4EZQA

Crystal structure of the substrate binding domain of e.coli dnak in complex with the c-terminal part of pyrrhocoricin (residues 12 to 20)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
216
structure length
216
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone/peptide binding protein
molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
total genus 63
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezqA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezqA01
4R5JA 4R5GA 4F01A 3OHXM 3C7NB 4JNFA 3C7NA 4EZPA 4EZSA 3T48A 1BPRA 3H0XA 4WV5A 3DPOA 5E84A 4JN4A 4JWIA 2QFFA 4R5IA 4B9QA 4E81A 4EZOA 4WV7A 4HYBA 2BPRA 4JWEA 7HSCA 2OP6A 3DPQA 4H6IA 4EZYA 3DQGA 4EZRA 3T49A 3D2EA 4EZVA 1DG4A 1U00A 4EZXA 1DKZA 3QNJA 4H6HA 4R5LA 2WINM 3D2FA 3DPPA 4HY9A 3T4AG 4EZZA 4EZUA 1YUWA 3L3OM 4R5KA 4EZWA 4JWCA 1DKXA 4JNEA 2V7YA 4FL9A 1DKYA 4EZQA 3DOBA 3N8EA 2KHOA 1Q5LA 4EZNA 4EZTA 2QXLA 4F00A 4PO2A 4JWDA 3T47A 1CKRA 5TKYA 3T46A
chains in the Genus database with same CATH superfamily
4AVMA 2JNKA 3I01A 4G6QA 4UDXX 4I43A 3EJRA 3GI7A 3OWGA 3BUPA 3QWEA 3DX3A 4PO2A 4FZSA 2Z0NA 4R5GA 3DX4A 4NPHA 3ABHA 1BPRA 2F18A 3DPOA 4AZ5A 4E81A 4KIKB 3SOGA 4WPEA 3VEBA 2OO2A 3A98A 3QE6A 3D2EA 2YL5A 4EZXA 2YL9A 4ILGA 4E3CA 3QNJA 3D2FA 3BUQA 2Z0OA 3BVXA 4H8SA 4ATMA 4AZBA 3CZNA 3DQGA 1DG4A 4EZZA 2LM0A 3M3WA 4AZ7A 3HAIA 1DKYA 3DOBA 3BUIA 3EJTA 3RV1A 3CV5A 3CZSA 1GN9A 3ZEFA 1JQKA 2WYHA 3I2WA 4IWOA 1QWNA 3BVVA 4HR1B 3DPQA 3ER9B 3HAHA 3RPMA 3CKDA 3DPPA 4NQIA 4EZWA 2YI9A 2V7YA 3KAWA 3F7WA 5E84A 4B9QA 4IM2A 1U00A 1YUWA 2OBMA 1UPXA 3BUBA 4AZCA 5KBPA 4AZHA 2YIVX 3UITA 4JNFA 1SU6A 2YLAA 4EZPA 3T48A 4WPCA 4D8JA 4FM3A 3LMFA 1R34A 1E9VA 3BUDA 1TQUA 2WINM 3I04A 3SBSA 4I1QA 1TQWA 2OZNB 4WV7A 1HXKA 2MI7A 3C7NA 4EZSA 4WV5A 4JN4A 4JL9A 2YI8A 2RAJA 4BNEA 4H6HA 4R5LA 3L3OM 1OA0A 2LXYA 3EJSA 2PMRA 2F1BA 2OW7A 1GNTA 1R5EA 3ERCC 4ILHB 1QWUA 1O7DC 1TQSA 2YL8A 2F7OA 3CAZA 3HAJA 5C5BB 3OK8A 4R5KA 1ZYLA 2Q12A 3N8EA 4EZTA 5TKYA 2OBLA 