1DKYA

The substrate binding domain of dnak in complex with a substrate peptide, determined from type 2 native crystals
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
211
structure length
211
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVSIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNAK
publication title Structural analysis of substrate binding by the molecular chaperone DnaK.
pubmed rcsb
molecule tags Complex (molecular chaperone/peptide)
total genus 54
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 1dkyA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 1dkyA01
3C7NA 4EZNA 4B9QA 4EZUA 4JN4A 4R5IA 1DKXA 4HY9A 4PO2A 4EZOA 4F00A 4EZYA 7HSCA 4JNEA 3T46A 4EZVA 4R5GA 5TKYA 4EZXA 1DG4A 4JWDA 3D2EA 1BPRA 2QXLA 4EZWA 1DKZA 4HYBA 4H6HA 1DKYA 3QNJA 4R5KA 4EZTA 3H0XA 4JNFA 2KHOA 4H6IA 3T48A 3OHXM 1CKRA 2QFFA 1YUWA 3DPPA 3DQGA 2WINM 3D2FA 3T49A 4EZPA 3N8EA 4JWCA 2OP6A 2BPRA 3DPQA 1U00A 4E81A 4EZQA 4JWEA 1Q5LA 4EZSA 4F01A 4EZRA 3DPOA 3DOBA 4R5LA 5E84A 3C7NB 4WV7A 4JWIA 4WV5A 2V7YA 4EZZA 4R5JA 4FL9A 3T47A 3T4AG 3L3OM
chains in the Genus database with same CATH superfamily
2X3WA 2RAJA 1DKXA 4PO2A 4G6QA 3D2EA 2F7PA 4HYBA 1DKYA 2V0OA 3L3PA 1GNLA 3ACOA 2OBLA 2YLAA 3EJQA 2LXYA 4AZ7A 2PMRA 3DDGA 3SYVA 3BUIA 3VEAA 4UDYX 4D8JA 2GAFD 3HAJA 3SBSA 4ILGA 2F1AA 1DG4A 3QA8A 1ZYLA 3H0XA 1CKRA 3KDRA 3I04A 4AZCB 1E1DA 4AZCA 1Q5LA 4IW0A 4R5LA 4FL9A 4EZZA 4JN4A 7HSCA 3T46A 1OAOA 3M3WA 3QWEA 2D4CA 4JWDA 4EZWA 2YLLA 3B53X 4ILIA 2QFFA 4FZPA 3CZNA 2ND0A 3UITA 3DDFA 4DCNC 4IWPA 1TQTA 2WYIA 4NSWA 4R5JA 4MQDA 3B52X 2Q13A 4EZXA 3EJRA 2OW7A 4I1QA 2D1LA 2X5CA 3QNIA 3DQGA 2N3KA 1QWUA 1OA1A 2RAIA 4AVMA 4NPHA 3CV5A 2YIVX 4JNEA 1R33A 4JL9A 5C5BB 2C08A 3T49A 3BVVA 4M0MA 2BPRA 1R5EA 4JWEA 1I4LA 2EFLA 4AZHA 4EZUA 2X3XA 3O3OB 4JLCA 3LLLA 3HAHA 3EJPA 4H6IA 1YUWA 4UDXX 3ZEFA 3HAIA 2ZXQA 2OBMA 4AZIA 3EJUA 3GI7A 3ABHA 4FM3A 2F18A 3DX4A 4FZOA 2YKTA 2Z0NA 1URUA 1SUFA 2GA9D 3OWGA 2JNSA 2OP6A 3VKHA 4EZRA 1SU7A 4JWIA 4WV5A 3LVTA 