4EZQA

Crystal structure of the substrate binding domain of e.coli dnak in complex with the c-terminal part of pyrrhocoricin (residues 12 to 20)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
216
structure length
216
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
total genus 63
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezqA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezqA01
4EZTA 4EZZA 3DPQA 4JN4A 2WINM 3T4AG 1CKRA 3L3OM 4R5GA 1U00A 4JWIA 3H0XA 1Q5LA 1BPRA 4E81A 4HYBA 4HY9A 3DOBA 4JWEA 4EZYA 4JWDA 4EZXA 4EZRA 4PO2A 4EZPA 3DPPA 4R5LA 4H6HA 2QXLA 2BPRA 4FL9A 4WV7A 1DKYA 4JNFA 3DQGA 4R5KA 2QFFA 4EZWA 1DKZA 3T49A 3T46A 4EZQA 3N8EA 3C7NB 4EZUA 4EZNA 5E84A 2V7YA 3C7NA 3DPOA 3D2EA 7HSCA 5TKYA 3D2FA 3T47A 3T48A 3OHXM 4EZVA 1DG4A 1DKXA 4JNEA 2KHOA 3QNJA 4R5JA 4F00A 4EZSA 4EZOA 2OP6A 1YUWA 4R5IA 4WV5A 4F01A 4JWCA 4B9QA 4H6IA
chains in the Genus database with same CATH superfamily
3DPQA 2YIBA 1R33A 2EWFA 1SU6A 1OA0A 4E81A 2NCZA 4HY9A 1HXKA 3SBTB 3CVRA 3DX0A 2YIAA 3BUBA 1ZYLA 3VKHA 2GAFD 2O0I1 4JLCA 4AVMA 5FLEX 1URUA 1QWNA 3D4YA 4IWOA 2WYHA 4JN4A 3QNIA 4UDXX 3B51X 1X04A 4H6HA 2V0OA 1GN9A 3M3WA 3DYTA 5TKYA 3LLLA 1DKXA 2F18A 3QWEA 1MJGA 4EZTA 3L3OM 5FIGA 3CZSA 3FD9A 2C08A 3I04A 4NQIA 3D52A 2X3XA 1TQTA 4FZPA 2QFFA 3DDFA 3DX4A 4JNEA 2KHOA 4WV5A 1PS3A 2ELBA 3CKDA 2X3VA 4G6QA 4IW0A 3ZEDA 4HYBA 1I4TA 1SU8A 3O3OB 2FYVA 2RAIA 3CZNA 3BUIA 3SOGA 3KAVA 4WPEA 2LXYA 2F7PA 2YL9A 2OP6A 1QWUA 4MQDA 2YL6A 4R5IA 3SBSA 4IM0A 4B9QA 3GI7A 4HR1A 4EZZA 3EJQA 1GNLA 4ILHB 2YI8A 3EJPA 2JNKA 1X03A 3O3MB 3BLBA 3DPOA 4NSWA 3T47A 1TQUA 3D50A 2ND1A 2ND0A 4AZCA 1O7DC 1YWMA 1UPXA 2OBMA 2N3KA 3DOBA 3DPPA 3Q84A 3HAIA 3DQGA 4FZOA 2X5CA 2MI7A 4DCNC 3N8EA 3G9GA 3T48A 2F7RA 4HR1B 2PY6A 1Q5LA 4AZBA 4ILGA 3VEAA 2OW6A 4I43A 3T46A 4EZQA 3LVTA 4IWQA 1I4LA 3QNJA 3BVTA 1YUWA 1JQKA 4AZCB 3UITA 1E9VA 2OBLA 3H0XA 2JNSA 1I49A 3DX3A 2Z0NA 4PO2A 2Z0OA 3VEBA 2Q12A 1DKYA 4R5KA 3EJSA 1DKZA 2RT6A 3BUPA 