4EZQA

Crystal structure of the substrate binding domain of e.coli dnak in complex with the c-terminal part of pyrrhocoricin (residues 12 to 20)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
216
structure length
216
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
molecule keywords Chaperone protein DnaK
total genus 63
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezqA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezqA01
4JNFA 4R5KA 4R5IA 1DG4A 4EZRA 3DOBA 4H6IA 2WINM 3L3OM 1U00A 1Q5LA 5E84A 4R5LA 3C7NA 4WV7A 2QXLA 4EZTA 4EZZA 3T49A 4H6HA 4EZYA 3DPOA 3OHXM 4R5GA 1DKZA 4EZQA 2OP6A 2V7YA 1CKRA 4JNEA 3T47A 4FL9A 5TKYA 4E81A 4F00A 3D2FA 3T4AG 4PO2A 4JWIA 3C7NB 4EZXA 7HSCA 4EZVA 4HYBA 2QFFA 4B9QA 4EZWA 4EZOA 4F01A 2KHOA 3DPPA 3H0XA 3T48A 3D2EA 1BPRA 4JWEA 4EZNA 3DPQA 4WV5A 2BPRA 4JWCA 4JN4A 1DKYA 3DQGA 4EZUA 3QNJA 4HY9A 4EZSA 1YUWA 1DKXA 4JWDA 3N8EA 4EZPA 4R5JA 3T46A
chains in the Genus database with same CATH superfamily
1SU7A 2RAKA 2ZXQA 4R5KA 2ALWA 4KIKA 2X3XA 4I1QA 4AZIA 4AZ6A 3DOBA 1DG4A 2NCZA 3CZNA 2EX3B 3EJTA 1GNLA 1E1DA 1U00A 2JNSA 2EFLA 2QKWA 1GN9A 1ZWWA 2YI8A 5E84A 3ZEDA 4EZZA 3T49A 4M0MA 3DPOA 1R34A 4AZCA 1HWWA 1CKRA 1QX1A 2YLLA 4DCNC 3VEBA 4JLCA 2LXYA 5FLEX 2MI7A 4IM3A 4PO2A 4JWIA 1QWUA 3EJPA 3QA8A 4E3CA 4EZVA 2JNKA 1TQUA 2YIBA 1W9MA 3CAZA 3BUBA 3I39X 4HR1B 1TQWA 2ELBA 2GF4A 3KAWA 4FZSA 3T48A 2N3KA 2YL5A 3DX3A 4EZNA 2OO2A 4JN4A 1GNTA 2F18A 1I49A 3QNJA 1YUWA 1DKXA 3ACOA 4IW0A 3LVTA 3D4ZA 3SYVA 4H8SA 4R5JA 2LM0A 3T46A 3D50A 4BNEA 3I04A 3LMFA 3ZEFA 2RAJA 2OBLA 4R5IA 3M3WA 4FZOA 4H6IA 2WINM 3B52X 4IWPA 4ILGA 4HR1A 1I4DA 3C7NA 3BVVA 1HXKA 2QXLA 3DX0A 1Q5LA 1OA1A 4WPCA 3A98A 2V7YA 3OHXM 4EZQA 3BVTA 2EFKA 4ILIA 2F7RA 3DDFA 1E9VA 2F7OA 1WDZA 4JNEA 3T47A 4NSWA 4ILHB 3CKDA 1SU8A 1O7DC 2F7QA 2GA9D 4EZXA 3QNIA 2QFFA 2X5CA 4NPHA 4B9QA 4EZWA 1O7DB 4EZOA 4F01A 3DPPA 2OW6A 4I43A 1OAOA 3B53X 3QWEA 2YIAA 3DX4A 3DPQA 3RPMA 2WYHA 3Q84A 2Z0OA 3BUIA 1YWMA 1SUFA 1LQ7A 