4HY9A

Crystal structure of the substrate binding domain of e.coli dnak in complex with pyrrhocoricin_lyzz (residues 1 to 11)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
213
structure length
213
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone, peptide binding protein
molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
total genus 61
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4hy9A02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4hy9A01
4JNEA 4H6HA 3H0XA 3D2EA 2WINM 4EZYA 4F01A 4JWIA 4EZXA 3C7NB 1DKZA 4JWCA 3T48A 4R5KA 3T49A 2V7YA 3T4AG 3DPQA 4WV7A 4H6IA 4EZTA 7HSCA 4R5IA 4PO2A 4HYBA 4JN4A 3C7NA 3OHXM 4HY9A 3QNJA 3DQGA 4R5LA 4EZZA 3DPOA 3T47A 4WV5A 2KHOA 3DOBA 4EZWA 5TKYA 4F00A 1DKYA 4EZUA 4JWDA 1BPRA 3D2FA 4EZPA 4EZOA 4EZQA 3T46A 1YUWA 2BPRA 2OP6A 2QXLA 1U00A 4EZRA 4EZVA 3N8EA 1CKRA 4E81A 4B9QA 3L3OM 5E84A 1Q5LA 4JWEA 4JNFA 1DKXA 4EZSA 4EZNA 4R5GA 3DPPA 2QFFA 4FL9A 4R5JA 1DG4A
chains in the Genus database with same CATH superfamily
1SU7A 4EZXA 3HAJA 3DPQA 2X3WA 5KBPA 3C7NA 3UITA 2F18A 4IWPA 2GAFD 3DPOA 3T47A 2RAJA 1OAOA 4IM0A 2LXYA 1R5EA 1QWUA 3ZEFA 3QNIA 3HAIA 4EZNA 3DPPA 1I49A 1ZYLA 3DYTA 3VEBA 1OA0A 4EZYA 3CVRA 2O0I1 3D4YA 4R5LA 3DX0A 1I4DA 3CV5A 2D4CA 2BPRA 1UPXA 1U00A 1SU6A 3N8EA 4H8SA 4UDXX 4AZ5A 1TQSA 2RAIA 3Q84A 1I4LA 2OW6A 2WINM 7HSCA 2YIBA 1BPRA 4E3CA 2F7QA 3EJRA 1GNLA 4B9QA 2OW7A 3BUQA 3ACOA 3CKDA 4ILHB 3D51A 4NQIA 4UDYX 3D52A 3RV0A 3L3PA 2RT6A 4IWQA 4DYLA 2N3KA 2JNSA 3DDFA 3D2FA 1TQVA 1YUWA 3QA8A 4EZRA 3SBTB 1O7DC 4FM3A 2EWFA 1URUA 4IM2A 4M0MA 3RPMA 4WV7A 4D8JA 1TQUA 3DQGA 5FIGA 2Z8YA 2PY6A 2OBLA 4KIKB 4EZUA 3O3OB 3D4ZA 2WYIA 4KIKA 1HWWA 3Q0KA 4WPCA 5E84A 3DDGA 4ILGA 3EJSA 4I43A 1TQWA 2F7PA 2WYHA 3VEAA 1DKZA 3T48A 3T4AG 4H6IA 4WV5A 4FZSA 5C5BB 4E81A 5C5BA 3O3NB 1Q5LA 1R34A 1PS3A 2V0OA 1DG4A 1YWMA 4PO2A 4IWOA 4EZZA 4AVMA 4F00A 3I01A 1DKYA 4FZOA 1QWNA 3BUIA 2F1AA 3O3MB 2YL9A 2Z0VA 3CAZA 4AZHA 2ELBA 2QKWA 2F7RA 1W9MA 4AZCB 3PLTA 4AZCA 