3ACOA 2F7QA 2F7OA 3D2EA 3I01A 4D8JA 1TQWA 3F7WA 4F01A 4DYLA 3EJRA 1LQ7A 3BVWA 2Q13A 2OW7A 3ERCC 1HTYA 2F1BA 2BPRA 1OAOA 4I1QA 4AZ6A 3T49A 1R5EA 4FZSA 4EZVA 1SU7A 5KBPA 2YLLA 4EZSA 4ILIA 2RAKA 2YIVX 4AZIA 3L3PA 3OWGA 1OA1A 4JWCA 2FICA 4H6IA 4E3CA 1CKRA 2YLAA 1I4DA 1E1DA 4EZXA 4EZYA 3B53X 4FL9A 4R5LA 1E2UA 2Z8YA 3KDRA 3HAJA 2ZXQA 4AZ7A 3RPMA 2EFLA 3D2FA 3B52X 4EZOA 3KAWA 1QX1A 3DDGA 3T4AG 4JWIA 2OZNB 3DX1A 3BVXA 3O3NB 3EJTA 2EFKA 3BUQA 1DG4A 4NPHA 4R5JA 4M0MA 2F1AA 4AZ5A 4H8SA 4F00A 4AZHA 4IM2A 4IM3A 3PLTA 3LMFA 2QXLA 1R34A 4JL9A 2EX3B 3ER9B 3C7NB 4EZUA 4EZNA 5E84A 7HSCA 1TQVA 2PMRA 3Q0KA 2YKTA 2D4CA 4JWEA 3DX2A 3CV5A 4FM3A 3D4ZA 5C5BA 1O7DB 3OHXM 1GNTA 1W9MA 3QA8A 3QE6A 2WINM 1WDZA 3EJUA 1TQSA 2YL5A 4EZPA 4WV7A 4BNEA 4KIKA 2GF4A 3ZEFA 3ABHA 3HAHA 3I2WA 3SYVA 3BUDA 4ATMA 4UDYX 3BVVA 4R5GA 1BPRA 2D1LA 3I39X 4EZRA 3BVUA 1HWWA 2ALWA 2YI9A 3RV0A 1Y2OA 4EZWA 2GA9D 2RAJA 2V7YA 3C7NA 1ZWWA 5C5BB 4IWPA 2X3WA 3A98A 2QKWA 4AKVA 2OO2A 2WYIA 1U00A 2LM0A 3OK8A 3CAZA 4JWDA 2YL8A 4JNFA 3RV1A 4KIKB 2Z0VA 3D51A 1SUFA 3ER8C 4AZGA 4WPCA
chains in the Genus database with same CATH topology
3GI7A 4HR1A 4EZZA 3DPQA 2YIBA 2EWFA 1SU6A 1GNLA 4ILHB 1OA0A 4E81A 3ERCC 2YI8A 2NCZA 4HY9A 4JWEA 2BPRA 1OAOA 3SBTB 4FM3A 2YIAA 3T49A 1ZYLA 3VKHA 3O3MB 2GAFD 3DPOA 3T47A 4EZVA 3OHXM 1GNTA 1SU7A 4ILIA 4JLCA 4EZSA 2YIVX 5FLEX 2ND1A 2ND0A 1W9MA 3OWGA 1OA1A 3QA8A 4IWOA 4H6IA 4JWCA 4E3CA 4JN4A 2WINM 1CKRA 1UPXA 4UDXX 2OBMA 3B51X 2N3KA 1E1DA 3DOBA 4EZXA 4EZYA 3B53X 4FL9A 4EZPA 3DPPA 4R5LA 4H6HA 4WV7A 1E2UA 3DQGA 2Z8YA 2X5CA 3KDRA 4KIKA 1GN9A 3N8EA 3ZEFA 5TKYA 3D2FA 3T48A 3B52X 1DKXA 4EZOA 3KAWA 1MJGA 4HR1B 4UDYX 4EZTA 3T4AG 3L3OM 4R5GA 4JWIA 5FIGA 3FD9A 2PY6A 1Q5LA 1BPRA 3I04A 4ILGA 3I39X 4EZRA 2YI9A 3RV0A 3VEAA 3O3NB 2QFFA 4EZWA 2GA9D 4I43A 3T46A 4EZQA 4IWQA 2V7YA 3C7NA 1DG4A 4NPHA 4JNEA 4IWPA 2KHOA 3QNJA 4R5JA 1YUWA 1JQKA 3A98A 4M0MA 4WV5A 3UITA 1E9VA 4F00A 2OBLA 4G6QA 4IW0A 3H0XA 1U00A 2JNSA 3ZEDA 4IM2A 2LM0A 