3I01A 4EZUA 3BUPA 3F7WA 4IM2A 4NQIA 2WYIA 3I2WA 2Z8YA 3LLLA 4EZPA 3ABHA 2YL8A 2OW7A 3DDGA 4AKVA 3O3OB 4JNFA 4ATMA 5KBPA 4EZRA 2OBMA 2YI9A 4AZCB 3SBTB 3SBSA 3L3OM 1I4TA 2D4CA 3BUDA 3ER9B 3D51A 3H0XA 3BLBA 1ZYLA 4AZHA 2YKTA 1URUA 4R5GA 1DKZA 2OP6A 3Q0KA 2YIVX 4IWOA 2F7PA 2X3WA 3EJQA 2C08A 2YL6A 5TKYA 4E81A 3C7NB 3D2FA 4KIKB 2F1AA 2PY6A 3EJSA 3VEAA 3D4YA 1HTYA 2KHOA 3CV5A 2X3VA 3KAVA 4IWQA 3D2EA 2YL9A 1BPRA 4JWEA 2Q13A 3DX1A 3UITA 2ND1A 4WV5A 3BUQA 2ND0A 1X04A 1Y2OA 4G6QA 2FICA 1QWNA 3HAJA 4JWCA 3HAIA 1R5EA 2PMRA 2OZNB 2RAIA 3KDRA 4HY9A 2Q12A 1R33A 4UDXX 3FD9A 3D52A 3OWGA 2F1BA 3DYTA 4AZ7A 4AZGA 3O3MB 3ERCC 4IM0A 1TQSA 4FZPA 1E2UA 3BVUA 2EWFA 4FM3A 5C5BB 2YLAA 3VKHA 4R5LA 4WV7A 3DX2A 4EZTA 1TQVA 4MQDA 4H6HA 4EZYA 3HAHA 4JL9A 2O0I1 2V0OA 3OK8A 2D1LA 3RV0A 4AZ5A 5C5BA 4FL9A 3GI7A 3PLTA 4F00A 3EJUA 1I4LA 3BVWA 4UDYX 3T4AG 4AZBA 2GAFD 1JQKA 3ER8C 7HSCA 3O3NB 4HYBA 1UPXA 1OA0A 4D8JA 4WPEA 3G9GA 3BVXA 3QE6A 2Z0NA 2Z0VA 4AVMA 3B51X 1PS3A 1MJGA 1TQTA 3L3PA 3EJRA 4DYLA 2BPRA 1SU6A 3CZSA 1DKYA 2RT6A 5FIGA 3DQGA 3N8EA 4EZSA 4JWDA 3SOGA 1X03A 2FYVA 3RV1A 3CVRA
chains in the Genus database with same CATH topology
1SU7A 4R5KA 4KIKA 1DG4A 3DOBA 2NCZA 3RV1A 2EX3B 1Q5LA 1GNLA 1E1DA 1U00A 2JNSA 2YI8A 5E84A 1GN9A 3ZEDA 4EZZA 3T49A 4M0MA 3DPOA 1CKRA 3VEBA 4JLCA 5FLEX 4IM3A 4PO2A 4JWIA 3QA8A 4EZVA 2YIBA 1W9MA 4HR1B 4E3CA 3I39X 3T48A 3H0XA 3KAWA 4EZNA 2N3KA 4JN4A 1GNTA 3QNJA 1YUWA 1DKXA 4IW0A 4R5JA 2LM0A 3T46A 3ZEFA 3I04A 3LMFA 2OBLA 4R5IA 4H6IA 2WINM 3B52X 4IWPA 4ILGA 4HR1A 3C7NA 2QXLA 1OA1A 3A98A 2V7YA 3OHXM 4EZQA 4ILIA 1E9VA 4JNEA 3T47A 4ILHB 1SU8A 2GA9D 4EZXA 2QFFA 2X5CA 4NPHA 4B9QA 4EZWA 4EZOA 4F01A 4I43A 3DPPA 1OAOA 3B53X 2YIAA 3DPQA 1SUFA 4EZUA 3I01A 3F7WA 4IM2A 2Z8YA 4EZPA 3O3OB 4JNFA 4EZRA 2OBMA 2YI9A 3SBTB 3SBSA 3L3OM 3ER9B 1ZYLA 4R5GA 1DKZA 2OP6A 2YIVX 4IWOA 5TKYA 4E81A 3C7NB 3D2FA 4KIKB 2PY6A 3VEAA 2KHOA 4IWQA 3KAVA 3D2EA 1BPRA 4JWEA 3UITA 2ND1A 4WV5A 2ND0A 4G6QA 4JWCA 4HY9A 3KDRA 4UDXX 