4JWDA 3D50A 4AZGA 3OWGA 2YIAA 2ND0A 4AZBA 3GI7A 2MI7A 4JNEA 2Q13A 3BVUA 3I39X 2NCZA 2D1LA 2ND1A 2Z0NA 4IM3A 1JQKA 2ALWA 2QFFA 2EX3B 3BUBA 4HR1B 2Q12A 3D2EA 4HR1A 2JNKA 4R5KA 4I1QA 4WPEA 2ZXQA 3RV1A 2X3VA 1SUFA 1MJGA 1X04A 3ER9B 3I2WA 3LMFA 4R5GA 4FL9A 4AZIA 3DX2A 2FYVA 1E2UA 3VKHA 2X3XA 2FICA 1O7DB 4AZ7A 3EJPA 4R5IA 1OA1A 1GN9A 3BLBA 4FZPA 4JLCA 2YL8A 2YI9A 3BUPA 2OP6A 3SYVA 3KAWA 2QXLA 1CKRA 1X03A 2X5CA 4JNFA 1DKXA 3QE6A 2YL6A 4BNEA 3H0XA 4G6QA 4F01A 3C7NB 3A98A 4EZTA 2YLAA 3B53X 3BVVA 2KHOA 3BVXA 4EZWA 5TKYA 3DX4A 4EZPA 2YI8A 3CZNA 4JWEA 5FLEX 3ZEDA 4EZSA 3ABHA 4R5JA 3B51X 3SOGA 2OO2A 4H6HA 4AKVA 4MQDA 3QWEA 4DCNC 4ILIA 1SU8A 4NPHA 4JL9A 3SBSA 2RAKA 2OBMA 3BVTA 4HY9A 1Y2OA 1ZWWA 2EFLA 3DOBA 3BUDA 3EJTA 2F7OA 3L3OM 3EJUA 1HTYA 3DX3A 2YIVX 1GNTA 3EJQA 3G9GA 3OK8A 4HYBA 3BVWA 1LQ7A 1R33A 4EZQA 3HAHA 2C08A 3M3WA 2OZNB 4JWIA 2GA9D 4ATMA 1E9VA 3QNJA 2Z0OA 1E1DA 2PMRA 3T46A 3KAVA 2GF4A 2F1BA 1WDZA 1TQTA 3F7WA 3LLLA 4JWCA 3FD9A 2V7YA 3DX1A 3T49A 3ER8C 3I04A 2YLLA 4JN4A 3OHXM 2LM0A 3CZSA 2YKTA 3LVTA 2EFKA 1I4TA 1HXKA 4EZOA 2YL5A 4AZ6A 3B52X 4EZVA 4NSWA 3ERCC 1QX1A 3KDRA 4IW0A
chains in the Genus database with same CATH topology
2EWFA 4JNEA 4H6HA 4MQDA 1SU7A 4IM2A 4EZXA 4ILIA 3I39X 1SU8A 4M0MA 4NPHA 3DPQA 4JL9A 4WV7A 3SBSA 3C7NA 3UITA 4D8JA 4HY9A 2OBMA 4IWPA 2GAFD 5FIGA 3DQGA 3DPOA 2Z8YA 3T47A 2NCZA 2PY6A 3DOBA 2OBLA 4KIKB 4EZUA 2ND1A 3O3OB 1OAOA 4IM0A 4KIKA 4IM3A 1JQKA 3L3OM 5E84A 3ZEFA 4ILGA 4EZNA 4I43A 3DPPA 2QFFA 2EX3B 1ZYLA 4HR1B 2YIVX 3VEBA 1GNTA 1OA0A 3D2EA 4HR1A 4EZYA 3VEAA 1DKZA 3T48A 4R5KA 3T4AG 4H6IA 4HYBA 4R5LA 3RV1A 4WV5A 1SUFA 1MJGA 4EZQA 3ER9B 2BPRA 1UPXA 1U00A 1SU6A 3N8EA 4E81A 3O3NB 3LMFA 1Q5LA 4UDXX 4R5GA 4FL9A 1DG4A 1E2UA 2WINM 3VKHA 4JWIA 2GA9D 7HSCA 4R5IA 4PO2A 4IWOA 1E9VA 3QNJA 4EZZA 1E1DA 2YIBA 1OA1A 1GN9A 4JLCA 3I01A 1DKYA 4F00A 4E3CA 1BPRA 2YI9A 3B51X 2OP6A 3T46A 3KAVA 3KAWA 2QXLA 1CKRA 1GNLA 4B9QA 2X5CA 4JNFA 1DKXA 3O3MB 3H0XA 4G6QA 4ILHB 4F01A 3F7WA 3C7NB 4JWCA 