1I4TA 2X3XA 3QA8A 1R33A 2ND0A 4EZYA 2C08A 2WYIA 2YLLA 2KHOA 4F00A 1MJGA 4DCNC 2F1AA 2F7QA 2X3VA 2Z8YA 4IM0A 4KIKA 2D4CA 2ALWA 7HSCA 2D1LA 3Q84A 1E1DA 4EZVA 1PS3A 4HY9A 2RAKA 3FD9A 1WDZA 4EZQA 1CKRA 4M0MA 3BLBA 4F01A 3OHXM 2F7RA 2GAFD 3DX2A 2RAIA 1OAOA 2BPRA 4JWEA 4NSWA 1LQ7A 2YKTA 4EZUA 3EJQA 1DKXA 2O0I1 3SYVA 1Q5LA 4IWQA 2GA9D 4JWDA 2F7PA 1TQTA 2EFLA 2Q13A 4IW0A 1URUA 2N3KA 4R5IA 2JNSA 3O3MB 1GNLA 3L3PA 4H6IA 4HR1A 3I39X 4DYLA 4AZ6A 1HTYA 2FICA 4JWCA 3SBTB 2ZXQA 3B52X 3T46A 4R5JA 3CVRA 2ELBA 3VKHA 2QFFA 1O7DB 3B53X 4EZOA 1TQVA 1SU8A 2EWFA 2ND1A 4HYBA 3DX1A 1SUFA 4EZRA 3T49A 1SU7A 1DKZA 3H0XA 2NCZA 4AZCB 3ACOA 2GF4A 3EJUA 5FIGA 1I4DA 3ZEDA 3DDGA 3DDFA 4UDYX 4FZPA 2FYVA 1HWWA 1I49A 4FZOA 3D50A 4JWIA 3G9GA 2QKWA 3BVUA 3Q0KA 4IM3A 4AZGA 2OW6A 3O3OB 1OA1A 3D51A 4FL9A 3LLLA 4EZNA 2QXLA 1ZWWA 3D52A 4IWPA 2X3WA 2EFKA 3D4YA 4JLCA 5FLEX 4AZIA 3KAVA 3ER8C 2YIBA 2X5CA 3C7NB 3LVTA 3DX0A 1X03A 3BVWA 2EX3B 4ILIA 3O3NB 1W9MA 3DYTA 3T4AG 1I4LA 4JNEA 3BVTA 3EJPA 3D4ZA 1Y2OA 2YL6A 1X04A 1QX1A 2V0OA 2PY6A 4MQDA 3KDRA 2Z0VA 2OP6A 3B51X 2RT6A 3QNIA 3RV0A 3PLTA 3VEAA 4AKVA 1E2UA 5C5BA 2YIAA 1YWMA 3T47A
chains in the Genus database with same CATH topology
2OBLA 4R5JA 3KAWA 3F7WA 3I01A 3QA8A 3VKHA 4G6QA 5E84A 4B9QA 2QFFA 4EZOA 3B53X 4IM2A 4UDXX 1SU8A 2EWFA 2ND1A 2ND0A 4HYBA 1SUFA 4I43A 3GI7A 4EZYA 4EZRA 3T49A 1SU7A 3OWGA 1U00A 1DKZA 1YUWA 3H0XA 2NCZA 2OBMA 1UPXA 2KHOA 5FIGA 4PO2A 4F00A 1MJGA 3ZEDA 2YIVX 4UDYX 4R5GA 3UITA 4NPHA 4JNFA 1SU6A 2Z8YA 4EZPA 3T48A 1BPRA 3DPOA 4D8JA 4JWIA 4E81A 4IM0A 4KIKB 4KIKA 7HSCA 4FM3A 3VEBA 3LMFA 1E1DA 3A98A 3D2EA 4IM3A 4EZVA 1E9VA 4EZXA 4ILGA 4E3CA 3QNJA 2WINM 3D2FA 3I04A 3O3OB 4HY9A 3SBSA 1OA1A 3FD9A 4FL9A 4EZQA 4EZNA 1CKRA 2QXLA 4WV7A 4M0MA 4IWPA 4JLCA 5FLEX 4F01A 3OHXM 3KAVA 2GAFD 2YIBA 2X5CA 3ER8C 3C7NB 3C7NA 4EZSA 4WV5A 4JN4A 4JL9A 1OAOA 2YI8A 4JWEA 2BPRA 2EX3B 3DQGA 4ILIA 3O3NB 1W9MA 1DG4A 4H6HA 4R5LA 3T4AG 4EZZA 4EZUA 3L3OM 2LM0A 1OA0A 1DKXA 4JNEA 1DKYA 3DOBA 1Q5LA 4IWQA 