4EZQA

Crystal structure of the substrate binding domain of e.coli dnak in complex with the c-terminal part of pyrrhocoricin (residues 12 to 20)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
216
structure length
216
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
total genus 63
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezqA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezqA01
3T49A 3T4AG 4R5IA 4EZWA 4PO2A 4FL9A 4JNFA 3L3OM 4HYBA 1DKZA 4JWEA 4R5GA 5E84A 2QXLA 4EZPA 4EZOA 3DOBA 3DPOA 5TKYA 1DG4A 4HY9A 4EZZA 1DKYA 4WV5A 4E81A 3C7NB 3DPPA 3D2FA 4R5JA 4H6IA 1YUWA 4EZUA 4R5LA 2QFFA 4EZTA 4EZXA 1U00A 2BPRA 3T47A 3N8EA 3D2EA 2V7YA 7HSCA 4JN4A 4R5KA 4H6HA 4EZSA 3H0XA 3DQGA 1CKRA 4JWIA 3OHXM 4EZYA 4F01A 4EZVA 4EZQA 3C7NA 1Q5LA 4EZNA 4F00A 3QNJA 4JWCA 3T48A 4B9QA 4EZRA 4JNEA 3DPQA 1BPRA 1DKXA 2WINM 4JWDA 2OP6A 3T46A 4WV7A 2KHOA
chains in the Genus database with same CATH superfamily
4AZ7A 1SU7A 4AKVA 3BLBA 1DG4A 2X5CA 2D4CA 2F7PA 3DPPA 1HWWA 4DCNC 4AZ6A 1TQUA 4FZSA 1YWMA 3VEAA 3LLLA 3T49A 3Q0KA 1R33A 4EZOA 2N3KA 1R5EA 2YI9A 3FD9A 1CKRA 4KIKA 3D4ZA 4E3CA 4AZGA 4IWOA 4AZCA 1WDZA 5E84A 2GF4A 4R5GA 1JQKA 3DOBA 1ZYLA 4EZZA 4WV5A 1PS3A 1E9VA 1OAOA 3N8EA 2V7YA 3SBTB 3M3WA 3BVVA 3D50A 3B52X 1HTYA 2OW7A 2OBLA 1HXKA 3EJQA 2KHOA 2C08A 3KAVA 1SU8A 2OW6A 3RV1A 5TKYA 2EWFA 2JNKA 1TQSA 5FIGA 3H0XA 2LXYA 2F1AA 3CKDA 3DDGA 2YI8A 2NCZA 4WV7A 1Y2OA 2O0I1 4IWQA 4EZPA 3F7WA 2OZNB 1W9MA 1I49A 3D2FA 4R5LA 3A98A 3D4YA 4EZVA 4AZCB 4EZNA 4F00A 3ER9B 3DX2A 4IWPA 2RAIA 3O3OB 3Q84A 1TQVA 4R5IA 1O7DB 2YL5A 4AZ5A 1YUWA 2Z8YA 3SBSA 3PLTA 3I39X 4JN4A 3QWEA 4FZOA 2X3WA 2RAKA 3OK8A 2GAFD 2Q12A 3L3OM 4JL9A 3BUPA 3DPOA 1DKYA 4ILHB 3SOGA 1OA1A 4MQDA 3SYVA 4R5JA 4FZPA 3BVUA 3BVXA 2ALWA 3ERCC 3LMFA 2QFFA 4IW0A 4HR1A 4EZYA 3OHXM 2EFLA 4EZQA 3VEBA 1Q5LA 1QWNA 2X3VA 3BUBA 2YL9A 2YL8A 2Q13A 2YKTA 3T4AG 4I43A 3KDRA 3ACOA 1E2UA 3EJPA 2PMRA 3O3NB 1QWUA 4EZUA 2Z0VA 1R34A 2YIVX 2RAJA 1I4TA 3OWGA 