4HY9A

Crystal structure of the substrate binding domain of e.coli dnak in complex with pyrrhocoricin_lyzz (residues 1 to 11)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
213
structure length
213
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone, peptide binding protein
total genus 61
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4hy9A02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4hy9A01
4F01A 4EZZA 4R5GA 4EZYA 1BPRA 4JNFA 4R5IA 2KHOA 1DKXA 1Q5LA 4H6IA 2QFFA 3C7NA 4R5KA 4EZWA 5TKYA 1DKZA 3OHXM 3T48A 4EZQA 1YUWA 3DPQA 4JWEA 3T46A 2BPRA 2WINM 4JNEA 1CKRA 4B9QA 4H6HA 3QNJA 4E81A 4EZSA 3DQGA 4PO2A 3D2FA 4EZTA 4EZPA 2QXLA 4EZVA 3D2EA 3T47A 4EZXA 2OP6A 4F00A 4FL9A 1U00A 1DG4A 3DOBA 3T4AG 4JWIA 4WV5A 3DPPA 4JWCA 4EZNA 7HSCA 3T49A 3L3OM 4EZOA 4HY9A 4EZRA 2V7YA 3C7NB 5E84A 4R5JA 3H0XA 4HYBA 1DKYA 4EZUA 4JWDA 4WV7A 4JN4A 3DPOA 3N8EA 4R5LA
chains in the Genus database with same CATH superfamily
2YKTA 3G9GA 1Q5LA 3D52A 2EFLA 2YIVX 2MI7A 4PO2A 2F7QA 2GF4A 2F18A 4F00A 3DX2A 3QE6A 3I04A 3L3OM 3Q84A 2YL8A 1SUFA 4WV7A 4JN4A 3EJPA 2FICA 3PLTA 1HWWA 4EZWA 1MJGA 3ZEFA 3BVXA 3D50A 1QWNA 3D2EA 4ILHB 4H8SA 3RV1A 4AKVA 1I4TA 1HTYA 3T48A 3Q0KA 1SU8A 4JLCA 4MQDA 2YIAA 2PY6A 3DX4A 4HR1B 3CVRA 3LVTA 4IWPA 4NPHA 5KBPA 4EZOA 3CKDA 5E84A 3BUPA 4R5LA 3BVWA 4HR1A 1ZYLA 2Z0OA 3QNJA 4DYLA 4AZCA 2PMRA 3M3WA 4JWIA 4AVMA 3DX3A 1JQKA 3HAJA 1TQVA 2C08A 3ERCC 3ABHA 4EZZA 4FZSA 4AZ6A 1O7DC 1E1DA 2Z0VA 4IM2A 4R5KA 3D4ZA 3BVUA 2Q13A 3HAIA 4I43A 1E2UA 5C5BB 2NCZA 1GNTA 2YL5A 4IWQA 2JNKA 4R5IA 1DKXA 2Z8YA 2X3VA 2RAJA 3DX1A 1CKRA 3O3NB 4EZPA 2WYHA 2YLAA 4E3CA 4EZNA 3DX0A 4WPCA 2F7PA 2V7YA 4EZRA 2V0OA 4EZUA 3QA8A 2OZNB 3D51A 3B52X 4KIKB 2OW7A 3ER9B 3B53X 2QFFA 1DKZA 4G6QA 4JNEA 2X5CA 1WDZA 4KIKA 5FIGA 1U00A 2D4CA 4JWCA 3EJSA 2Z0NA 1ZWWA 4M0MA 3EJTA 4EZYA 2YL9A 3BUDA 2KHOA 1SU7A 1OA0A 4NQIA 1R5EA 4B9QA 1O7DB 4FM3A 1OA1A 4AZHA 4AZBA 2OBLA 2JNSA 3N8EA 3BLBA 1PS3A 3FD9A 3RV0A 5TKYA 1SU6A 1R33A 