1DKYA

The substrate binding domain of dnak in complex with a substrate peptide, determined from type 2 native crystals
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
211
structure length
211
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVSIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Complex (molecular chaperone/peptide)
molecule keywords DNAK
publication title Structural analysis of substrate binding by the molecular chaperone DnaK.
pubmed rcsb
total genus 54
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 1dkyA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 1dkyA01
3T47A 4JWEA 3T48A 4EZNA 4EZTA 2OP6A 3DPOA 4HY9A 4EZQA 3D2FA 4EZSA 4WV7A 2QFFA 1DG4A 2QXLA 4EZYA 4JNEA 4EZVA 4F00A 4B9QA 4EZUA 4EZZA 4H6HA 2KHOA 3T4AG 3L3OM 2BPRA 5E84A 4EZPA 4JWIA 1BPRA 4R5LA 4H6IA 3OHXM 3DQGA 4F01A 4R5KA 2WINM 4HYBA 3T46A 1Q5LA 2V7YA 3DOBA 4EZOA 4PO2A 4EZXA 4R5IA 3C7NA 1U00A 4EZRA 3H0XA 7HSCA 4EZWA 4WV5A 3D2EA 1DKYA 1DKXA 3DPQA 3T49A 3N8EA 1CKRA 1DKZA 3DPPA 4FL9A 4JWDA 5TKYA 4R5JA 3QNJA 4JN4A 4R5GA 4JWCA 3C7NB 1YUWA 4JNFA 4E81A
chains in the Genus database with same CATH superfamily
2OP6A 1TQWA 1DG4A 4IWQA 4F00A 3ER8C 3CZSA 2YIVX 1LQ7A 4AZIA 1OAOA 3ZEDA 3DYTA 2PY6A 2OZNB 4ILHB 4FL9A 4JWCA 2F7RA 1OA1A 4AZGA 2F7OA 2BPRA 4JLCA 2F18A 1QWNA 1Q5LA 3SYVA 4EZOA 2Q12A 1TQVA 2GA9D 1SU7A 3EJPA 3QWEA 3RV1A 4UDYX 1URUA 3T48A 4DYLA 2JNKA 2QXLA 3CVRA 3EJUA 3ZEFA 4I1QA 4AZCB 4FZPA 3Q0KA 5FIGA 4G6QA 4I43A 2PMRA 3ABHA 3D51A 5TKYA 4KIKA 2V7YA 3BVTA 4EZQA 3D4YA 4EZSA 4B9QA 5E84A 1QWUA 3T46A 1TQTA 3DDFA 1O7DC 3EJSA 4JL9A 3QNJA 1R34A 4AZ5A 4EZNA 2V0OA 2WYHA 3D50A 3G9GA 2Q13A 3CKDA 3HAIA 4F01A 4AKVA 5FLEX 1SU8A 1GNLA 2YLLA 3CV5A 3I39X 3DPPA 2Z8YA 4R5JA 4DCNC 1WDZA 4IM2A 3D52A 2QFFA 3FD9A 4ATMA 4AZ7A 3BUPA 1X03A 2O0I1 3ERCC 4ILIA 4BNEA 3RPMA 3SBSA 2GAFD 3D2EA 3I04A 3LMFA 2OW7A 3QE6A 4E81A 3T47A 1YWMA 2YL8A 3EJRA 4JNEA 2FICA 3L3OM 1OA0A 2YKTA 1R5EA 3DQGA 2Z0VA 4AZHA 3I01A 1TQUA 1ZWWA 4AZBA 2D1LA 3KAVA 1DKZA 1JQKA 4HR1B 