3FD9A 3OWGA 3O3MB 3ERCC 4IM0A 1E2UA 2EWFA 4FM3A 3VKHA 4R5LA 4WV7A 4EZTA 4MQDA 4H6HA 4EZYA 4JL9A 3RV0A 4FL9A 3GI7A 4F00A 4UDYX 3T4AG 2GAFD 1JQKA 3ER8C 7HSCA 3O3NB 4HYBA 1UPXA 1OA0A 4D8JA 3B51X 1MJGA 2BPRA 1SU6A 1DKYA 2RT6A 5FIGA 3DQGA 3N8EA 4EZSA 4JWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JNF A;  4R5K A;  4R5I A;  1DG4 A;  4EZR A;  3DOB A;  4H6I A;  2WIN M;  3L3O M;  1U00 A;  1Q5L A;  5E84 A;  4R5L A;  3C7N A;  4WV7 A;  2QXL A;  4EZT A;  4EZZ A;  3T49 A;  4H6H A;  4EZY A;  3DPO A;  3OHX M;  4R5G A;  1DKZ A;  4EZQ A;  2OP6 A;  2V7Y A;  1CKR A;  4JNE A;  3T47 A;  4FL9 A;  5TKY A;  4E81 A;  4F00 A;  3D2F A;  3T4A G;  4PO2 A;  4JWI A;  3C7N B;  4EZX A;  7HSC A;  4EZV A;  4HYB A;  2QFF A;  4B9Q A;  4EZW A;  4EZO A;  4F01 A;  2KHO A;  3DPP A;  3H0X A;  3T48 A;  3D2E A;  1BPR A;  4JWE A;  4EZN A;  3DPQ A;  4WV5 A;  2BPR A;  4JWC A;  4JN4 A;  1DKY A;  3DQG A;  4EZU A;  3QNJ A;  4HY9 A;  4EZS A;  1YUW A;  1DKX A;  4JWD A;  3N8E A;  4EZP A;  4R5J A;  3T46 A; 
#chains in the Genus database with same CATH topology
 1SU7 A;  2RAK A;  2ZXQ A;  4R5K A;  2ALW A;  4KIK A;  2X3X A;  4I1Q A;  4AZI A;  4AZ6 A;  3DOB A;  1DG4 A;  2NCZ A;  3CZN A;  2EX3 B;  3EJT A;  1GNL A;  1E1D A;  1U00 A;  2JNS A;  2EFL A;  2QKW A;  1GN9 A;  1ZWW A;  2YI8 A;  5E84 A;  3ZED A;  4EZZ A;  3T49 A;  4M0M A;  3DPO A;  1R34 A;  4AZC A;  1HWW A;  1CKR A;  1QX1 A;  2YLL A;  4DCN C;  3VEB A;  4JLC A;  2LXY A;  5FLE X;  2MI7 A;  4IM3 A;  4PO2 A;  4JWI A;  1QWU A;  3EJP A;  3QA8 A;  4E3C A;  4EZV A;  2JNK A;  1TQU A;  2YIB A;  1W9M A;  3CAZ A;  3BUB A;  3I39 X;  4HR1 B;  1TQW A;  2ELB A;  2GF4 A;  3KAW A;  4FZS A;  3T48 A;  2N3K A;  2YL5 A;  3DX3 A;  4EZN A;  2OO2 A;  4JN4 A;  1GNT A;  2F18 A;  1I49 A;  3QNJ A;  1YUW A;  1DKX A;  3ACO A;  4IW0 A;  3LVT A;  3D4Z A;  3SYV A;  4H8S A;  4R5J A;  2LM0 A;  3T46 A;  3D50 A;  4BNE A;  3I04 A;  3LMF A;  3ZEF A;  2RAJ A;  2OBL A;  4R5I A;  3M3W A;  4FZO A;  4H6I A;  2WIN