4JNEA 3DPQA 3VKHA 1ZWWA 4NQIA 5KBPA 3G9GA 3D51A 4NPHA 4WPEA 2PY6A 2YIAA 3T47A 1I4DA 3B51X 1QX1A 3BVTA 1MJGA 3RPMA 3DX1A 1I4LA 1LQ7A 4FL9A 3QE6A 3ZEDA 3O3MB 4JWEA 3CZSA 4HR1B 3UITA 4E81A 2MI7A 1SUFA 3D2EA 3EJRA 3BVWA 3QA8A 4EZSA 4IM3A 2EX3B 2ND0A 4FM3A 4IM2A 1BPRA 3D52A 2OP6A 1URUA 4PO2A 4G6QA 1TQTA 2FYVA 2F1BA 3QNIA 2RT6A 2X3XA 4AZHA 1X04A 2YLAA 5C5BB 3DQGA 2YIBA 3ER8C 7HSCA 3L3PA 4AZBA 4ILIA 3GI7A 4HY9A 3HAJA 4UDYX 1TQWA 1GNTA 2EFKA 2WYIA 4EZTA 2F7RA 3DDFA 2BPRA 3DYTA 1E1DA 4F01A 3C7NA 2JNSA 5FLEX 3CAZA 4B9QA 4ATMA 4IM0A 4JWDA 3T46A 3DX4A 1X03A 4AVMA 3CV5A 1O7DC 2ELBA 4M0MA 4H6IA 1SU6A 4I1QA 4R5KA 2GA9D 4H6HA 3EJTA 3QNJA 4JWCA 3EJUA 2OBMA 4BNEA 1OA0A 3BUIA 3RV0A 5C5BA 3CZNA 4EZWA 4AZIA 2LM0A 4HYBA 3KAWA 3HAHA 2QXLA 2D1LA 2ND1A 3BUQA 3EJSA 3I01A 3T48A 4EZRA 2QKWA 4UDXX 4DYLA 2WINM 2FICA 3BUDA 1UPXA 4JLCA 3I04A 2ZXQA 4JNFA 1DKZA 2F7QA 4H8SA 2WYHA 3DX0A 4WPCA 3C7NB 4ILGA 1U00A 4NSWA 4JWIA 1GN9A 3CVRA 4D8JA 1DKXA 2Z0NA 3ZEFA 2OO2A 4KIKB 3HAIA 3I2WA 2YL6A 2Z0OA 2V0OA 1GNLA 3B53X 4EZXA 3ABHA 2YLLA 2F18A 3LVTA 3DX3A 2F7OA
chains in the Genus database with same CATH topology
1SU7A 4IWQA 4EZPA 1DG4A 3F7WA 4M0MA 2X5CA 1W9MA 4NPHA 3DPPA 3D2FA 4H6IA 4R5LA 1SU6A 2PY6A 2YIAA 3A98A 3T47A 4R5KA 2GA9D 4H6HA 3B51X 4EZVA 4EZNA 4F00A 3QNJA 4JWCA 3ER9B 2OBMA 1MJGA 4IWPA 1OA0A 3O3OB 3RV0A 3VEAA 3T49A 4R5IA 4EZWA 4FL9A 2LM0A 4HYBA 3KAWA 3O3MB 4JWEA 3ZEDA 2QXLA 4EZOA 2N3KA 4HR1B 2YI9A 3UITA 4E81A 1YUWA 2Z8YA 1SUFA 3FD9A 2ND1A 3SBSA 3D2EA 3I01A 3I39X 4JN4A 3QA8A 4EZSA 1CKRA 4KIKA 3T48A 4IM3A 2EX3B 2ND0A 4FM3A 4IM2A 4UDXX 4E3CA 4EZRA 1BPRA 2WINM 2OP6A 4IWOA 1UPXA 4JLCA 3I04A 2GAFD 4PO2A 4JNFA 4G6QA 3L3OM 4JL9A 1DKZA 4R5GA 5E84A 1JQKA 3DOBA 3DPOA 1ZYLA 4EZZA 1DKYA 4ILHB 4WV5A 1OA1A 1E9VA 4MQDA 3C7NB 4R5JA 2RT6A 3ERCC 3LMFA 1OAOA 2QFFA 4IW0A 4ILGA 1U00A 3N8EA 2V7YA 3SBTB 4HR1A 3DQGA 2YIBA 4JWIA 3OHXM 4EZYA 4EZQA 3B52X 3VEBA 1Q5LA 3ER8C 1GN9A 4D8JA 1DKXA 2OBLA 7HSCA 3ZEFA 2KHOA 3KAVA 3T4AG 4I43A 