3FD9A 3A98A 2V7YA 3T49A 3ER8C 4EZTA 4UDYX 3I04A 3B53X 2LM0A 3OHXM 4JN4A 3RV0A 1W9MA 2RT6A 4IWQA 2KHOA 2N3KA 2JNSA 4EZWA 5TKYA 4JWDA 3D2FA 4EZPA 4EZOA 2YI8A 1YUWA 3OWGA 3QA8A 4EZRA 3B52X 2YIAA 4EZVA 3SBTB 2ND0A 4JWEA 5FLEX 3ERCC 3ZEDA 3KDRA 4EZSA 4IW0A 4R5JA 4FM3A 3GI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JNE A;  4H6H A;  3H0X A;  3D2E A;  2WIN M;  4EZY A;  4F01 A;  4JWI A;  4EZX A;  3C7N B;  1DKZ A;  4JWC A;  3T48 A;  4R5K A;  3T49 A;  2V7Y A;  3T4A G;  3DPQ A;  4WV7 A;  4H6I A;  4EZT A;  7HSC A;  4R5I A;  4PO2 A;  4HYB A;  4JN4 A;  3C7N A;  3OHX M;  4HY9 A;  3QNJ A;  3DQG A;  4R5L A;  4EZZ A;  3DPO A;  3T47 A;  4WV5 A;  2KHO A;  3DOB A;  4EZW A;  5TKY A;  4F00 A;  1DKY A;  4EZU A;  4JWD A;  1BPR A;  3D2F A;  4EZP A;  4EZO A;  4EZQ A;  3T46 A;  1YUW A;  2BPR A;  2OP6 A;  2QXL A;  1U00 A;  4EZR A;  4EZV A;  3N8E A;  1CKR A;  4E81 A;  4B9Q A;  3L3O M;  5E84 A;  1Q5L A;  4JWE A;  4JNF A;  1DKX A;  4EZS A;  4EZN A;  4R5G A;  3DPP A;  2QFF A;  4FL9 A;  4R5J A;  1DG4 A; 
#chains in the Genus database with same CATH topology
 1SU7 A;  4EZX A;  3HAJ A;  3DPQ A;  2X3W A;  5KBP A;  3C7N A;  3UIT A;  2F18 A;  4IWP A;  2GAF D;  3DPO A;  3T47 A;  2RAJ A;  1OAO A;  4IM0 A;  2LXY A;  1R5E A;  1QWU A;  3ZEF A;  3QNI A;  3HAI A;  4EZN A;  3DPP A;  1I49 A;  1ZYL A;  3DYT A;  3VEB A;  1OA0 A;  4EZY A;  3CVR A;  2O0I 1;  3D4Y A;  4R5L A;  3DX0 A;  1I4D A;  3CV5 A;  2D4C A;  2BPR A;  1UPX A;  1U00 A;  1SU6 A;  3N8E A;  4H8S A;  4UDX X;  4AZ5 A;  1TQS A;  2RAI A;  3Q84 A;  1I4L A;  2OW6 A;  2WIN M;  7HSC A;  2YIB A;  1BPR A;  4E3C A;  2F7Q A;  3EJR A;  1GNL A;  4B9Q A;  2OW7 A;  3BUQ A;  3ACO A;  3CKD A;  4ILH B;  3D51 A;  4NQI A;  4UDY X;  3D52 A;  3RV0 A;  3L3P A;  2RT6 A;  4IWQ A;  4DYL A;  2N3K A;  2JNS A;  3DDF A;  3D2F A;  1TQV A;  1YUW A;  3QA8 A;  4EZR A;  3SBT B;  1O7D C;  4FM3 A;  2EWF A;  1URU A;  4IM2 A;  4M0M A;  3RPM A;  4WV7 A;  4D8J A;  1TQU A;  3DQG A;  5FIG A;  2Z8Y A;  