4IM3A 4HYBA 3LMFA 4JWDA 4PO2A 1SU8A 3VEBA 2QXLA 4JL9A 3O3OB 1DKYA 4JNFA 4R5KA 2EX3B 1DKZA 3RV1A 2RT6A 4KIKB 3ER9B 3KAVA 3C7NB 4EZUA 4EZNA 1SUFA 5E84A 3D2EA 7HSCA 3I01A 3ER8C 2OP6A 4D8JA 4MQDA 4R5IA 3SBSA 3F7WA 4F01A 4IM0A 4B9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZT A;  4EZZ A;  3DPQ A;  4JN4 A;  2WIN M;  3T4A G;  1CKR A;  3L3O M;  4R5G A;  1U00 A;  4JWI A;  3H0X A;  1Q5L A;  1BPR A;  4E81 A;  4HYB A;  4HY9 A;  3DOB A;  4JWE A;  4EZY A;  4JWD A;  4EZX A;  4EZR A;  4PO2 A;  4EZP A;  3DPP A;  4R5L A;  4H6H A;  2QXL A;  2BPR A;  4FL9 A;  4WV7 A;  1DKY A;  4JNF A;  3DQG A;  4R5K A;  2QFF A;  4EZW A;  1DKZ A;  3T49 A;  3T46 A;  4EZQ A;  3N8E A;  3C7N B;  4EZU A;  4EZN A;  5E84 A;  2V7Y A;  3C7N A;  3DPO A;  3D2E A;  7HSC A;  5TKY A;  3D2F A;  3T47 A;  3T48 A;  3OHX M;  4EZV A;  1DG4 A;  1DKX A;  4JNE A;  2KHO A;  3QNJ A;  4R5J A;  4F00 A;  4EZS A;  4EZO A;  2OP6 A;  1YUW A;  4R5I A;  4WV5 A;  4F01 A;  4JWC A;  4B9Q A;  4H6I A; 
#chains in the Genus database with same CATH topology
 3DPQ A;  2YIB A;  1R33 A;  2EWF A;  1SU6 A;  1OA0 A;  4E81 A;  2NCZ A;  4HY9 A;  1HXK A;  3SBT B;  3CVR A;  3DX0 A;  2YIA A;  3BUB A;  1ZYL A;  3VKH A;  2GAF D;  2O0I 1;  4JLC A;  4AVM A;  5FLE X;  1URU A;  1QWN A;  3D4Y A;  4IWO A;  2WYH A;  4JN4 A;  3QNI A;  4UDX X;  3B51 X;  1X04 A;  4H6H A;  2V0O A;  1GN9 A;  3M3W A;  3DYT A;  5TKY A;  3LLL A;  1DKX A;  2F18 A;  3QWE A;  1MJG A;  4EZT A;  3L3O M;  5FIG A;  3CZS A;  3FD9 A;  2C08 A;  3I04 A;  4NQI A;  3D52 A;  2X3X A;  1TQT A;  4FZP A;  2QFF A;  3DDF A;  3DX4 A;  4JNE A;  2KHO A;  4WV5 A;  1PS3 A;  2ELB A;  3CKD A;  2X3V A;  4G6Q A;  4IW0 A;  3ZED A;  4HYB A;  1I4T A;  1SU8 A;  3O3O B;  2FYV A;  2RAI A;  3CZN A;  3BUI A;  3SOG A;  3KAV A;  4WPE A;  2LXY A;  2F7P A;  2YL9 A;  2OP6 A;  1QWU A;  4MQD A;  2YL6 A;  4R5I A;  3SBS A;  4IM0 A;  4B9Q A;  3GI7 A;  4HR1 A;  4EZZ A;  3EJQ A;  1GNL A;  4ILH B;  2YI8 A;  3EJP A;  2JNK A;  1X03 