4JWCA

Crystal structure of the substrate binding domain of e.coli dnak in complex with bovine bac7(1-16)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
213
structure length
213
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Identification of DnaK Binding Sites within Bovine and Sheep Bactenecin Bac7.
pubmed rcsb
source organism Escherichia coli
molecule tags Chaperone/antibiotic
total genus 61
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4jwcA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4jwcA01
3D2EA 3T49A 4HY9A 1DKYA 4JWIA 4R5GA 2OP6A 2WINM 3DPOA 4B9QA 4EZPA 4JNFA 3T46A 3T4AG 4EZOA 2V7YA 2QXLA 4EZVA 4R5IA 1DKZA 7HSCA 1CKRA 3C7NA 4HYBA 4F01A 4F00A 4PO2A 4FL9A 3T47A 4EZTA 4WV5A 1YUWA 1DKXA 3OHXM 4H6IA 4JWEA 4R5JA 4EZWA 4R5LA 4WV7A 4EZNA 4EZSA 4EZYA 3D2FA 1Q5LA 4EZZA 4EZQA 3C7NB 3N8EA 4H6HA 1U00A 4JWDA 5E84A 2QFFA 4JN4A 3DPPA 4R5KA 5TKYA 3T48A 3QNJA 3L3OM 4EZXA 2BPRA 3H0XA 2KHOA 3DQGA 4JWCA 4JNEA 1DG4A 4E81A 3DPQA 4EZRA 4EZUA 1BPRA 3DOBA
chains in the Genus database with same CATH superfamily
2PMRA 3M3WA 3VEAA 4EZPA 3D51A 2X3VA 2YL5A 2OW6A 3T47A 3BUPA 1ZWWA 2Z0NA 4JWEA 1ZYLA 4EZZA 4MQDA 5E84A 2X3XA 1I4TA 3D4YA 3ZEFA 4AZCB 3D4ZA 3D52A 2X3WA 3ERCC 3D2EA 2V0OA 4ILHB 3Q0KA 2LXYA 4EZWA 4WPCA 1Q5LA 3BVWA 1GN9A 1JQKA 3I39X 3O3MB 3H0XA 2OO2A 1R34A 2YLLA 4JNEA 1BPRA 4UDXX 4IM2A 4JWIA 3BUDA 3QA8A 2EX3B 4AZGA 3PLTA 2EFKA 3C7NA 1TQSA 2GA9D 4H6IA 1MJGA 4EZQA 2Z0VA 1TQTA 3DPPA 3BVTA 4M0MA 3DQGA 2YI9A 3EJQA 2WYHA 2C08A 1TQVA 1QWUA 3DX1A 2Q12A 2ND0A 4R5IA 3LMFA 3LLLA 2MI7A 3A98A 1YWMA 4FM3A 3N8EA 1GNTA 3L3OM 3DDFA 4JWCA 3D50A 3DOBA 3SBSA 3B52X 1CKRA 4DYLA 2D4CA 3ACOA 4WV7A 4EZNA 4EZSA 4AZCA 2ELBA 2F18A 4AVMA 1I4DA 2F7QA 2OBLA 2RAJA 3EJSA 2ND1A 3KAWA 4E3CA 3QNIA 2OZNB 3UITA 2NCZA 4EZOA 4JLCA 4IW0A 3CV5A 2YL9A 4ILIA 2F1BA 4AZIA 3CVRA 1E1DA 4ILGA 3DX3A 5KBPA 3BUQA 1OA1A 4JN4A 4EZXA 2JNSA 1DG4A 2YIAA 3DPQA 4E81A 3ER8C 3CZSA 4BNEA 3I01A 3CKDA 1GNLA 4FL9A 2YKTA 1UPXA 1HWWA 2N3KA 3CAZA 