3Q84A 3B53X 3SOGA 7HSCA 4JWEA 3D2FA 4AZCA 1I4TA 3KAWA 3LVTA 3BLBA 2X3XA 4HYBA 5C5BB 4FZSA 3M3WA 3BVVA 3N8EA 1CKRA 4D8JA 1X04A 3RV0A 1QX1A 4JNFA 3OK8A 3BVUA 1UPXA 4EZYA 3O3OB 1I4LA 2Z0NA 3OWGA 3B52X 2EFLA 4EZXA 3B51X 2X3WA 1U00A 1Y2OA 3VEAA 3O3NB 2F1AA 4ILGA 4JN4A 3C7NB 3L3PA 4WV7A 2X5CA 3QA8A 4EZVA 4EZZA 4EZUA 3HAJA 4IWOA 4FM3A 2EFKA 2YL9A 4IM0A 3DOBA 3BUIA 3H0XA 4EZWA 1GNTA 3F7WA 2YIAA 4M0MA 4EZTA 2WYIA 3ACOA 2ND1A 4HY9A 3SBTB 4E3CA 2MI7A 3KDRA 4R5KA 2WINM 3BUQA 4AVMA 2EX3B 4IWPA 3UITA 2YI9A 2YL5A 2X3VA 1HTYA 2RAKA 1GN9A 3D4ZA 3DDGA 3EJTA 2C08A 2LM0A 2NCZA 2F1BA 2N3KA 2F7QA 2OW6A 3EJQA 3ER9B 1I49A 4FZOA 1HWWA 4HR1A 2OO2A 1MJGA 4NSWA 3DX1A 1R33A 1DKXA 3DPOA 4NQIA 5C5BA 2KHOA 3DX4A 4WPCA 2FYVA 4NPHA 2ZXQA 4JWIA 4EZPA 2YL6A 1SU6A 4IM3A 4R5IA 2OBMA 4EZRA 2QKWA 4WV5A 2EWFA 1DKYA 2GF4A 2JNSA 2YI8A 5KBPA 3BVXA 3DX3A 4AZ6A 3BUBA 4H6HA 2Z0OA 2ELBA 2ND0A 3C7NA 1E2UA 1I4DA 4MQDA 2D4CA 3VKHA 3O3MB 2YIBA 1E1DA 2F7PA 3T49A 1O7DB 3CZNA 4H8SA 2OBLA 1YUWA 4IW0A 3DX0A 3BVWA 4KIKB 4R5LA 1BPRA 4H6IA 3OHXM 3GI7A 3LLLA 3PLTA 3QNIA 4UDXX 2YLAA 1E9VA 2RT6A 3DPQA 1HXKA 2RAIA 3CAZA 2RAJA 3A98A 1TQSA 1ZYLA 2ALWA 3T4AG 1W9MA 1PS3A 3VEBA 4PO2A 3I2WA 3HAHA 3BUDA 1SUFA 2LXYA 4WPEA 4JWDA 4R5GA 3DX2A
chains in the Genus database with same CATH topology
4EZNA 2OP6A 3DPOA 1DG4A 1UPXA 4IWQA 4EZYA 4F00A 3O3OB 2KHOA 4NPHA 3ER8C 4EZPA 2YIVX 4JWIA 3OWGA 1OAOA 3B52X 3ZEDA 4F01A 1SU6A 4IM3A 5FLEX 4EZXA 3B51X 2OBMA 4R5IA 1SU8A 1U00A 4EZRA 1GNLA 2PY6A 3I39X 4WV5A 2EWFA 1DKYA 3VEAA 3O3NB 2JNSA 3DPPA 4ILHB 4FL9A 2YI8A 4ILGA 2Z8YA 4R5JA 4JN4A 4JWCA 3C7NB 4IM2A 1OA1A 4WV7A 2QFFA 3FD9A 2X5CA 3QA8A 4EZVA 4EZZA 4EZUA 4H6HA 2BPRA 4IWOA 4JLCA 4FM3A 3ERCC 4IM0A 4ILIA 3DOBA 2ND0A 1Q5LA 4EZOA 3C7NA 3SBSA 2GAFD 1E2UA 3H0XA 4EZWA 4MQDA 2GA9D 1GNTA 3F7WA 3VKHA 3D2EA 3O3MB 2YIBA 3I04A 1E1DA 2YIAA 1SU7A 3LMFA 3T49A 3RV1A 2OBLA 4M0MA 4UDYX 1YUWA 4IW0A 4E81A 3T47A 3T48A 4EZTA 4HY9A 2ND1A 3SBTB 2QXLA 4JNEA 3L3OM 1OA0A 4KIKB 4R5LA 1BPRA 4E3CA 4H6IA 3KDRA 3OHXM 3DQGA 