A;  3O3M B;  3BLB A;  3DPO A;  4NSW A;  3T47 A;  1TQU A;  3D50 A;  2ND1 A;  2ND0 A;  4AZC A;  1O7D C;  1YWM A;  1UPX A;  2OBM A;  2N3K A;  3DOB A;  3DPP A;  3Q84 A;  3HAI A;  3DQG A;  4FZO A;  2X5C A;  2MI7 A;  4DCN C;  3N8E A;  3G9G A;  3T48 A;  2F7R A;  4HR1 B;  2PY6 A;  1Q5L A;  4AZB A;  4ILG A;  3VEA A;  2OW6 A;  4I43 A;  3T46 A;  4EZQ A;  3LVT A;  4IWQ A;  1I4L A;  3QNJ A;  3BVT A;  1YUW A;  1JQK A;  4AZC B;  3UIT A;  1E9V A;  2OBL A;  3H0X A;  2JNS A;  1I49 A;  3DX3 A;  2Z0N A;  4PO2 A;  2Z0O A;  3VEB A;  2Q12 A;  1DKY A;  4R5K A;  3EJS A;  1DKZ A;  2RT6 A;  3BUP A;  3ACO A;  2F7Q A;  2F7O A;  3D2E A;  3I01 A;  4D8J A;  1TQW A;  3F7W A;  4F01 A;  4DYL A;  3EJR A;  1LQ7 A;  3BVW A;  2Q13 A;  2OW7 A;  3ERC C;  1HTY A;  2F1B A;  2BPR A;  1OAO A;  4I1Q A;  4AZ6 A;  3T49 A;  1R5E A;  4FZS A;  4EZV A;  1SU7 A;  5KBP A;  2YLL A;  4EZS A;  4ILI A;  2RAK A;  2YIV X;  4AZI A;  3L3P A;  3OWG A;  1OA1 A;  4JWC A;  2FIC A;  4H6I A;  4E3C A;  1CKR A;  2YLA A;  1I4D A;  1E1D A;  4EZX A;  4EZY A;  3B53 X;  4FL9 A;  4R5L A;  1E2U A;  2Z8Y A;  3KDR A;  3HAJ A;  2ZXQ A;  4AZ7 A;  3RPM A;  2EFL A;  3D2F A;  3B52 X;  4EZO A;  3KAW A;  1QX1 A;  3DDG A;  3T4A G;  4JWI A;  2OZN B;  3DX1 A;  3BVX A;  3O3N B;  3EJT A;  2EFK A;  3BUQ A;  1DG4 A;  4NPH A;  4R5J A;  4M0M A;  2F1A A;  4AZ5 A;  4H8S A;  4F00 A;  4AZH A;  4IM2 A;  4IM3 A;  3PLT A;  3LMF A;  2QXL A;  1R34 A;  4JL9 A;  2EX3 B;  3ER9 B;  3C7N B;  4EZU A;  4EZN A;  5E84 A;  7HSC A;  1TQV A;  2PMR A;  3Q0K A;  2YKT A;  2D4C A;  4JWE A;  3DX2 A;  3CV5 A;  4FM3 A;  3D4Z A;  5C5B A;  1O7D B;  3OHX M;  1GNT A;  1W9M A;  3QA8 A;  3QE6 A;  2WIN M;  1WDZ A;  3EJU A;  1TQS A;  2YL5 A;  4EZP A;  4WV7 A;  4BNE A;  4KIK A;  2GF4 A;  3ZEF A;  3ABH A;  3HAH A;  3I2W A;  3SYV A;  3BUD A;  4ATM A;  4UDY X;  3BVV A;  4R5G A;  1BPR A;  2D1L A;  3I39 X;  4EZR A;  3BVU A;  1HWW A;  2ALW A;  2YI9 A;  3RV0 A;  1Y2O A;  4EZW A;  2GA9 D;  2RAJ A;  2V7Y A;  3C7N A;  1ZWW A;  5C5B B;  4IWP A;  2X3W A;  3A98 A;  2QKW A;  4AKV A;  2OO2 A;  2WYI A;  1U00 A;  2LM0 A;  3OK8 A;  3CAZ A;  4JWD A;  2YL8 A;  4JNF A;  3RV1 A;  4KIK B;  2Z0V A;  3D51 A;  1SUF A;  3ER8 C;  4AZG A;  4WPC A; 