2GA9D 4JWDA 1GNTA 3RV1A 1GN9A 4IW0A 3ZEFA 3ERCC 1JQKA 4ILHB 2N3KA 4IWOA 4R5IA 2JNSA 3O3MB 1GNLA 2PY6A 4MQDA 4HR1B 3KDRA 2OP6A 3B51X 2RT6A 3DPQA 4H6IA 4HR1A 3ER9B 3RV0A 3VEAA 3I39X 1E2UA 3DPPA 4R5KA 2YIAA 4EZWA 2YI9A 4JWCA 1ZYLA 3SBTB 3N8EA 4EZTA 2V7YA 3T47A 3B52X 5TKYA 3T46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R5J A;  4R5G A;  4F01 A;  3OHX M;  3C7N B;  4JNF A;  3C7N A;  4EZP A;  4EZS A;  3T48 A;  1BPR A;  3H0X A;  4WV5 A;  3DPO A;  5E84 A;  4JN4 A;  4JWI A;  2QFF A;  4R5I A;  4B9Q A;  4E81 A;  4EZO A;  4WV7 A;  4HYB A;  2BPR A;  4JWE A;  7HSC A;  2OP6 A;  3DPQ A;  4H6I A;  4EZY A;  3DQG A;  4EZR A;  3T49 A;  3D2E A;  4EZV A;  1DG4 A;  1U00 A;  4EZX A;  1DKZ A;  3QNJ A;  4H6H A;  4R5L A;  2WIN M;  3D2F A;  3DPP A;  4HY9 A;  3T4A G;  4EZZ A;  4EZU A;  1YUW A;  3L3O M;  4R5K A;  4EZW A;  4JWC A;  1DKX A;  4JNE A;  2V7Y A;  4FL9 A;  1DKY A;  4EZQ A;  3DOB A;  3N8E A;  2KHO A;  1Q5L A;  4EZN A;  4EZT A;  2QXL A;  4F00 A;  4PO2 A;  4JWD A;  3T47 A;  1CKR A;  5TKY A;  3T46 A; 
#chains in the Genus database with same CATH topology
 4AVM A;  2JNK A;  3I01 A;  4G6Q A;  4UDX X;  4I43 A;  3EJR A;  3GI7 A;  3OWG A;  3BUP A;  3QWE A;  3DX3 A;  4PO2 A;  4FZS A;  2Z0N A;  4R5G A;  3DX4 A;  4NPH A;  3ABH A;  1BPR A;  2F18 A;  3DPO A;  4AZ5 A;  4E81 A;  4KIK B;  3SOG A;  4WPE A;  3VEB A;  2OO2 A;  3A98 A;  3QE6 A;  3D2E A;  2YL5 A;  4EZX A;  2YL9 A;  4ILG A;  4E3C A;  3QNJ A;  3D2F A;  3BUQ A;  2Z0O A;  3BVX A;  4H8S A;  4ATM A;  4AZB A;  3CZN A;  3DQG A;  1DG4 A;  4EZZ A;  2LM0 A;  3M3W A;  4AZ7 A;  3HAI A;  1DKY A;  3DOB A;  3BUI A;  3EJT A;  3RV1 A;  3CV5 A;  3CZS A;  1GN9 A;  3ZEF A;  1JQK A;  2WYH A;  3I2W A;  4IWO A;  1QWN A;  3BVV A;  4HR1 B;  3DPQ A;  3ER9 B;  3HAH A;  3RPM A;  3CKD A;  3DPP A;  4NQI A;  4EZW A;  2YI9 A;  2V7Y A;  3KAW A;  3F7W A;  5E84 A;  4B9Q A;  4IM2 A;  1U00 A;  1YUW A;  2OBM A;  1UPX A;  3BUB A;  4AZC A;  5KBP A;  4AZH A;  2YIV X;  3UIT A;  4JNF A;  1SU6 