2F7OA 2WINM 3CZNA 4EZSA 3CAZA 2QXLA 3VEAA 4AZGA 1QX1A 2RAKA 3DPPA 4ATMA 4FZPA 2QKWA 4R5JA 1I4LA 3F7WA 4NSWA 3EJRA 3CV5A 2ZXQA 4AZ5A 3DDGA 4EZQA 1TQSA 4IM0A 3DQGA 3D2FA 3EJUA 2YL6A 4UDXX 1W9MA 4FL9A 1DG4A 2N3KA 2F7RA 3C7NB 4FZOA 3O3OB 4IWOA 1GNLA 3DPOA 2RT6A 2LXYA 3KAWA 2GA9D 5C5BA 3OWGA 2ELBA 1YUWA 3GI7A 3OHXM 2OBMA 2D1LA 2GAFD 3ZEDA 1TQUA 2WYIA 3SBTB 2X3WA 3SOGA 4HYBA 4AZIA 4JWDA 3BUBA 4F01A 1BPRA 2EWFA 4JNFA 1QWUA 3DYTA 1E9VA 1YWMA 3EJQA 3QWEA 1URUA 3T46A 3I2WA 2YI8A 2O0I1 2F1BA 4ILGA 3UITA 4I1QA 2EX3B 3ER8C 1HXKA 3LLLA 4HY9A 1UPXA 3L3PA 1TQTA 1I49A 1LQ7A 3RPMA 3DPQA 1TQWA 1OAOA 2YIBA 4H6HA 3I39X 4ILIA 3BUQA 3VKHA 4EZVA 2OP6A 2F1AA 3T4AG 2ND0A 2X3XA 3T49A 1X03A 3BVVA 4AZ7A 3H0XA 2EFKA 3LMFA 4IW0A 2RAIA 2BPRA 2OO2A 3D4YA 3VEBA 4IM3A 3HAHA 3DOBA 1R34A 4WV5A 1GN9A 3BUIA 2OW6A 3O3MB 2Q12A 3KAVA 1DKYA 2YI9A 3I01A 4AZCB 4DCNC 3B51X 4H6IA 3BVTA 1Y2OA 4EZTA 4WPEA 2LM0A 4UDYX 1I4DA 1X04A 3QNIA 2ND1A 7HSCA 4JL9A 3KDRA 3SYVA 2YLLA 3DDFA 3CZSA 4R5GA 3SBSA 3C7NA 5FLEX 4JWEA 4D8JA 3OK8A 4E81A 3T47A 4EZXA 3A98A 4BNEA 2FYVA 2ALWA 3ACOA
chains in the Genus database with same CATH topology
4EZZA 3FD9A 1Q5LA 1E1DA 4IM2A 4R5KA 5TKYA 3RV0A 1SU6A 3DPQA 2WINM 2YIVX 1OAOA 2YIBA 4H6HA 3I39X 4ILIA 4EZSA 4PO2A 2QXLA 1E2UA 3VKHA 4I43A 4EZVA 2OP6A 2JNSA 4F00A 3VEAA 3T4AG 3DPPA 2ND0A 2NCZA 3I04A 3T49A 3L3OM 1GNTA 4R5JA 3H0XA 1SUFA 4WV7A 3F7WA 4JN4A 4IWQA 3LMFA 4R5IA 4IW0A 1DKXA 2Z8YA 4EZWA 1MJGA 4EZQA 2BPRA 4IM0A 3ZEFA 1CKRA 3O3NB 3VEBA 3DQGA 3D2FA 4UDXX 4EZPA 1W9MA 4IM3A 3D2EA 4FL9A 1DG4A 3DOBA 4E3CA 4WV5A 4EZNA 4ILHB 1GN9A 2N3KA 3RV1A 2V7YA 3C7NB 3O3MB 4EZRA 3KAVA 4EZUA 1DKYA 3QA8A 3O3OB 3DPOA 1GNLA 4IWOA 2RT6A 2YI9A 3B52X 3I01A 3KAWA 4KIKB 2GA9D 3OWGA 3ER9B 3B53X 3B51X 4H6IA 2QFFA 1YUWA 3GI7A 1DKZA 3OHXM 3T48A 4G6QA 4JNEA 1SU8A 2X5CA 2OBMA 4JLCA 2GAFD 4KIKA 4EZTA 4MQDA 3ZEDA 5FIGA 2YIAA 2PY6A 2LM0A 4UDYX 1U00A 4HR1B 4JWCA 2ND1A 7HSCA 3SBTB 4IWPA 4NPHA 4EZOA 4JL9A 3KDRA 5E84A 4HYBA 4JWDA 4M0MA 