1TQSA 4EZNA 2OO2A 5TKYA 1BPRA 4EZTA 4ILHB 3CVRA 4AZ6A 2ND1A 3DPPA 2WINM 3PLTA 3KAWA 3I2WA 1TQWA 2GF4A 3C7NB 2V7YA 3L3OM 3C7NA 1I4TA 4I43A 3I39X 2OW6A 1O7DB 3D4ZA 4FZSA 1YWMA 4AKVA 1GNTA 3CAZA 3QNJA 4WPCA 4JNFA 4ATMA 2RT6A 3O3NB 3SOGA 2ALWA 3D52A 2Z8YA 4F01A 4WPEA 2RAKA 2FICA 2X3VA 4R5IA 5FIGA 2YIBA 4EZYA 1WDZA 2YI9A 2ELBA 2NCZA 3ER9B 2F7RA 2F7OA 5C5BA 1X03A 4JWCA 2JNKA 4HR1B 4HR1A 1W9MA 3OK8A 2MI7A 2OZNB 3BUBA 2F1BA 1JQKA 5KBPA 4R5KA 2KHOA 1I49A 3SBTB 4IWOA 4WV7A 1QX1A 3KAVA 4AZGA 1I4DA 4HY9A 3O3MB 2QKWA 3D51A 3BVUA 1LQ7A 1HTYA 1TQVA 3BVTA 3N8EA 2FYVA 2YL5A 3DPOA 1GN9A 1QWNA 4AZ5A 1SU8A 3DX3A 4EZOA 2F7QA 2QXLA 1DKZA 3DX1A 4IM0A 3Q84A 4KIKB 4DYLA 4EZPA 4KIKA 2YIAA 1U00A 3EJTA 1MJGA 4EZSA 1HXKA 3DYTA 1E2UA 3CZSA 3T47A 3B51X 4R5GA 1SU6A 3F7WA 4H6HA 3BLBA 4NQIA 1X04A 3RPMA 5FLEX 2YI8A 3VEBA 1HWWA 2LM0A 2EWFA 3BVWA 1R34A 3ERCC 5E84A 3CKDA 2PY6A 3DX0A 3FD9A 4B9QA 2Z0OA 3D4YA 4IWQA 4F00A 2YL8A 4EZVA 1ZWWA 1O7DC 3RV1A 3ER8C 1UPXA 1OA0A 1TQUA 4IM2A 2Q12A 3T48A 3OHXM 2YL6A 3A98A 3D2FA 3Q0KA 3DX2A 3DPQA 2EX3B 2Z0VA 2EFKA 3BUQA 3LMFA 2WYHA 3RV0A 1Y2OA 3QE6A 4E3CA 3D50A 4BNEA 1E9VA 4IM3A 2O0I1 3BUDA 2YL9A 4AZBA 3BUPA 1PS3A 3ZEDA 3EJSA 3G9GA 3I01A 4EZQA 4H8SA 3DOBA 3BVXA 4E81A 3T4AG
chains in the Genus database with same CATH topology
3C7NA 4I43A 1SU8A 3I39X 2YIVX 1DKXA 4PO2A 4EZOA 4JNEA 1GNTA 4G6QA 3D2EA 2QXLA 1DKZA 4HYBA 4JL9A 1DKYA 3QNJA 4JNFA 4IM0A 4KIKB 1GNLA 2RT6A 3O3NB 3T49A 4EZPA 4KIKA 2OBLA 4M0MA 2YIAA 2BPRA 1U00A 2Z8YA 4JWEA 1MJGA 4EZSA 4F01A 1E2UA 3T47A 3B51X 4EZUA 4R5IA 5FIGA 2YIBA 4EZYA 2YI9A 3VEAA 4UDYX 4D8JA 2GAFD 1SU6A 4R5GA 4ILGA 3SBSA 1DG4A 3F7WA 3QA8A 1ZYLA 3O3OB 4JLCA 4H6HA 3H0XA 2NCZA 4H6IA 1CKRA 3ER9B 1YUWA 3KDRA 5FLEX 2YI8A 3VEBA 4UDXX 3I04A 4JWCA 2LM0A 4HR1B 2EWFA 1E1DA 1Q5LA 4E81A 3ZEFA 4HR1A 3ERCC 4IW0A 4R5LA 2PY6A 5E84A 1W9MA 2OBMA 4FL9A 3FD9A 4EZZA 3GI7A 4B9QA 4JN4A 4FM3A 4IWQA 4F00A 7HSCA 3T46A 4EZVA 1JQKA 1OAOA 4JWDA 3RV1A 4EZWA 3ER8C 1UPXA 1OA0A 4R5KA 4IM2A 3B53X 2KHOA 1SUFA 3T48A 2GA9D 4ILIA 