2PY6 A;  2OBL A;  4KIK B;  4EZU A;  3O3O B;  3D4Z A;  2WYI A;  4KIK A;  1HWW A;  3Q0K A;  4WPC A;  5E84 A;  3DDG A;  4ILG A;  3EJS A;  4I43 A;  1TQW A;  2F7P A;  2WYH A;  3VEA A;  1DKZ A;  3T48 A;  3T4A G;  4H6I A;  4WV5 A;  4FZS A;  5C5B B;  4E81 A;  5C5B A;  3O3N B;  1Q5L A;  1R34 A;  1PS3 A;  2V0O A;  1DG4 A;  1YWM A;  4PO2 A;  4IWO A;  4EZZ A;  4AVM A;  4F00 A;  3I01 A;  1DKY A;  4FZO A;  1QWN A;  3BUI A;  2F1A A;  3O3M B;  2YL9 A;  2Z0V A;  3CAZ A;  4AZH A;  2ELB A;  2QKW A;  2F7R A;  1W9M A;  4AZC B;  3PLT A;  4AZC A;  4JWD A;  3D50 A;  4AZG A;  3OWG A;  2YIA A;  2ND0 A;  4AZB A;  3GI7 A;  2MI7 A;  4JNE A;  2Q13 A;  3BVU A;  3I39 X;  2NCZ A;  2D1L A;  2ND1 A;  2Z0N A;  4IM3 A;  1JQK A;  2ALW A;  2QFF A;  2EX3 B;  3BUB A;  4HR1 B;  2Q12 A;  3D2E A;  4HR1 A;  2JNK A;  4R5K A;  4I1Q A;  4WPE A;  2ZXQ A;  3RV1 A;  2X3V A;  1SUF A;  1MJG A;  1X04 A;  3ER9 B;  3I2W A;  3LMF A;  4R5G A;  4FL9 A;  4AZI A;  3DX2 A;  2FYV A;  1E2U A;  3VKH A;  2X3X A;  2FIC A;  1O7D B;  4AZ7 A;  3EJP A;  4R5I A;  1OA1 A;  1GN9 A;  3BLB A;  4FZP A;  4JLC A;  2YL8 A;  2YI9 A;  3BUP A;  2OP6 A;  3SYV A;  3KAW A;  2QXL A;  1CKR A;  1X03 A;  2X5C A;  4JNF A;  1DKX A;  3QE6 A;  2YL6 A;  4BNE A;  3H0X A;  4G6Q A;  4F01 A;  3C7N B;  3A98 A;  4EZT A;  2YLA A;  3B53 X;  3BVV A;  2KHO A;  3BVX A;  4EZW A;  5TKY A;  3DX4 A;  4EZP A;  2YI8 A;  3CZN A;  4JWE A;  5FLE X;  3ZED A;  4EZS A;  3ABH A;  4R5J A;  3B51 X;  3SOG A;  2OO2 A;  4H6H A;  4AKV A;  4MQD A;  3QWE A;  4DCN C;  4ILI A;  1SU8 A;  4NPH A;  4JL9 A;  3SBS A;  2RAK A;  2OBM A;  3BVT A;  4HY9 A;  1Y2O A;  1ZWW A;  2EFL A;  3DOB A;  3BUD A;  3EJT A;  2F7O A;  3L3O M;  3EJU A;  1HTY A;  3DX3 A;  2YIV X;  1GNT A;  3EJQ A;  3G9G A;  3OK8 A;  4HYB A;  3BVW A;  1LQ7 A;  1R33 A;  4EZQ A;  3HAH A;  2C08 A;  3M3W A;  2OZN B;  4JWI A;  2GA9 D;  4ATM A;  1E9V A;  3QNJ A;  2Z0O A;  1E1D A;  2PMR A;  3T46 A;  3KAV A;  2GF4 A;  2F1B A;  1WDZ A;  1TQT A;  3F7W A;  3LLL A;  4JWC A;  3FD9 A;  2V7Y A;  3DX1 A;  3T49 A;  3ER8 C;  3I04 A;  2YLL A;  4JN4 A;  3OHX M;  2LM0 A;  3CZS A;  2YKT A;  3LVT A;  2EFK A;  1I4T A;  1HXK A;  4EZO A;  2YL5 A;  4AZ6 A;  3B52 X;  4EZV A;  4NSW A;  3ERC C;  1QX1 A;  3KDR A;  4IW0 A; 