3ZEFA 4R5KA 2WINM 3I01A 3GI7A 4UDXX 1E9VA 2RT6A 3DPQA 5FIGA 2EX3B 3KAVA 4G6QA 1DKZA 4IWPA 4I43A 1JQKA 4HR1B 5TKYA 3UITA 2YI9A 4KIKA 3B53X 3A98A 2V7YA 7HSCA 1GN9A 4JWEA 2LM0A 2NCZA 4EZQA 3D2FA 4EZSA 2N3KA 1ZYLA 4B9QA 3T4AG 1W9MA 5E84A 3KAWA 3ER9B 4HR1A 3VEBA 4HYBA 3T46A 4PO2A 1MJGA 4JL9A 1SUFA 1DKXA 3N8EA 1CKRA 4D8JA 4JWDA 3QNJA 4R5GA 3RV0A 4JNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T47 A;  4JWE A;  3T48 A;  4EZN A;  4EZT A;  2OP6 A;  3DPO A;  4HY9 A;  4EZQ A;  3D2F A;  4EZS A;  4WV7 A;  2QFF A;  1DG4 A;  2QXL A;  4EZY A;  4JNE A;  4EZV A;  4F00 A;  4B9Q A;  4EZU A;  4EZZ A;  4H6H A;  2KHO A;  3T4A G;  3L3O M;  2BPR A;  5E84 A;  4EZP A;  4JWI A;  1BPR A;  4R5L A;  4H6I A;  3OHX M;  3DQG A;  4F01 A;  4R5K A;  2WIN M;  4HYB A;  3T46 A;  1Q5L A;  2V7Y A;  3DOB A;  4EZO A;  4PO2 A;  4EZX A;  4R5I A;  3C7N A;  1U00 A;  4EZR A;  3H0X A;  7HSC A;  4EZW A;  4WV5 A;  3D2E A;  1DKY A;  1DKX A;  3DPQ A;  3T49 A;  3N8E A;  1CKR A;  1DKZ A;  3DPP A;  4FL9 A;  4JWD A;  5TKY A;  4R5J A;  3QNJ A;  4JN4 A;  4R5G A;  4JWC A;  3C7N B;  1YUW A;  4JNF A;  4E81 A; 
#chains in the Genus database with same CATH topology
 2OP6 A;  1TQW A;  1DG4 A;  4IWQ A;  4F00 A;  3ER8 C;  3CZS A;  2YIV X;  1LQ7 A;  4AZI A;  1OAO A;  3ZED A;  3DYT A;  2PY6 A;  2OZN B;  4ILH B;  4FL9 A;  4JWC A;  2F7R A;  1OA1 A;  4AZG A;  2F7O A;  2BPR A;  4JLC A;  2F18 A;  1QWN A;  1Q5L A;  3SYV A;  4EZO A;  2Q12 A;  1TQV A;  2GA9 D;  1SU7 A;  3EJP A;  3QWE A;  3RV1 A;  4UDY X;  1URU A;  3T48 A;  4DYL A;  2JNK A;  2QXL A;  3CVR A;  3EJU A;  3ZEF A;  4I1Q A;  4AZC B;  4FZP A;  3Q0K A;  5FIG A;  4G6Q A;  4I43 A;  2PMR A;  3ABH A;  3D51 A;  5TKY A;  4KIK A;  2V7Y A;  3BVT A;  4EZQ A;  3D4Y A;  4EZS A;  4B9Q A;  5E84 A;  1QWU A;  3T46 A;  1TQT A;  3DDF A;  1O7D C;  3EJS A;  4JL9 A;  3QNJ A;  1R34 A;  4AZ5 A;  4EZN A;  2V0O A;  2WYH A;  3D50 A;  3G9G A;  2Q13 A;  3CKD A;  3HAI A;  4F01 A;  4AKV A;  5FLE X;  1SU8 A;  1GNL A;  2YLL A;  3CV5 A;  3I39 X;  3DPP