3OHXM 2QFFA 3A98A 3D2FA 2ND0A 3OWGA 3UITA 2JNSA 3SBTB 2OP6A 3VKHA 3DPQA 2EX3B 4EZRA 4IWPA 4IWOA 4WV7A 1SU7A 4JWIA 4WV5A 4R5JA 3KAVA 3LMFA 4MQDA 4EZNA 4HY9A 3RV0A 3B52X 3O3MB 4E3CA 1E9VA 5TKYA 4EZXA 4IM3A 1BPRA 2X5CA 4EZTA 4ILHB 2ND1A 3DPPA 3DQGA 2WINM 3ZEDA 3KAWA 3N8EA 2N3KA 3I01A 4EZQA 1OA1A 3DPOA 3DOBA 1GN9A 3C7NB 2V7YA 4NPHA 3T4AG 3L3OM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C7N A;  4EZN A;  4B9Q A;  4EZU A;  4JN4 A;  4R5I A;  1DKX A;  4HY9 A;  4PO2 A;  4EZO A;  4F00 A;  4EZY A;  7HSC A;  4JNE A;  3T46 A;  4EZV A;  4R5G A;  5TKY A;  4EZX A;  1DG4 A;  4JWD A;  3D2E A;  1BPR A;  2QXL A;  4EZW A;  1DKZ A;  4HYB A;  4H6H A;  1DKY A;  3QNJ A;  4R5K A;  4EZT A;  3H0X A;  4JNF A;  2KHO A;  4H6I A;  3T48 A;  3OHX M;  1CKR A;  2QFF A;  1YUW A;  3DPP A;  3DQG A;  2WIN M;  3D2F A;  3T49 A;  4EZP A;  3N8E A;  4JWC A;  2OP6 A;  2BPR A;  3DPQ A;  1U00 A;  4E81 A;  4EZQ A;  4JWE A;  1Q5L A;  4EZS A;  4F01 A;  4EZR A;  3DPO A;  3DOB A;  4R5L A;  5E84 A;  3C7N B;  4WV7 A;  4JWI A;  4WV5 A;  2V7Y A;  4EZZ A;  4R5J A;  4FL9 A;  3T47 A;  3T4A G;  3L3O M; 
#chains in the Genus database with same CATH topology
 2X3W A;  2RAJ A;  1DKX A;  4PO2 A;  4G6Q A;  3D2E A;  2F7P A;  4HYB A;  1DKY A;  2V0O A;  3L3P A;  1GNL A;  3ACO A;  2OBL A;  2YLA A;  3EJQ A;  2LXY A;  4AZ7 A;  2PMR A;  3DDG A;  3SYV A;  3BUI A;  3VEA A;  4UDY X;  4D8J A;  2GAF D;  3HAJ A;  3SBS A;  4ILG A;  2F1A A;  1DG4 A;  3QA8 A;  1ZYL A;  3H0X A;  1CKR A;  3KDR A;  3I04 A;  4AZC B;  1E1D A;  4AZC A;  1Q5L A;  4IW0 A;  4R5L A;  4FL9 A;  4EZZ A;  4JN4 A;  7HSC A;  3T46 A;  1OAO A;  3M3W A;  3QWE A;  2D4C A;  4JWD A;  4EZW A;  2YLL A;  3B53 X;  4ILI A;  2QFF A;  4FZP A;  3CZN A;  2ND0 A;  3UIT A;  3DDF A;  4DCN C;  4IWP A;  1TQT A;  2WYI A;  4NSW A;  4R5J A;  4MQD A;  3B52 X;  2Q13 A;  4EZX A;  3EJR A;  2OW7 A;  4I1Q A;  2D1L A;  2X5C A;  3QNI A;  3DQG A;  2N3K A;  1QWU A;  1OA1 A;  2RAI A;  4AVM A;  4NPH A;  3CV5 A;  2YIV X;  4JNE A;  1R33 A;  4JL9 A;  