1SU8A 3RV1A 3KDRA 4ILIA 1E2UA 3GI7A 3O3NB 5TKYA 4KIKB 4HY9A 4UDYX 2EWFA 1GNTA 1GNLA 4EZUA 3B53X 4EZTA 4EZXA 2YIVX 2BPRA 5FIGA 1E1DA 3H0XA 4F01A 3C7NA 2JNSA 5FLEX 3OWGA 4B9QA 4JNEA 2YI8A 3DPQA 4IM0A 4JWDA 3VKHA 2NCZA 3T46A 4WV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T49 A;  3T4A G;  4R5I A;  4EZW A;  4PO2 A;  4FL9 A;  4JNF A;  3L3O M;  4HYB A;  1DKZ A;  4JWE A;  4R5G A;  5E84 A;  2QXL A;  4EZP A;  4EZO A;  3DOB A;  3DPO A;  5TKY A;  1DG4 A;  4HY9 A;  4EZZ A;  1DKY A;  4WV5 A;  4E81 A;  3C7N B;  3DPP A;  3D2F A;  4R5J A;  4H6I A;  1YUW A;  4EZU A;  4R5L A;  2QFF A;  4EZT A;  4EZX A;  1U00 A;  2BPR A;  3T47 A;  3N8E A;  3D2E A;  2V7Y A;  7HSC A;  4JN4 A;  4R5K A;  4H6H A;  4EZS A;  3H0X A;  3DQG A;  1CKR A;  4JWI A;  3OHX M;  4EZY A;  4F01 A;  4EZV A;  4EZQ A;  3C7N A;  1Q5L A;  4EZN A;  4F00 A;  3QNJ A;  4JWC A;  3T48 A;  4B9Q A;  4EZR A;  4JNE A;  3DPQ A;  1BPR A;  1DKX A;  2WIN M;  4JWD A;  2OP6 A;  3T46 A;  4WV7 A;  2KHO A; 
#chains in the Genus database with same CATH topology
 4AZ7 A;  1SU7 A;  4AKV A;  3BLB A;  1DG4 A;  2X5C A;  2D4C A;  2F7P A;  3DPP A;  1HWW A;  4DCN C;  4AZ6 A;  1TQU A;  4FZS A;  1YWM A;  3VEA A;  3LLL A;  3T49 A;  3Q0K A;  1R33 A;  4EZO A;  2N3K A;  1R5E A;  2YI9 A;  3FD9 A;  1CKR A;  4KIK A;  3D4Z A;  4E3C A;  4AZG A;  4IWO A;  4AZC A;  1WDZ A;  5E84 A;  2GF4 A;  4R5G A;  1JQK A;  3DOB A;  1ZYL A;  4EZZ A;  4WV5 A;  1PS3 A;  1E9V A;  1OAO A;  3N8E A;  2V7Y A;  3SBT B;  3M3W A;  3BVV A;  3D50 A;  3B52 X;  1HTY A;  2OW7 A;  2OBL A;  1HXK A;  3EJQ A;  2KHO A;  2C08 A;  3KAV A;  1SU8 A;  2OW6 A;  3RV1 A;  5TKY A;  2EWF A;  2JNK A;  1TQS A;  5FIG A;  3H0X A;  2LXY A;  2F1A A;  3CKD A;  3DDG A;  2YI8 A;  2NCZ A;  4WV7 A;  1Y2O A;  2O0I 1;  4IWQ A;  4EZP A;  3F7W A;  2OZN B;  1W9M A;  1I49 A;  3D2F A;  4R5L A;  3A98 A;  3D4Y A;  4EZV A;  4AZC B;  4EZN A;  4F00 A;  3ER9 B;  3DX2 A;  4IWP A;  2RAI A;  3O3O B;  3Q84 A;  1TQV A;  4R5I A;  1O7D