A;  2YLA A;  4EZP A;  3T48 A;  4WPC A;  4D8J A;  4FM3 A;  3LMF A;  1R34 A;  1E9V A;  3BUD A;  1TQU A;  2WIN M;  3I04 A;  3SBS A;  4I1Q A;  1TQW A;  2OZN B;  4WV7 A;  1HXK A;  2MI7 A;  3C7N A;  4EZS A;  4WV5 A;  4JN4 A;  4JL9 A;  2YI8 A;  2RAJ A;  4BNE A;  4H6H A;  4R5L A;  3L3O M;  1OA0 A;  2LXY A;  3EJS A;  2PMR A;  2F1B A;  2OW7 A;  1GNT A;  1R5E A;  3ERC C;  4ILH B;  1QWU A;  1O7D C;  1TQS A;  2YL8 A;  2F7O A;  3CAZ A;  3HAJ A;  5C5B B;  3OK8 A;  4R5K A;  1ZYL A;  2Q12 A;  3N8E A;  4EZT A;  5TKY A;  2OBL A;  1I4T A;  2X3X A;  3QA8 A;  1R33 A;  2ND0 A;  4EZY A;  2C08 A;  2WYI A;  2YLL A;  2KHO A;  4F00 A;  1MJG A;  4DCN C;  2F1A A;  2F7Q A;  2X3V A;  2Z8Y A;  4IM0 A;  4KIK A;  2D4C A;  2ALW A;  7HSC A;  2D1L A;  3Q84 A;  1E1D A;  4EZV A;  1PS3 A;  4HY9 A;  2RAK A;  3FD9 A;  1WDZ A;  4EZQ A;  1CKR A;  4M0M A;  3BLB A;  4F01 A;  3OHX M;  2F7R A;  2GAF D;  3DX2 A;  2RAI A;  1OAO A;  2BPR A;  4JWE A;  4NSW A;  1LQ7 A;  2YKT A;  4EZU A;  3EJQ A;  1DKX A;  2O0I 1;  3SYV A;  1Q5L A;  4IWQ A;  2GA9 D;  4JWD A;  2F7P A;  1TQT A;  2EFL A;  2Q13 A;  4IW0 A;  1URU A;  2N3K A;  4R5I A;  2JNS A;  3O3M B;  1GNL A;  3L3P A;  4H6I A;  4HR1 A;  3I39 X;  4DYL A;  4AZ6 A;  1HTY A;  2FIC A;  4JWC A;  3SBT B;  2ZXQ A;  3B52 X;  3T46 A;  4R5J A;  3CVR A;  2ELB A;  3VKH A;  2QFF A;  1O7D B;  3B53 X;  4EZO A;  1TQV A;  1SU8 A;  2EWF A;  2ND1 A;  4HYB A;  3DX1 A;  1SUF A;  4EZR A;  3T49 A;  1SU7 A;  1DKZ A;  3H0X A;  2NCZ A;  4AZC B;  3ACO A;  2GF4 A;  3EJU A;  5FIG A;  1I4D A;  3ZED A;  3DDG A;  3DDF A;  4UDY X;  4FZP A;  2FYV A;  1HWW A;  1I49 A;  4FZO A;  3D50 A;  4JWI A;  3G9G A;  2QKW A;  3BVU A;  3Q0K A;  4IM3 A;  4AZG A;  2OW6 A;  3O3O B;  1OA1 A;  3D51 A;  4FL9 A;  3LLL A;  4EZN A;  2QXL A;  1ZWW A;  3D52 A;  4IWP A;  2X3W A;  2EFK A;  3D4Y A;  4JLC A;  5FLE X;  4AZI A;  3KAV A;  3ER8 C;  2YIB A;  2X5C A;  3C7N B;  3LVT A;  3DX0 A;  1X03 A;  3BVW A;  2EX3 B;  4ILI A;  3O3N B;  1W9M A;  3DYT A;  3T4A G;  1I4L A;  4JNE A;  3BVT A;  3EJP A;  3D4Z A;  1Y2O A;  2YL6 A;  1X04 A;  1QX1 A;  2V0O A;  2PY6 A;  4MQD A;  3KDR A;  2Z0V A;  2OP6 A;  3B51 X;  2RT6 A;  3QNI A;  3RV0 A;  3PLT A;  3VEA A;  4AKV A;  1E2U A;  5C5B A;  2YIA A;  1YWM A;  3T47 A; 