5C5B B;  2C08 A;  3T49 A;  3BVV A;  4M0M A;  2BPR A;  1R5E A;  4JWE A;  1I4L A;  2EFL A;  4AZH A;  4EZU A;  2X3X A;  3O3O B;  4JLC A;  3LLL A;  3HAH A;  3EJP A;  4H6I A;  1YUW A;  4UDX X;  3ZEF A;  3HAI A;  2ZXQ A;  2OBM A;  4AZI A;  3EJU A;  3GI7 A;  3ABH A;  4FM3 A;  2F18 A;  3DX4 A;  4FZO A;  2YKT A;  2Z0N A;  1URU A;  1SUF A;  2GA9 D;  3OWG A;  2JNS A;  2OP6 A;  3VKH A;  4EZR A;  1SU7 A;  4JWI A;  4WV5 A;  3LVT A;  1TQS A;  4EZN A;  2OO2 A;  5TKY A;  1BPR A;  4EZT A;  4ILH B;  3CVR A;  4AZ6 A;  2ND1 A;  3DPP A;  2WIN M;  3PLT A;  3KAW A;  3I2W A;  1TQW A;  2GF4 A;  3C7N B;  2V7Y A;  3L3O M;  3C7N A;  1I4T A;  4I43 A;  3I39 X;  2OW6 A;  1O7D B;  3D4Z A;  4FZS A;  1YWM A;  4AKV A;  1GNT A;  3CAZ A;  3QNJ A;  4WPC A;  4JNF A;  4ATM A;  2RT6 A;  3O3N B;  3SOG A;  2ALW A;  3D52 A;  2Z8Y A;  4F01 A;  4WPE A;  2RAK A;  2FIC A;  2X3V A;  4R5I A;  5FIG A;  2YIB A;  4EZY A;  1WDZ A;  2YI9 A;  2ELB A;  2NCZ A;  3ER9 B;  2F7R A;  2F7O A;  5C5B A;  1X03 A;  4JWC A;  2JNK A;  4HR1 B;  4HR1 A;  1W9M A;  3OK8 A;  2MI7 A;  2OZN B;  3BUB A;  2F1B A;  1JQK A;  5KBP A;  4R5K A;  2KHO A;  1I49 A;  3SBT B;  4IWO A;  4WV7 A;  1QX1 A;  3KAV A;  4AZG A;  1I4D A;  4HY9 A;  3O3M B;  2QKW A;  3D51 A;  3BVU A;  1LQ7 A;  1HTY A;  1TQV A;  3BVT A;  3N8E A;  2FYV A;  2YL5 A;  3DPO A;  1GN9 A;  1QWN A;  4AZ5 A;  1SU8 A;  3DX3 A;  4EZO A;  2F7Q A;  2QXL A;  1DKZ A;  3DX1 A;  4IM0 A;  3Q84 A;  4KIK B;  4DYL A;  4EZP A;  4KIK A;  2YIA A;  1U00 A;  3EJT A;  1MJG A;  4EZS A;  1HXK A;  3DYT A;  1E2U A;  3CZS A;  3T47 A;  3B51 X;  4R5G A;  1SU6 A;  3F7W A;  4H6H A;  3BLB A;  4NQI A;  1X04 A;  3RPM A;  5FLE X;  2YI8 A;  3VEB A;  1HWW A;  2LM0 A;  2EWF A;  3BVW A;  1R34 A;  3ERC C;  5E84 A;  3CKD A;  2PY6 A;  3DX0 A;  3FD9 A;  4B9Q A;  2Z0O A;  3D4Y A;  4IWQ A;  4F00 A;  2YL8 A;  4EZV A;  1ZWW A;  1O7D C;  3RV1 A;  3ER8 C;  1UPX A;  1OA0 A;  1TQU A;  4IM2 A;  2Q12 A;  3T48 A;  3OHX M;  2YL6 A;  3A98 A;  3D2F A;  3Q0K A;  3DX2 A;  3DPQ A;  2EX3 B;  2Z0V A;  2EFK A;  3BUQ A;  3LMF A;  2WYH A;  3RV0 A;  1Y2O A;  3QE6 A;  4E3C A;  3D50 A;  4BNE A;  1E9V A;  4IM3 A;  2O0I 1;  3BUD A;  2YL9 A;  4AZB A;  3BUP A;  1PS3 A;  3ZED A;  3EJS A;  3G9G A;  3I01 A;  4EZQ A;  4H8S A;  3DOB A;  3BVX A;  4E81 A;  3T4A G; 