B;  2YL5 A;  4AZ5 A;  1YUW A;  2Z8Y A;  3SBS A;  3PLT A;  3I39 X;  4JN4 A;  3QWE A;  4FZO A;  2X3W A;  2RAK A;  3OK8 A;  2GAF D;  2Q12 A;  3L3O M;  4JL9 A;  3BUP A;  3DPO A;  1DKY A;  4ILH B;  3SOG A;  1OA1 A;  4MQD A;  3SYV A;  4R5J A;  4FZP A;  3BVU A;  3BVX A;  2ALW A;  3ERC C;  3LMF A;  2QFF A;  4IW0 A;  4HR1 A;  4EZY A;  3OHX M;  2EFL A;  4EZQ A;  3VEB A;  1Q5L A;  1QWN A;  2X3V A;  3BUB A;  2YL9 A;  2YL8 A;  2Q13 A;  2YKT A;  3T4A G;  4I43 A;  3KDR A;  3ACO A;  1E2U A;  3EJP A;  2PMR A;  3O3N B;  1QWU A;  4EZU A;  2Z0V A;  1R34 A;  2YIV X;  2RAJ A;  1I4T A;  3OWG A;  4JNE A;  3DPQ A;  3VKH A;  1ZWW A;  4NQI A;  5KBP A;  3G9G A;  3D51 A;  4NPH A;  4WPE A;  2PY6 A;  2YIA A;  3T47 A;  1I4D A;  3B51 X;  1QX1 A;  3BVT A;  1MJG A;  3RPM A;  3DX1 A;  1I4L A;  1LQ7 A;  4FL9 A;  3QE6 A;  3ZED A;  3O3M B;  4JWE A;  3CZS A;  4HR1 B;  3UIT A;  4E81 A;  2MI7 A;  1SUF A;  3D2E A;  3EJR A;  3BVW A;  3QA8 A;  4EZS A;  4IM3 A;  2EX3 B;  2ND0 A;  4FM3 A;  4IM2 A;  1BPR A;  3D52 A;  2OP6 A;  1URU A;  4PO2 A;  4G6Q A;  1TQT A;  2FYV A;  2F1B A;  3QNI A;  2RT6 A;  2X3X A;  4AZH A;  1X04 A;  2YLA A;  5C5B B;  3DQG A;  2YIB A;  3ER8 C;  7HSC A;  3L3P A;  4AZB A;  4ILI A;  3GI7 A;  4HY9 A;  3HAJ A;  4UDY X;  1TQW A;  1GNT A;  2EFK A;  2WYI A;  4EZT A;  2F7R A;  3DDF A;  2BPR A;  3DYT A;  1E1D A;  4F01 A;  3C7N A;  2JNS A;  5FLE X;  3CAZ A;  4B9Q A;  4ATM A;  4IM0 A;  4JWD A;  3T46 A;  3DX4 A;  1X03 A;  4AVM A;  3CV5 A;  1O7D C;  2ELB A;  4M0M A;  4H6I A;  1SU6 A;  4I1Q A;  4R5K A;  2GA9 D;  4H6H A;  3EJT A;  3QNJ A;  4JWC A;  3EJU A;  2OBM A;  4BNE A;  1OA0 A;  3BUI A;  3RV0 A;  5C5B A;  3CZN A;  4EZW A;  4AZI A;  2LM0 A;  4HYB A;  3KAW A;  3HAH A;  2QXL A;  2D1L A;  2ND1 A;  3BUQ A;  3EJS A;  3I01 A;  3T48 A;  4EZR A;  2QKW A;  4UDX X;  4DYL A;  2WIN M;  2FIC A;  3BUD A;  1UPX A;  4JLC A;  3I04 A;  2ZXQ A;  4JNF A;  1DKZ A;  2F7Q A;  4H8S A;  2WYH A;  3DX0 A;  4WPC A;  3C7N B;  4ILG A;  1U00 A;  4NSW A;  4JWI A;  1GN9 A;  3CVR A;  4D8J A;  1DKX A;  2Z0N A;  3ZEF A;  2OO2 A;  4KIK B;  3HAI A;  3I2W A;  2YL6 A;  2Z0O A;  2V0O A;  1GNL A;  3B53 X;  4EZX A;  3ABH A;  2YLL A;  2F18 A;  3LVT A;  3DX3 A;  2F7O A; 