3BVUA 5C5BB 2OBMA 2YIBA 2OW7A 4AZHA 2QXLA 4EZVA 2D1LA 4R5LA 4IWOA 1U00A 2QFFA 5TKYA 2F7OA 2BPRA 1X03A 1E2UA 3BLBA 4NSWA 2F7PA 1OAOA 1Y2OA 3T49A 4AZ7A 4NQIA 2Z8YA 3DPOA 3DX0A 4B9QA 4JNFA 3O3OB 1OA0A 2WYIA 4EZTA 4WV5A 4H8SA 3I2WA 1SU6A 3D2FA 2YIVX 3F7WA 2JNKA 3DX4A 4R5KA 3T48A 4AZBA 2O0I1 2KHOA 4IM0A 3VKHA 2YI8A 2Q13A 3DYTA 3CZNA 2RAIA 2WINM 1SU7A 1URUA 4IM3A 3HAIA 4D8JA 2RAKA 3SYVA 5FLEX 4IWPA 2EWFA 3LVTA 4EZUA 4AZ6A 4FZSA 3GI7A 3HAJA 1HXKA 2YL8A 3T4AG 3SBTB 3ER9B 2YLAA 1I49A 3B51X 5C5BA 3QWEA 3KDRA 3EJPA 1SU8A 1R5EA 3SOGA 1X04A 1E9VA 3I04A 3O3NB 4EZRA 4IWQA 2ALWA 4AZ5A 2LM0A 1LQ7A 2V7YA 1W9MA 4PO2A 1TQWA 3BVVA 3EJTA 2F7RA 2GF4A 3KAVA 3EJRA 1HTYA 3ZEDA 1QWNA 4I43A 1I4LA 1PS3A 2EFLA 1TQUA 4AKVA 2OP6A 3BVXA 7HSCA 4F01A 1O7DB 4H6HA 3DDGA 2Z0OA 3L3PA 3OK8A 1DKYA 4FZPA 3T46A 2RT6A 4ATMA 1DKZA 4HYBA 2FICA 1YUWA 1DKXA 3RV1A 3HAHA 4EZYA 3VEBA 2FYVA 4WPEA 4UDYX 4NPHA 1O7DC 3QNJA 3FD9A 5FIGA 4KIKA 3DX2A 4DCNC 2X5CA 4HR1A 3G9GA 3OWGA 3BUIA 3OHXM 4R5JA 1QX1A 1SUFA 2PY6A 3BUBA 3C7NB 1WDZA 4JWDA 2F1AA 4FZOA 2QKWA 3RV0A 4HY9A 4R5GA 2ZXQA 4I1QA 4KIKB 3Q84A 3B53X 3EJUA 2GAFD 4F00A 4G6QA 1R33A 4HR1B 4JL9A 3RPMA 3QE6A 2YL6A 3ABHA
chains in the Genus database with same CATH topology
3T49A 2OP6A 3VEAA 3SBSA 2Z8YA 3DPOA 4B9QA 4EZPA 4JNFA 3O3OB 3B52X 7HSCA 1CKRA 4F01A 1OA0A 3T47A 4EZTA 4WV5A 4JWEA 1ZYLA 4WV7A 4EZNA 4EZSA 1SU6A 3D2FA 2YIVX 4EZZA 4MQDA 3F7WA 4H6HA 5E84A 4R5KA 3T48A 2KHOA 4IM0A 3ZEFA 2OBLA 2ND1A 3VKHA 3KAWA 2YI8A 3ERCC 3D2EA 4E3CA 1DKYA 2WINM 3UITA 4ILHB 3T46A 2NCZA 4EZOA 1SU7A 2RT6A 4IW0A 4JLCA 1DKZA 4ILIA 4HYBA 1E1DA 1YUWA 4ILGA 1DKXA 3RV1A 4EZWA 4IM3A 4EZYA 1Q5LA 3VEBA 1GN9A 1OA1A 1JQKA 3I39X 3O3MB 4JN4A 4UDYX 4NPHA 3QNJA 4EZXA 4D8JA 3H0XA 3FD9A 5FIGA 4KIKA 5FLEX 4JNEA 2JNSA 4IWPA 1DG4A 2EWFA 2YIAA 3DPQA 4E81A 4EZUA 1BPRA 3ER8C 4UDXX 2X5CA 3GI7A 4IM2A 4HR1A 4JWIA 3I01A 3OWGA 3QA8A 2EX3B 3T4AG 3SBTB 3ER9B 3C7NA 1GNLA 4FL9A 3B51X 2GA9D 3OHXM 4H6IA 4R5JA 1SUFA 1UPXA 2PY6A 3KDRA 1MJGA 2N3KA 4EZQA 1SU8A 