M;  3B52 X;  4IWP A;  4ILG A;  4HR1 A;  1I4D A;  3C7N A;  3BVV A;  1HXK A;  2QXL A;  3DX0 A;  1Q5L A;  1OA1 A;  4WPC A;  3A98 A;  2V7Y A;  3OHX M;  4EZQ A;  3BVT A;  2EFK A;  4ILI A;  2F7R A;  3DDF A;  1E9V A;  2F7O A;  1WDZ A;  4JNE A;  3T47 A;  4NSW A;  4ILH B;  3CKD A;  1SU8 A;  1O7D C;  2F7Q A;  2GA9 D;  4EZX A;  3QNI A;  2QFF A;  2X5C A;  4NPH A;  4B9Q A;  4EZW A;  1O7D B;  4EZO A;  4F01 A;  3DPP A;  2OW6 A;  4I43 A;  1OAO A;  3B53 X;  3QWE A;  2YIA A;  3DX4 A;  3DPQ A;  3RPM A;  2WYH A;  3Q84 A;  2Z0O A;  3BUI A;  1YWM A;  1SUF A;  1LQ7 A;  3I01 A;  4EZU A;  3BUP A;  3F7W A;  4IM2 A;  4NQI A;  2WYI A;  3I2W A;  2Z8Y A;  3LLL A;  4EZP A;  3ABH A;  2YL8 A;  2OW7 A;  3DDG A;  4AKV A;  3O3O B;  4JNF A;  4ATM A;  5KBP A;  4EZR A;  2OBM A;  2YI9 A;  4AZC B;  3SBT B;  3SBS A;  3L3O M;  1I4T A;  2D4C A;  3BUD A;  3ER9 B;  3D51 A;  3H0X A;  3BLB A;  1ZYL A;  4AZH A;  2YKT A;  1URU A;  4R5G A;  1DKZ A;  2OP6 A;  3Q0K A;  2YIV X;  4IWO A;  2F7P A;  2X3W A;  3EJQ A;  2C08 A;  2YL6 A;  5TKY A;  4E81 A;  3C7N B;  3D2F A;  4KIK B;  2F1A A;  2PY6 A;  3EJS A;  3VEA A;  3D4Y A;  1HTY A;  2KHO A;  3CV5 A;  2X3V A;  3KAV A;  4IWQ A;  3D2E A;  2YL9 A;  1BPR A;  4JWE A;  2Q13 A;  3DX1 A;  3UIT A;  2ND1 A;  4WV5 A;  3BUQ A;  2ND0 A;  1X04 A;  1Y2O A;  4G6Q A;  2FIC A;  1QWN A;  3HAJ A;  4JWC A;  3HAI A;  1R5E A;  2PMR A;  2OZN B;  2RAI A;  3KDR A;  4HY9 A;  2Q12 A;  1R33 A;  4UDX X;  3FD9 A;  3D52 A;  3OWG A;  2F1B A;  3DYT A;  4AZ7 A;  4AZG A;  3O3M B;  3ERC C;  4IM0 A;  1TQS A;  4FZP A;  1E2U A;  3BVU A;  2EWF A;  4FM3 A;  5C5B B;  2YLA A;  3VKH A;  4R5L A;  4WV7 A;  3DX2 A;  4EZT A;  1TQV A;  4MQD A;  4H6H A;  4EZY A;  3HAH A;  4JL9 A;  2O0I 1;  2V0O A;  3OK8 A;  2D1L A;  3RV0 A;  4AZ5 A;  5C5B A;  4FL9 A;  3GI7 A;  3PLT A;  4F00 A;  3EJU A;  1I4L A;  3BVW A;  4UDY X;  3T4A G;  4AZB A;  2GAF D;  1JQK A;  3ER8 C;  7HSC A;  3O3N B;  4HYB A;  1UPX A;  1OA0 A;  4D8J A;  4WPE A;  3G9G A;  3BVX A;  3QE6 A;  2Z0N A;  2Z0V A;  4AVM A;  3B51 X;  1PS3 A;  1MJG A;  1TQT A;  3L3P A;  3EJR A;  4DYL A;  2BPR A;  1SU6 A;  3CZS A;  1DKY A;  2RT6 A;  5FIG A;  3DQG A;  3N8E A;  4EZS A;  4JWD A;  3SOG A;  1X03 A;  2FYV A;  3RV1 A;  3CVR A; 