#chains in the Genus database with same CATH homology
 1SU7 A;  4IWQ A;  4EZP A;  1DG4 A;  3F7W A;  4M0M A;  2X5C A;  1W9M A;  4NPH A;  3DPP A;  3D2F A;  4H6I A;  4R5L A;  1SU6 A;  2PY6 A;  2YIA A;  3A98 A;  3T47 A;  4R5K A;  2GA9 D;  4H6H A;  3B51 X;  4EZV A;  4EZN A;  4F00 A;  3QNJ A;  4JWC A;  3ER9 B;  2OBM A;  1MJG A;  4IWP A;  1OA0 A;  3O3O B;  3RV0 A;  3VEA A;  3T49 A;  4R5I A;  4EZW A;  4FL9 A;  2LM0 A;  4HYB A;  3KAW A;  3O3M B;  4JWE A;  3ZED A;  2QXL A;  4EZO A;  2N3K A;  4HR1 B;  2YI9 A;  3UIT A;  4E81 A;  1YUW A;  2Z8Y A;  1SUF A;  3FD9 A;  2ND1 A;  3SBS A;  3D2E A;  3I01 A;  3I39 X;  4JN4 A;  3QA8 A;  4EZS A;  1CKR A;  4KIK A;  3T48 A;  4IM3 A;  2EX3 B;  2ND0 A;  4FM3 A;  4IM2 A;  4UDX X;  4E3C A;  4EZR A;  1BPR A;  2WIN M;  2OP6 A;  4IWO A;  1UPX A;  4JLC A;  3I04 A;  2GAF D;  4PO2 A;  4JNF A;  4G6Q A;  3L3O M;  4JL9 A;  1DKZ A;  4R5G A;  5E84 A;  1JQK A;  3DOB A;  3DPO A;  1ZYL A;  4EZZ A;  1DKY A;  4ILH B;  4WV5 A;  1OA1 A;  1E9V A;  4MQD A;  3C7N B;  4R5J A;  2RT6 A;  3ERC C;  3LMF A;  1OAO A;  2QFF A;  4IW0 A;  4ILG A;  1U00 A;  3N8E A;  2V7Y A;  3SBT B;  4HR1 A;  3DQG A;  2YIB A;  4JWI A;  3OHX M;  4EZY A;  4EZQ A;  3B52 X;  3VEB A;  1Q5L A;  3ER8 C;  1GN9 A;  4D8J A;  1DKX A;  2OBL A;  7HSC A;  3ZEF A;  2KHO A;  3KAV A;  3T4A G;  4I43 A;  1SU8 A;  3RV1 A;  3KDR A;  4ILI A;  1E2U A;  3GI7 A;  3O3N B;  5TKY A;  4KIK B;  4HY9 A;  4UDY X;  2EWF A;  1GNT A;  1GNL A;  4EZU A;  3B53 X;  4EZT A;  4EZX A;  2YIV X;  2BPR A;  5FIG A;  1E1D A;  3H0X A;  4F01 A;  3C7N A;  2JNS A;  5FLE X;  3OWG A;  4B9Q A;  4JNE A;  2YI8 A;  3DPQ A;  4IM0 A;  4JWD A;  3VKH A;  2NCZ A;  3T46 A;  4WV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...