1X04 A;  1TQV A;  2KHO A;  1R5E A;  3D51 A;  3BUQ A;  2ELB A;  2LM0 A;  4JWE A;  4H6H A;  1Q5L A;  3LMF A;  1SUF A;  2RAJ A;  5C5B B;  4AZB A;  2BPR A;  3C7N A;  4JL9 A;  2OP6 A;  2Z8Y A;  4E3C A;  2EX3 B;  2N3K A;  2O0I 1;  2X5C A;  3BUP A;  2GA9 D;  3ZEF A;  2YIA A;  3VEB A;  3T46 A;  3OK8 A;  3F7W A;  2NCZ A;  3O3O B;  3O3N B;  4JWI A;  2F7O A;  4IWQ A;  3KAW A;  2EWF A;  4DYL A;  2OZN B;  2JNK A;  3L3P A;  3BVU A;  3VEA A;  3C7N B;  3BLB A;  2YKT A;  4IW0 A;  1GNT A;  3D2F A;  3DX0 A;  3DQG A;  1R34 A;  2MI7 A;  3EJQ A;  1QX1 A;  1OAO A;  2YI8 A;  2ALW A;  2OBM A;  3SBS A;  3ER9 B;  1X03 A;  2YL8 A;  4BNE A;  2X3W A;  3KAV A;  4WPE A;  1HTY A;  1TQS A;  2RAK A;  3QNI A;  4AZG A;  4AZI A;  3T47 A;  3HAJ A;  4EZS A;  1SU7 A;  3DX2 A;  2F7R A;  3FD9 A;  1ZYL A;  3DPO A;  1LQ7 A;  4EZN A;  2Q13 A;  4IM3 A;  4EZY A;  4NQI A;  3RV0 A;  3VKH A;  3DDG A;  4JN4 A;  5KBP A;  1ZWW A;  4AVM A;  2YL6 A;  3CV5 A;  3EJR A;  4R5G A;  2RAI A;  4FZP A;  2QXL A;  3EJT A;  1CKR A;  2F18 A;  4PO2 A;  1Y2O A;  3QA8 A;  4UDY X;  4JNE A;  3Q84 A;  4AKV A;  7HSC A;  1DKX A;  5FLE X;  3Q0K A;  3B51 X;  3T4A G;  3UIT A;  1SU8 A;  2Z0O A;  2C08 A;  2F7Q A;  3BUI A;  4EZO A;  4WV7 A;  3ER8 C;  4EZT A;  4R5J A;  2OBL A;  3DX4 A;  3N8E A;  1MJG A;  4R5K A;  5E84 A;  2OO2 A;  4WV5 A;  3CZS A;  1BPR A;  3T49 A;  1I4L A;  3BVW A;  3OHX M;  2LXY A;  1OA1 A;  2ZXQ A;  4FM3 A;  4MQD A;  2OW7 A;  3RPM A;  1I49 A;  2YL9 A;  1JQK A;  4AZC A;  3HAH A;  4M0M A;  2EFL A;  2GAF D;  1TQU A;  1WDZ A;  1GNL A;  1YWM A; 
#chains in the Genus database with same CATH homology
 1E9V A;  3I39 X;  3T48 A;  1DKZ A;  3FD9 A;  4IWO A;  4E81 A;  4JLC A;  4R5L A;  1ZYL A;  4D8J A;  4IM2 A;  3SBT B;  4KIK B;  3B52 X;  4NPH A;  4KIK A;  4FL9 A;  3OWG A;  2KHO A;  3DPO A;  1YUW A;  4EZN A;  2LM0 A;  4IM3 A;  4EZY A;  4JWE A;  4F00 A;  1E2U A;  4H6H A;  1Q5L A;  3RV0 A;  3GI7 A;  3LMF A;  1SUF A;  3VKH A;  3O3M B;  3H0X A;  2QFF A;  1OA0 A;  4JN4 A;  3ZED A;  2BPR A;  1E1D A;  3C7N A;  4JL9 A;  4JWC A;  2OP6 A;  2Z8Y A;  4E3C A;  2YIV X;  2RT6 A;  2EX3 B;  4ILH B;  2N3K A;  4R5G A;  2X5C A;  3ZEF A;  2GA9 D;  4EZU A;  2YIA A;  1GN9 A;  2QXL A;  1CKR A;  2YI9 A;  4PO2 A;  3QA8 A;  4UDY X;  3VEB A;  4JNE A;  3T46 A;  2ND1 A;  3I04 A;  4F01 A;  4UDX X;  4EZX A;  3F7W A;  4EZQ A;  2NCZ A;  1DKY A;  4JWD A;  4ILI A;  7HSC A;  4HYB A;  4HR1 A;  3O3O B;  4IM0 A;  1DKX A;  3O3N B;  5FLE X;  4JWI A;  4IWQ A;  3B51 X;  3KAW A;  2EWF A;  3T4A G;  3UIT A;  1SU8 A;  3VEA A;  3C7N B;  4JNF A;  3RV1 A;  4I43 A;  2YIB A;  4IW0 A;  3DPP A;  4EZO A;  1GNT A;  4WV7 A;  3D2F A;  3DQG A;  3ER8 C;  4EZT A;  2WIN M;  4R5J A;  2OBL A;  4B9Q A;  2V7Y A;  3DPQ A;  2JNS A;  4HY9 A;  1OAO A;  2YI8 A;  3B53 X;  1MJG A;  4R5K A;  5E84 A;  4EZR A;  3DOB A;  3N8E A;  2OBM A;  4EZW A;  4WV5 A;  4HR1 B;  3SBS A;  3ER9 B;  2ND0 A;  4EZP A;  3L3O M;  4G6Q A;  4ILG A;  1BPR A;  3D2E A;  3T49 A;  3KAV A;  3A98 A;  3OHX M;  1U00 A;  1OA1 A;  4H6I A;  1SU6 A;  4FM3 A;  4MQD A;  4IWP A;  1UPX A;  3ERC C;  5TKY A;  3QNJ A;  1DG4 A;  1JQK A;  5FIG A;  1W9M A;  4M0M A;  3T47 A;  4R5I A;  4EZS A;  3KDR A;  4EZZ A;  2GAF D;  4EZV A;  1GNL A;  3I01 A;  1SU7 A;  2PY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...