4R5LA 4F01A 4HR1A 1ZYLA 4R5GA 4EZYA 1BPRA 3N8EA 2EWFA 4JNFA 3SBSA 2KHOA 1E9VA 1SU7A 3C7NA 5FLEX 4JWEA 3T46A 1OA0A 4D8JA 2YI8A 4B9QA 3QNJA 4E81A 4FM3A 3T47A 4EZXA 4ILGA 3UITA 3A98A 1OA1A 2EX3B 4JWIA 3ER8C 1JQKA 4HY9A 1UPXA 2OBLA 3ERCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F01 A;  4EZZ A;  4R5G A;  4EZY A;  1BPR A;  4JNF A;  4R5I A;  2KHO A;  1DKX A;  1Q5L A;  4H6I A;  2QFF A;  3C7N A;  4R5K A;  4EZW A;  5TKY A;  1DKZ A;  3OHX M;  3T48 A;  4EZQ A;  1YUW A;  3DPQ A;  4JWE A;  3T46 A;  2BPR A;  2WIN M;  4JNE A;  1CKR A;  4B9Q A;  4H6H A;  3QNJ A;  4E81 A;  4EZS A;  3DQG A;  4PO2 A;  3D2F A;  4EZT A;  4EZP A;  2QXL A;  4EZV A;  3D2E A;  3T47 A;  4EZX A;  2OP6 A;  4F00 A;  4FL9 A;  1U00 A;  1DG4 A;  3DOB A;  3T4A G;  4JWI A;  4WV5 A;  3DPP A;  4JWC A;  4EZN A;  7HSC A;  3T49 A;  3L3O M;  4EZO A;  4HY9 A;  4EZR A;  2V7Y A;  3C7N B;  5E84 A;  4R5J A;  3H0X A;  4HYB A;  1DKY A;  4EZU A;  4JWD A;  4WV7 A;  4JN4 A;  3DPO A;  3N8E A;  4R5L A; 
#chains in the Genus database with same CATH topology
 2YKT A;  3G9G A;  1Q5L A;  3D52 A;  2EFL A;  2YIV X;  2MI7 A;  4PO2 A;  2F7Q A;  2GF4 A;  2F18 A;  4F00 A;  3DX2 A;  3QE6 A;  3I04 A;  3L3O M;  3Q84 A;  2YL8 A;  1SUF A;  4WV7 A;  4JN4 A;  3EJP A;  2FIC A;  3PLT A;  1HWW A;  4EZW A;  1MJG A;  3ZEF A;  3BVX A;  3D50 A;  1QWN A;  3D2E A;  4ILH B;  4H8S A;  3RV1 A;  4AKV A;  1I4T A;  1HTY A;  3T48 A;  3Q0K A;  1SU8 A;  4JLC A;  4MQD A;  2YIA A;  2PY6 A;  3DX4 A;  4HR1 B;  3CVR A;  3LVT A;  4IWP A;  4NPH A;  5KBP A;  4EZO A;  3CKD A;  5E84 A;  3BUP A;  4R5L A;  3BVW A;  4HR1 A;  1ZYL A;  2Z0O A;  3QNJ A;  4DYL A;  4AZC A;  2PMR A;  3M3W A;  4JWI A;  4AVM A;  3DX3 A;  1JQK A;  3HAJ A;  1TQV A;  2C08 A;  3ERC C;  3ABH A;  4EZZ A;  4FZS A;  4AZ6 A;  1O7D C;  1E1D A;  2Z0V A;  4IM2 A;  4R5K A;  3D4Z A;  3BVU A;  2Q13 A;  3HAI A;  4I43 A;  1E2U A;  5C5B B;  2NCZ A;  1GNT A;  2YL5 A;  4IWQ A;  2JNK A;  4R5I A;  1DKX A;  2Z8Y A;  2X3V A;  