3C7NB 4JWDA 1E9VA 3DPPA 3I04A 4M0MA 3DQGA 2YI9A 3O3NB 3RV0A 4EZRA 4IWQA 4HY9A 2OBMA 2YIBA 4R5GA 2LM0A 4KIKB 2V7YA 2QXLA 2ND0A 3B53X 4R5IA 4EZVA 2GAFD 1W9MA 4F00A 4PO2A 3LMFA 4G6QA 4HR1B 4JL9A 4R5LA 3A98A 4IWOA 4FM3A 3N8EA 1GNTA 1U00A 2QFFA 5TKYA 3KAVA 2BPRA 3L3OM 1E2UA 4JWCA 3ZEDA 4I43A 3DOBA 1OAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D2E A;  3T49 A;  4HY9 A;  1DKY A;  4JWI A;  4R5G A;  2OP6 A;  2WIN M;  3DPO A;  4B9Q A;  4EZP A;  4JNF A;  3T46 A;  3T4A G;  4EZO A;  2V7Y A;  2QXL A;  4EZV A;  4R5I A;  1DKZ A;  7HSC A;  1CKR A;  3C7N A;  4HYB A;  4F01 A;  4F00 A;  4PO2 A;  4FL9 A;  3T47 A;  4EZT A;  4WV5 A;  1YUW A;  1DKX A;  3OHX M;  4H6I A;  4JWE A;  4R5J A;  4EZW A;  4R5L A;  4WV7 A;  4EZN A;  4EZS A;  4EZY A;  3D2F A;  1Q5L A;  4EZZ A;  4EZQ A;  3C7N B;  3N8E A;  4H6H A;  1U00 A;  4JWD A;  5E84 A;  2QFF A;  4JN4 A;  3DPP A;  4R5K A;  5TKY A;  3T48 A;  3QNJ A;  3L3O M;  4EZX A;  2BPR A;  3H0X A;  2KHO A;  3DQG A;  4JWC A;  4JNE A;  1DG4 A;  4E81 A;  3DPQ A;  4EZR A;  4EZU A;  1BPR A;  3DOB A; 
#chains in the Genus database with same CATH topology
 2PMR A;  3M3W A;  3VEA A;  4EZP A;  3D51 A;  2X3V A;  2YL5 A;  2OW6 A;  3T47 A;  3BUP A;  1ZWW A;  2Z0N A;  4JWE A;  1ZYL A;  4EZZ A;  4MQD A;  5E84 A;  2X3X A;  1I4T A;  3D4Y A;  3ZEF A;  4AZC B;  3D4Z A;  3D52 A;  2X3W A;  3ERC C;  3D2E A;  2V0O A;  4ILH B;  3Q0K A;  2LXY A;  4EZW A;  4WPC A;  1Q5L A;  3BVW A;  1GN9 A;  1JQK A;  3I39 X;  3O3M B;  3H0X A;  2OO2 A;  1R34 A;  2YLL A;  4JNE A;  1BPR A;  4UDX X;  4IM2 A;  4JWI A;  3BUD A;  3QA8 A;  2EX3 B;  4AZG A;  3PLT A;  2EFK A;  3C7N A;  1TQS A;  2GA9 D;  4H6I A;  1MJG A;  4EZQ A;  2Z0V A;  1TQT A;  3DPP A;  3BVT A;  4M0M A;  3DQG A;  2YI9 A;  3EJQ A;  2WYH A;  2C08 A;  1TQV A;  1QWU A;  3DX1 A;  2Q12 A;  2ND0 A;  4R5I A;  3LMF A;  3LLL A;  2MI7 A;  3A98 A;  1YWM A;  4FM3 A;  3N8E A;  1GNT A;  3L3O M;  3DDF A;  4JWC A;  3D50 A;  3DOB A;  3SBS A;  3B52 X;  1CKR A;  4DYL A;  2D4C A;  