#chains in the Genus database with same CATH homology
 2EWF A;  4JNE A;  4H6H A;  4MQD A;  1SU7 A;  4IM2 A;  4EZX A;  4ILI A;  3I39 X;  1SU8 A;  4M0M A;  4NPH A;  3DPQ A;  4JL9 A;  4WV7 A;  3SBS A;  3C7N A;  3UIT A;  4D8J A;  4HY9 A;  2OBM A;  4IWP A;  2GAF D;  5FIG A;  3DQG A;  3DPO A;  2Z8Y A;  3T47 A;  2NCZ A;  2PY6 A;  3DOB A;  2OBL A;  4KIK B;  4EZU A;  2ND1 A;  3O3O B;  1OAO A;  4IM0 A;  4KIK A;  4IM3 A;  1JQK A;  3L3O M;  5E84 A;  3ZEF A;  4ILG A;  4EZN A;  4I43 A;  3DPP A;  2QFF A;  2EX3 B;  1ZYL A;  4HR1 B;  2YIV X;  3VEB A;  1GNT A;  1OA0 A;  3D2E A;  4HR1 A;  4EZY A;  3VEA A;  1DKZ A;  3T48 A;  4R5K A;  3T4A G;  4H6I A;  4HYB A;  4R5L A;  3RV1 A;  4WV5 A;  1SUF A;  1MJG A;  4EZQ A;  3ER9 B;  2BPR A;  1UPX A;  1U00 A;  1SU6 A;  3N8E A;  4E81 A;  3O3N B;  3LMF A;  1Q5L A;  4UDX X;  4R5G A;  4FL9 A;  1DG4 A;  1E2U A;  2WIN M;  3VKH A;  4JWI A;  2GA9 D;  7HSC A;  4R5I A;  4PO2 A;  4IWO A;  1E9V A;  3QNJ A;  4EZZ A;  1E1D A;  2YIB A;  1OA1 A;  1GN9 A;  4JLC A;  3I01 A;  1DKY A;  4F00 A;  4E3C A;  1BPR A;  2YI9 A;  3B51 X;  2OP6 A;  3T46 A;  3KAV A;  3KAW A;  2QXL A;  1CKR A;  1GNL A;  4B9Q A;  2X5C A;  4JNF A;  1DKX A;  3O3M B;  3H0X A;  4G6Q A;  4ILH B;  4F01 A;  3F7W A;  3C7N B;  4JWC A;  3FD9 A;  3A98 A;  2V7Y A;  3T49 A;  3ER8 C;  4EZT A;  4UDY X;  3I04 A;  3B53 X;  2LM0 A;  3OHX M;  4JN4 A;  3RV0 A;  1W9M A;  2RT6 A;  4IWQ A;  2KHO A;  2N3K A;  2JNS A;  4EZW A;  5TKY A;  4JWD A;  3D2F A;  4EZP A;  4EZO A;  2YI8 A;  1YUW A;  3OWG A;  3QA8 A;  4EZR A;  3B52 X;  2YIA A;  4EZV A;  3SBT B;  2ND0 A;  4JWE A;  5FLE X;  3ERC C;  3ZED A;  3KDR A;  4EZS A;  4IW0 A;  4R5J A;  4FM3 A;  3GI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...