2RAJ A;  3DX1 A;  1CKR A;  3O3N B;  4EZP A;  2WYH A;  2YLA A;  4E3C A;  4EZN A;  3DX0 A;  4WPC A;  2F7P A;  2V7Y A;  4EZR A;  2V0O A;  4EZU A;  3QA8 A;  2OZN B;  3D51 A;  3B52 X;  4KIK B;  2OW7 A;  3ER9 B;  3B53 X;  2QFF A;  1DKZ A;  4G6Q A;  4JNE A;  2X5C A;  1WDZ A;  4KIK A;  5FIG A;  1U00 A;  2D4C A;  4JWC A;  3EJS A;  2Z0N A;  1ZWW A;  4M0M A;  3EJT A;  4EZY A;  2YL9 A;  3BUD A;  2KHO A;  1SU7 A;  1OA0 A;  4NQI A;  1R5E A;  4B9Q A;  1O7D B;  4FM3 A;  1OA1 A;  4AZH A;  4AZB A;  2OBL A;  2JNS A;  3N8E A;  3BLB A;  1PS3 A;  3FD9 A;  3RV0 A;  5TKY A;  1SU6 A;  1R33 A;  2F7O A;  2WIN M;  3CZN A;  4EZS A;  3CAZ A;  2QXL A;  3VEA A;  4AZG A;  1QX1 A;  2RAK A;  3DPP A;  4ATM A;  4FZP A;  2QKW A;  4R5J A;  1I4L A;  3F7W A;  4NSW A;  3EJR A;  3CV5 A;  2ZXQ A;  4AZ5 A;  3DDG A;  4EZQ A;  1TQS A;  4IM0 A;  3DQG A;  3D2F A;  3EJU A;  2YL6 A;  4UDX X;  1W9M A;  4FL9 A;  1DG4 A;  2N3K A;  2F7R A;  3C7N B;  4FZO A;  3O3O B;  4IWO A;  1GNL A;  3DPO A;  2RT6 A;  2LXY A;  3KAW A;  2GA9 D;  5C5B A;  3OWG A;  2ELB A;  1YUW A;  3GI7 A;  3OHX M;  2OBM A;  2D1L A;  2GAF D;  3ZED A;  1TQU A;  2WYI A;  3SBT B;  2X3W A;  3SOG A;  4HYB A;  4AZI A;  4JWD A;  3BUB A;  4F01 A;  1BPR A;  2EWF A;  4JNF A;  1QWU A;  3DYT A;  1E9V A;  1YWM A;  3EJQ A;  3QWE A;  1URU A;  3T46 A;  3I2W A;  2YI8 A;  2O0I 1;  2F1B A;  4ILG A;  3UIT A;  4I1Q A;  2EX3 B;  3ER8 C;  1HXK A;  3LLL A;  4HY9 A;  1UPX A;  3L3P A;  1TQT A;  1I49 A;  1LQ7 A;  3RPM A;  3DPQ A;  1TQW A;  1OAO A;  2YIB A;  4H6H A;  3I39 X;  4ILI A;  3BUQ A;  3VKH A;  4EZV A;  2OP6 A;  2F1A A;  3T4A G;  2ND0 A;  2X3X A;  3T49 A;  1X03 A;  3BVV A;  4AZ7 A;  3H0X A;  2EFK A;  3LMF A;  4IW0 A;  2RAI A;  2BPR A;  2OO2 A;  3D4Y A;  3VEB A;  4IM3 A;  3HAH A;  3DOB A;  1R34 A;  4WV5 A;  1GN9 A;  3BUI A;  2OW6 A;  3O3M B;  2Q12 A;  3KAV A;  1DKY A;  2YI9 A;  3I01 A;  4AZC B;  4DCN C;  3B51 X;  4H6I A;  3BVT A;  1Y2O A;  4EZT A;  4WPE A;  2LM0 A;  4UDY X;  1I4D A;  1X04 A;  3QNI A;  2ND1 A;  7HSC A;  4JL9 A;  3KDR A;  3SYV A;  2YLL A;  3DDF A;  3CZS A;  4R5G A;  3SBS A;  3C7N A;  5FLE X;  4JWE A;  4D8J A;  3OK8 A;  4E81 A;  3T47 A;  4EZX A;  3A98 A;  4BNE A;  2FYV A;  2ALW A;  3ACO A; 