#chains in the Genus database with same CATH homology
 3C7N A;  4I43 A;  1SU8 A;  3I39 X;  2YIV X;  1DKX A;  4PO2 A;  4EZO A;  4JNE A;  1GNT A;  4G6Q A;  3D2E A;  2QXL A;  1DKZ A;  4HYB A;  4JL9 A;  1DKY A;  3QNJ A;  4JNF A;  4IM0 A;  4KIK B;  1GNL A;  2RT6 A;  3O3N B;  3T49 A;  4EZP A;  4KIK A;  2OBL A;  4M0M A;  2YIA A;  2BPR A;  1U00 A;  2Z8Y A;  4JWE A;  1MJG A;  4EZS A;  4F01 A;  1E2U A;  3T47 A;  3B51 X;  4EZU A;  4R5I A;  5FIG A;  2YIB A;  4EZY A;  2YI9 A;  3VEA A;  4UDY X;  4D8J A;  2GAF D;  1SU6 A;  4R5G A;  4ILG A;  3SBS A;  1DG4 A;  3F7W A;  3QA8 A;  1ZYL A;  3O3O B;  4JLC A;  4H6H A;  3H0X A;  2NCZ A;  4H6I A;  1CKR A;  3ER9 B;  1YUW A;  3KDR A;  5FLE X;  2YI8 A;  3VEB A;  4UDX X;  3I04 A;  4JWC A;  2LM0 A;  4HR1 B;  2EWF A;  1E1D A;  1Q5L A;  4E81 A;  3ZEF A;  4HR1 A;  3ERC C;  4IW0 A;  4R5L A;  2PY6 A;  5E84 A;  1W9M A;  2OBM A;  4FL9 A;  3FD9 A;  4EZZ A;  3GI7 A;  4B9Q A;  4JN4 A;  4FM3 A;  4IWQ A;  4F00 A;  7HSC A;  3T46 A;  4EZV A;  1JQK A;  1OAO A;  4JWD A;  3RV1 A;  4EZW A;  3ER8 C;  1UPX A;  1OA0 A;  4R5K A;  4IM2 A;  3B53 X;  2KHO A;  1SUF A;  3T48 A;  2GA9 D;  4ILI A;  3OHX M;  2QFF A;  3A98 A;  3D2F A;  2ND0 A;  3OWG A;  3UIT A;  2JNS A;  3SBT B;  2OP6 A;  3VKH A;  3DPQ A;  2EX3 B;  4EZR A;  4IWP A;  4IWO A;  4WV7 A;  1SU7 A;  4JWI A;  4WV5 A;  4R5J A;  3KAV A;  3LMF A;  4MQD A;  4EZN A;  4HY9 A;  3RV0 A;  3B52 X;  3O3M B;  4E3C A;  1E9V A;  5TKY A;  4EZX A;  4IM3 A;  1BPR A;  2X5C A;  4EZT A;  4ILH B;  2ND1 A;  3DPP A;  3DQG A;  2WIN M;  3ZED A;  3KAW A;  3N8E A;  2N3K A;  3I01 A;  4EZQ A;  1OA1 A;  3DPO A;  3DOB A;  1GN9 A;  3C7N B;  2V7Y A;  4NPH A;  3T4A G;  3L3O M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...