#chains in the Genus database with same CATH homology
 1SU7 A;  4R5K A;  4KIK A;  1DG4 A;  3DOB A;  2NCZ A;  3RV1 A;  2EX3 B;  1Q5L A;  1GNL A;  1E1D A;  1U00 A;  2JNS A;  2YI8 A;  5E84 A;  1GN9 A;  3ZED A;  4EZZ A;  3T49 A;  4M0M A;  3DPO A;  1CKR A;  3VEB A;  4JLC A;  5FLE X;  4IM3 A;  4PO2 A;  4JWI A;  3QA8 A;  4EZV A;  2YIB A;  1W9M A;  4HR1 B;  4E3C A;  3I39 X;  3T48 A;  3H0X A;  3KAW A;  4EZN A;  2N3K A;  4JN4 A;  1GNT A;  3QNJ A;  1YUW A;  1DKX A;  4IW0 A;  4R5J A;  2LM0 A;  3T46 A;  3ZEF A;  3I04 A;  3LMF A;  2OBL A;  4R5I A;  4H6I A;  2WIN M;  3B52 X;  4IWP A;  4ILG A;  4HR1 A;  3C7N A;  2QXL A;  1OA1 A;  3A98 A;  2V7Y A;  3OHX M;  4EZQ A;  4ILI A;  1E9V A;  4JNE A;  3T47 A;  4ILH B;  1SU8 A;  2GA9 D;  4EZX A;  2QFF A;  2X5C A;  4NPH A;  4B9Q A;  4EZW A;  4EZO A;  4F01 A;  4I43 A;  3DPP A;  1OAO A;  3B53 X;  2YIA A;  3DPQ A;  1SUF A;  4EZU A;  3I01 A;  3F7W A;  4IM2 A;  2Z8Y A;  4EZP A;  3O3O B;  4JNF A;  4EZR A;  2OBM A;  2YI9 A;  3SBT B;  3SBS A;  3L3O M;  3ER9 B;  1ZYL A;  4R5G A;  1DKZ A;  2OP6 A;  2YIV X;  4IWO A;  5TKY A;  4E81 A;  3C7N B;  3D2F A;  4KIK B;  2PY6 A;  3VEA A;  2KHO A;  4IWQ A;  3KAV A;  3D2E A;  1BPR A;  4JWE A;  3UIT A;  2ND1 A;  4WV5 A;  2ND0 A;  4G6Q A;  4JWC A;  4HY9 A;  3KDR A;  4UDX X;  3FD9 A;  3OWG A;  3O3M B;  3ERC C;  4IM0 A;  1E2U A;  2EWF A;  4FM3 A;  3VKH A;  4R5L A;  4WV7 A;  4EZT A;  4MQD A;  4H6H A;  4EZY A;  4JL9 A;  3RV0 A;  4FL9 A;  3GI7 A;  4F00 A;  4UDY X;  3T4A G;  2GAF D;  1JQK A;  3ER8 C;  7HSC A;  3O3N B;  4HYB A;  1UPX A;  1OA0 A;  4D8J A;  3B51 X;  1MJG A;  2BPR A;  1SU6 A;  1DKY A;  2RT6 A;  5FIG A;  3DQG A;  3N8E A;  4EZS A;  4JWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...