A;  2Z8Y A;  4R5J A;  4DCN C;  1WDZ A;  4IM2 A;  3D52 A;  2QFF A;  3FD9 A;  4ATM A;  4AZ7 A;  3BUP A;  1X03 A;  2O0I 1;  3ERC C;  4ILI A;  4BNE A;  3RPM A;  3SBS A;  2GAF D;  3D2E A;  3I04 A;  3LMF A;  2OW7 A;  3QE6 A;  4E81 A;  3T47 A;  1YWM A;  2YL8 A;  3EJR A;  4JNE A;  2FIC A;  3L3O M;  1OA0 A;  2YKT A;  1R5E A;  3DQG A;  2Z0V A;  4AZH A;  3I01 A;  1TQU A;  1ZWW A;  4AZB A;  2D1L A;  3KAV A;  1DKZ A;  1JQK A;  4HR1 B;  3Q84 A;  3B53 X;  3SOG A;  7HSC A;  4JWE A;  3D2F A;  4AZC A;  1I4T A;  3KAW A;  3LVT A;  3BLB A;  2X3X A;  4HYB A;  5C5B B;  4FZS A;  3M3W A;  3BVV A;  3N8E A;  1CKR A;  4D8J A;  1X04 A;  3RV0 A;  1QX1 A;  4JNF A;  3OK8 A;  3BVU A;  1UPX A;  4EZY A;  3O3O B;  1I4L A;  2Z0N A;  3OWG A;  3B52 X;  2EFL A;  4EZX A;  3B51 X;  2X3W A;  1U00 A;  1Y2O A;  3VEA A;  3O3N B;  2F1A A;  4ILG A;  4JN4 A;  3C7N B;  3L3P A;  4WV7 A;  2X5C A;  3QA8 A;  4EZV A;  4EZZ A;  4EZU A;  3HAJ A;  4IWO A;  4FM3 A;  2EFK A;  2YL9 A;  4IM0 A;  3DOB A;  3BUI A;  3H0X A;  4EZW A;  1GNT A;  3F7W A;  2YIA A;  4M0M A;  4EZT A;  2WYI A;  3ACO A;  2ND1 A;  4HY9 A;  3SBT B;  4E3C A;  2MI7 A;  3KDR A;  4R5K A;  2WIN M;  3BUQ A;  4AVM A;  2EX3 B;  4IWP A;  3UIT A;  2YI9 A;  2YL5 A;  2X3V A;  1HTY A;  2RAK A;  1GN9 A;  3D4Z A;  3DDG A;  3EJT A;  2C08 A;  2LM0 A;  2NCZ A;  2F1B A;  2N3K A;  2F7Q A;  2OW6 A;  3EJQ A;  3ER9 B;  1I49 A;  4FZO A;  1HWW A;  4HR1 A;  2OO2 A;  1MJG A;  4NSW A;  3DX1 A;  1R33 A;  1DKX A;  3DPO A;  4NQI A;  5C5B A;  2KHO A;  3DX4 A;  4WPC A;  2FYV A;  4NPH A;  2ZXQ A;  4JWI A;  4EZP A;  2YL6 A;  1SU6 A;  4IM3 A;  4R5I A;  2OBM A;  4EZR A;  2QKW A;  4WV5 A;  2EWF A;  1DKY A;  2GF4 A;  2JNS A;  2YI8 A;  5KBP A;  3BVX A;  3DX3 A;  4AZ6 A;  3BUB A;  4H6H A;  2Z0O A;  2ELB A;  2ND0 A;  3C7N A;  1E2U A;  1I4D A;  4MQD A;  2D4C A;  3VKH A;  3O3M B;  2YIB A;  1E1D A;  2F7P A;  3T49 A;  1O7D B;  3CZN A;  4H8S A;  2OBL A;  1YUW A;  4IW0 A;  3DX0 A;  3BVW A;  4KIK B;  4R5L A;  1BPR A;  4H6I A;  3OHX M;  3GI7 A;  3LLL A;  3PLT A;  3QNI A;  4UDX X;  2YLA A;  1E9V A;  2RT6 A;  3DPQ A;  1HXK A;  2RAI A;  3CAZ A;  2RAJ A;  3A98 A;  1TQS A;  1ZYL A;  2ALW A;  3T4A G;  1W9M A;  1PS3 A;  3VEB A;  4PO2 A;  3I2W A;  3HAH A;  3BUD A;  1SUF A;  2LXY A;  4WPE A;  4JWD A;  4R5G A;  3DX2 A; 