#chains in the Genus database with same CATH homology
 2OBL A;  4R5J A;  3KAW A;  3F7W A;  3I01 A;  3QA8 A;  3VKH A;  4G6Q A;  5E84 A;  4B9Q A;  2QFF A;  4EZO A;  3B53 X;  4IM2 A;  4UDX X;  1SU8 A;  2EWF A;  2ND1 A;  2ND0 A;  4HYB A;  1SUF A;  4I43 A;  3GI7 A;  4EZY A;  4EZR A;  3T49 A;  1SU7 A;  3OWG A;  1U00 A;  1DKZ A;  1YUW A;  3H0X A;  2NCZ A;  2OBM A;  1UPX A;  2KHO A;  5FIG A;  4PO2 A;  4F00 A;  1MJG A;  3ZED A;  2YIV X;  4UDY X;  4R5G A;  3UIT A;  4NPH A;  4JNF A;  1SU6 A;  2Z8Y A;  4EZP A;  3T48 A;  1BPR A;  3DPO A;  4D8J A;  4JWI A;  4E81 A;  4IM0 A;  4KIK B;  4KIK A;  7HSC A;  4FM3 A;  3VEB A;  3LMF A;  1E1D A;  3A98 A;  3D2E A;  4IM3 A;  4EZV A;  1E9V A;  4EZX A;  4ILG A;  4E3C A;  3QNJ A;  2WIN M;  3D2F A;  3I04 A;  3O3O B;  4HY9 A;  3SBS A;  1OA1 A;  3FD9 A;  4FL9 A;  4EZQ A;  4EZN A;  1CKR A;  2QXL A;  4WV7 A;  4M0M A;  4IWP A;  4JLC A;  5FLE X;  4F01 A;  3OHX M;  3KAV A;  2GAF D;  2YIB A;  2X5C A;  3ER8 C;  3C7N B;  3C7N A;  4EZS A;  4WV5 A;  4JN4 A;  4JL9 A;  1OAO A;  2YI8 A;  4JWE A;  2BPR A;  2EX3 B;  3DQG A;  4ILI A;  3O3N B;  1W9M A;  1DG4 A;  4H6H A;  4R5L A;  3T4A G;  4EZZ A;  4EZU A;  3L3O M;  2LM0 A;  1OA0 A;  1DKX A;  4JNE A;  1DKY A;  3DOB A;  1Q5L A;  4IWQ A;  2GA9 D;  4JWD A;  1GNT A;  3RV1 A;  1GN9 A;  4IW0 A;  3ZEF A;  3ERC C;  1JQK A;  4ILH B;  2N3K A;  4IWO A;  4R5I A;  2JNS A;  3O3M B;  1GNL A;  2PY6 A;  4MQD A;  4HR1 B;  3KDR A;  2OP6 A;  3B51 X;  2RT6 A;  3DPQ A;  4H6I A;  4HR1 A;  3ER9 B;  3RV0 A;  3VEA A;  3I39 X;  1E2U A;  3DPP A;  4R5K A;  2YIA A;  4EZW A;  2YI9 A;  4JWC A;  1ZYL A;  3SBT B;  3N8E A;  4EZT A;  2V7Y A;  3T47 A;  3B52 X;  5TKY A;  3T46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...