3ACO A;  4WV7 A;  4EZN A;  4EZS A;  4AZC A;  2ELB A;  2F18 A;  4AVM A;  1I4D A;  2F7Q A;  2OBL A;  2RAJ A;  3EJS A;  2ND1 A;  3KAW A;  4E3C A;  3QNI A;  2OZN B;  3UIT A;  2NCZ A;  4EZO A;  4JLC A;  4IW0 A;  3CV5 A;  2YL9 A;  4ILI A;  2F1B A;  4AZI A;  3CVR A;  1E1D A;  4ILG A;  3DX3 A;  5KBP A;  3BUQ A;  1OA1 A;  4JN4 A;  4EZX A;  2JNS A;  1DG4 A;  2YIA A;  3DPQ A;  4E81 A;  3ER8 C;  3CZS A;  4BNE A;  3I01 A;  3CKD A;  1GNL A;  4FL9 A;  2YKT A;  1UPX A;  1HWW A;  2N3K A;  3CAZ A;  3BVU A;  5C5B B;  2OBM A;  2YIB A;  2OW7 A;  4AZH A;  2QXL A;  4EZV A;  2D1L A;  4R5L A;  4IWO A;  1U00 A;  2QFF A;  5TKY A;  2F7O A;  2BPR A;  1X03 A;  1E2U A;  3BLB A;  4NSW A;  2F7P A;  1OAO A;  1Y2O A;  3T49 A;  4AZ7 A;  4NQI A;  2Z8Y A;  3DPO A;  3DX0 A;  4B9Q A;  4JNF A;  3O3O B;  1OA0 A;  2WYI A;  4EZT A;  4WV5 A;  4H8S A;  3I2W A;  1SU6 A;  3D2F A;  2YIV X;  3F7W A;  2JNK A;  3DX4 A;  4R5K A;  3T48 A;  4AZB A;  2O0I 1;  2KHO A;  4IM0 A;  3VKH A;  2YI8 A;  2Q13 A;  3DYT A;  3CZN A;  2RAI A;  2WIN M;  1SU7 A;  1URU A;  4IM3 A;  3HAI A;  4D8J A;  2RAK A;  3SYV A;  5FLE X;  4IWP A;  2EWF A;  3LVT A;  4EZU A;  4AZ6 A;  4FZS A;  3GI7 A;  3HAJ A;  1HXK A;  2YL8 A;  3T4A G;  3SBT B;  3ER9 B;  2YLA A;  1I49 A;  3B51 X;  5C5B A;  3QWE A;  3KDR A;  3EJP A;  1SU8 A;  1R5E A;  3SOG A;  1X04 A;  1E9V A;  3I04 A;  3O3N B;  4EZR A;  4IWQ A;  2ALW A;  4AZ5 A;  2LM0 A;  1LQ7 A;  2V7Y A;  1W9M A;  4PO2 A;  1TQW A;  3BVV A;  3EJT A;  2F7R A;  2GF4 A;  3KAV A;  3EJR A;  1HTY A;  3ZED A;  1QWN A;  4I43 A;  1I4L A;  1PS3 A;  2EFL A;  1TQU A;  4AKV A;  2OP6 A;  3BVX A;  7HSC A;  4F01 A;  1O7D B;  4H6H A;  3DDG A;  2Z0O A;  3L3P A;  3OK8 A;  1DKY A;  4FZP A;  3T46 A;  2RT6 A;  4ATM A;  1DKZ A;  4HYB A;  2FIC A;  1YUW A;  1DKX A;  3RV1 A;  3HAH A;  4EZY A;  3VEB A;  2FYV A;  4WPE A;  4UDY X;  4NPH A;  1O7D C;  3QNJ A;  3FD9 A;  5FIG A;  4KIK A;  3DX2 A;  4DCN C;  2X5C A;  4HR1 A;  3G9G A;  3OWG A;  3BUI A;  3OHX M;  4R5J A;  1QX1 A;  1SUF A;  2PY6 A;  3BUB A;  3C7N B;  1WDZ A;  4JWD A;  2F1A A;  4FZO A;  2QKW A;  3RV0 A;  4HY9 A;  4R5G A;  2ZXQ A;  4I1Q A;  4KIK B;  3Q84 A;  3B53 X;  3EJU A;  2GAF D;  4F00 A;  4G6Q A;  1R33 A;  4HR1 B;  4JL9 A;  3RPM A;  3QE6 A;  2YL6 A;  3ABH A; 