#chains in the Genus database with same CATH homology
 4EZN A;  2OP6 A;  3DPO A;  1DG4 A;  1UPX A;  4IWQ A;  4EZY A;  4F00 A;  3O3O B;  2KHO A;  4NPH A;  3ER8 C;  4EZP A;  2YIV X;  4JWI A;  3OWG A;  1OAO A;  3B52 X;  3ZED A;  4F01 A;  1SU6 A;  4IM3 A;  5FLE X;  4EZX A;  3B51 X;  2OBM A;  4R5I A;  1SU8 A;  1U00 A;  4EZR A;  1GNL A;  2PY6 A;  3I39 X;  4WV5 A;  2EWF A;  1DKY A;  3VEA A;  3O3N B;  2JNS A;  3DPP A;  4ILH B;  4FL9 A;  2YI8 A;  4ILG A;  2Z8Y A;  4R5J A;  4JN4 A;  4JWC A;  3C7N B;  4IM2 A;  1OA1 A;  4WV7 A;  2QFF A;  3FD9 A;  2X5C A;  3QA8 A;  4EZV A;  4EZZ A;  4EZU A;  4H6H A;  2BPR A;  4IWO A;  4JLC A;  4FM3 A;  3ERC C;  4IM0 A;  4ILI A;  3DOB A;  2ND0 A;  1Q5L A;  4EZO A;  3C7N A;  3SBS A;  2GAF D;  1E2U A;  3H0X A;  4EZW A;  4MQD A;  2GA9 D;  1GNT A;  3F7W A;  3VKH A;  3D2E A;  3O3M B;  2YIB A;  3I04 A;  1E1D A;  2YIA A;  1SU7 A;  3LMF A;  3T49 A;  3RV1 A;  2OBL A;  4M0M A;  4UDY X;  1YUW A;  4IW0 A;  4E81 A;  3T47 A;  3T48 A;  4EZT A;  4HY9 A;  2ND1 A;  3SBT B;  2QXL A;  4JNE A;  3L3O M;  1OA0 A;  4KIK B;  4R5L A;  1BPR A;  4E3C A;  4H6I A;  3KDR A;  3OHX M;  3DQG A;  3ZEF A;  4R5K A;  2WIN M;  3I01 A;  3GI7 A;  4UDX X;  1E9V A;  2RT6 A;  3DPQ A;  5FIG A;  2EX3 B;  3KAV A;  4G6Q A;  1DKZ A;  4IWP A;  4I43 A;  1JQK A;  4HR1 B;  5TKY A;  3UIT A;  2YI9 A;  4KIK A;  3B53 X;  3A98 A;  2V7Y A;  7HSC A;  1GN9 A;  4JWE A;  2LM0 A;  2NCZ A;  4EZQ A;  3D2F A;  4EZS A;  2N3K A;  1ZYL A;  4B9Q A;  3T4A G;  1W9M A;  5E84 A;  3KAW A;  3ER9 B;  4HR1 A;  3VEB A;  4HYB A;  3T46 A;  4PO2 A;  1MJG A;  4JL9 A;  1SUF A;  1DKX A;  3N8E A;  1CKR A;  4D8J A;  4JWD A;  3QNJ A;  4R5G A;  3RV0 A;  4JNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...