#chains in the Genus database with same CATH homology
 4EZZ A;  3FD9 A;  1Q5L A;  1E1D A;  4IM2 A;  4R5K A;  5TKY A;  3RV0 A;  1SU6 A;  3DPQ A;  2WIN M;  2YIV X;  1OAO A;  2YIB A;  4H6H A;  3I39 X;  4ILI A;  4EZS A;  4PO2 A;  2QXL A;  1E2U A;  3VKH A;  4I43 A;  4EZV A;  2OP6 A;  2JNS A;  4F00 A;  3VEA A;  3T4A G;  3DPP A;  2ND0 A;  2NCZ A;  3I04 A;  3T49 A;  3L3O M;  1GNT A;  4R5J A;  3H0X A;  1SUF A;  4WV7 A;  3F7W A;  4JN4 A;  4IWQ A;  3LMF A;  4R5I A;  4IW0 A;  1DKX A;  2Z8Y A;  4EZW A;  1MJG A;  4EZQ A;  2BPR A;  4IM0 A;  3ZEF A;  1CKR A;  3O3N B;  3VEB A;  3DQG A;  3D2F A;  4UDX X;  4EZP A;  1W9M A;  4IM3 A;  3D2E A;  4FL9 A;  1DG4 A;  3DOB A;  4E3C A;  4WV5 A;  4EZN A;  4ILH B;  1GN9 A;  2N3K A;  3RV1 A;  2V7Y A;  3C7N B;  3O3M B;  4EZR A;  3KAV A;  4EZU A;  1DKY A;  3QA8 A;  3O3O B;  3DPO A;  1GNL A;  4IWO A;  2RT6 A;  2YI9 A;  3B52 X;  3I01 A;  3KAW A;  4KIK B;  2GA9 D;  3OWG A;  3ER9 B;  3B53 X;  3B51 X;  4H6I A;  2QFF A;  1YUW A;  3GI7 A;  1DKZ A;  3OHX M;  3T48 A;  4G6Q A;  4JNE A;  1SU8 A;  2X5C A;  2OBM A;  4JLC A;  2GAF D;  4KIK A;  4EZT A;  4MQD A;  3ZED A;  5FIG A;  2YIA A;  2PY6 A;  2LM0 A;  4UDY X;  1U00 A;  4HR1 B;  4JWC A;  2ND1 A;  7HSC A;  3SBT B;  4IWP A;  4NPH A;  4EZO A;  4JL9 A;  3KDR A;  5E84 A;  4HYB A;  4JWD A;  4M0M A;  4R5L A;  4F01 A;  4HR1 A;  1ZYL A;  4R5G A;  4EZY A;  1BPR A;  3N8E A;  2EWF A;  4JNF A;  3SBS A;  2KHO A;  1E9V A;  1SU7 A;  3C7N A;  5FLE X;  4JWE A;  3T46 A;  1OA0 A;  4D8J A;  2YI8 A;  4B9Q A;  3QNJ A;  4E81 A;  4FM3 A;  3T47 A;  4EZX A;  4ILG A;  3UIT A;  3A98 A;  1OA1 A;  2EX3 B;  4JWI A;  3ER8 C;  1JQK A;  4HY9 A;  1UPX A;  2OBL A;  3ERC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...