#chains in the Genus database with same CATH homology
 3T49 A;  2OP6 A;  3VEA A;  3SBS A;  2Z8Y A;  3DPO A;  4B9Q A;  4EZP A;  4JNF A;  3O3O B;  3B52 X;  7HSC A;  1CKR A;  4F01 A;  1OA0 A;  3T47 A;  4EZT A;  4WV5 A;  4JWE A;  1ZYL A;  4WV7 A;  4EZN A;  4EZS A;  1SU6 A;  3D2F A;  2YIV X;  4EZZ A;  4MQD A;  3F7W A;  4H6H A;  5E84 A;  4R5K A;  3T48 A;  2KHO A;  4IM0 A;  3ZEF A;  2OBL A;  2ND1 A;  3VKH A;  3KAW A;  2YI8 A;  3ERC C;  3D2E A;  4E3C A;  1DKY A;  2WIN M;  3UIT A;  4ILH B;  3T46 A;  2NCZ A;  4EZO A;  1SU7 A;  2RT6 A;  4IW0 A;  4JLC A;  1DKZ A;  4ILI A;  4HYB A;  1E1D A;  1YUW A;  4ILG A;  1DKX A;  3RV1 A;  4EZW A;  4IM3 A;  4EZY A;  1Q5L A;  3VEB A;  1GN9 A;  1OA1 A;  1JQK A;  3I39 X;  3O3M B;  4JN4 A;  4UDY X;  4NPH A;  3QNJ A;  4EZX A;  4D8J A;  3H0X A;  3FD9 A;  5FIG A;  4KIK A;  5FLE X;  4JNE A;  2JNS A;  4IWP A;  1DG4 A;  2EWF A;  2YIA A;  3DPQ A;  4E81 A;  4EZU A;  1BPR A;  3ER8 C;  4UDX X;  2X5C A;  3GI7 A;  4IM2 A;  4HR1 A;  4JWI A;  3I01 A;  3OWG A;  3QA8 A;  2EX3 B;  3T4A G;  3SBT B;  3ER9 B;  3C7N A;  1GNL A;  4FL9 A;  3B51 X;  2GA9 D;  3OHX M;  4H6I A;  4R5J A;  1SUF A;  1UPX A;  2PY6 A;  3KDR A;  1MJG A;  2N3K A;  4EZQ A;  1SU8 A;  3C7N B;  4JWD A;  1E9V A;  3DPP A;  3I04 A;  4M0M A;  3DQG A;  2YI9 A;  3O3N B;  3RV0 A;  4EZR A;  4IWQ A;  4HY9 A;  2OBM A;  2YIB A;  4R5G A;  2LM0 A;  4KIK B;  2V7Y A;  2QXL A;  2ND0 A;  3B53 X;  4R5I A;  4EZV A;  2GAF D;  1W9M A;  4F00 A;  4PO2 A;  3LMF A;  4G6Q A;  4HR1 B;  4JL9 A;  4R5L A;  3A98 A;  4IWO A;  4FM3 A;  3N8E A;  1GNT A;  1U00 A;  2QFF A;  5TKY A;  3KAV A;  2BPR A;  3L3O M;  1E2U A;  4JWC A;  3ZED A;  4I43 A;  3DOB A;  1OAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...