#chains in the Genus database with same CATH homology
 3GI7 A;  4HR1 A;  4EZZ A;  3DPQ A;  2YIB A;  2EWF A;  1SU6 A;  1GNL A;  4ILH B;  1OA0 A;  4E81 A;  3ERC C;  2YI8 A;  2NCZ A;  4HY9 A;  4JWE A;  2BPR A;  1OAO A;  3SBT B;  4FM3 A;  2YIA A;  3T49 A;  1ZYL A;  3VKH A;  3O3M B;  2GAF D;  3DPO A;  3T47 A;  4EZV A;  3OHX M;  1GNT A;  1SU7 A;  4ILI A;  4JLC A;  4EZS A;  2YIV X;  5FLE X;  2ND1 A;  2ND0 A;  1W9M A;  3OWG A;  1OA1 A;  3QA8 A;  4IWO A;  4H6I A;  4JWC A;  4E3C A;  4JN4 A;  2WIN M;  1CKR A;  1UPX A;  4UDX X;  2OBM A;  3B51 X;  2N3K A;  1E1D A;  3DOB A;  4EZX A;  4EZY A;  3B53 X;  4FL9 A;  4EZP A;  3DPP A;  4R5L A;  4H6H A;  4WV7 A;  1E2U A;  3DQG A;  2Z8Y A;  2X5C A;  3KDR A;  4KIK A;  1GN9 A;  3N8E A;  3ZEF A;  5TKY A;  3D2F A;  3T48 A;  3B52 X;  1DKX A;  4EZO A;  3KAW A;  1MJG A;  4HR1 B;  4UDY X;  4EZT A;  3T4A G;  3L3O M;  4R5G A;  4JWI A;  5FIG A;  3FD9 A;  2PY6 A;  1Q5L A;  1BPR A;  3I04 A;  4ILG A;  3I39 X;  4EZR A;  2YI9 A;  3RV0 A;  3VEA A;  3O3N B;  2QFF A;  4EZW A;  2GA9 D;  4I43 A;  3T46 A;  4EZQ A;  4IWQ A;  2V7Y A;  3C7N A;  1DG4 A;  4NPH A;  4JNE A;  4IWP A;  2KHO A;  3QNJ A;  4R5J A;  1YUW A;  1JQK A;  3A98 A;  4M0M A;  4WV5 A;  3UIT A;  1E9V A;  4F00 A;  2OBL A;  4G6Q A;  4IW0 A;  3H0X A;  1U00 A;  2JNS A;  3ZED A;  4IM2 A;  2LM0 A;  4IM3 A;  4HYB A;  3LMF A;  4JWD A;  4PO2 A;  1SU8 A;  3VEB A;  2QXL A;  4JL9 A;  3O3O B;  1DKY A;  4JNF A;  4R5K A;  2EX3 B;  1DKZ A;  3RV1 A;  2RT6 A;  4KIK B;  3ER9 B;  3KAV A;  3C7N B;  4EZU A;  4EZN A;  1SUF A;  5E84 A;  3D2E A;  7HSC A;  3I01 A;  3ER8 C;  2OP6 A;  4D8J A;  4MQD A;  4R5I A;  3SBS A;  3F7W A;  4F01 A;  4IM0 A;  4B9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...