4HY9A

Crystal structure of the substrate binding domain of e.coli dnak in complex with pyrrhocoricin_lyzz (residues 1 to 11)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
213
structure length
213
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone, peptide binding protein
total genus 61
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4hy9A02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4hy9A01
4JWIA 4E81A 4EZSA 4R5JA 4JWDA 3OHXM 4B9QA 4EZOA 4JNFA 1U00A 4F01A 4EZTA 2OP6A 4EZWA 1DKXA 3D2FA 4JWEA 1Q5LA 3QNJA 4H6HA 4PO2A 4WV5A 4EZUA 4EZRA 1CKRA 2KHOA 1DKZA 3C7NA 2QXLA 3DPPA 4R5LA 3T46A 3T4AG 4F00A 1BPRA 1YUWA 2BPRA 3L3OM 2V7YA 4EZVA 3DOBA 1DG4A 4R5GA 4R5IA 3DQGA 4HY9A 4HYBA 3T47A 4EZZA 2WINM 3H0XA 4JWCA 2QFFA 3DPOA 7HSCA 4EZPA 4JNEA 4EZYA 3T48A 4JN4A 3DPQA 4H6IA 3T49A 5TKYA 4EZNA 4EZQA 1DKYA 3N8EA 4FL9A 4WV7A 4R5KA 4EZXA 5E84A 3C7NB 3D2EA
chains in the Genus database with same CATH superfamily
4AZ7A 2YL6A 3DDGA 1TQVA 1R5EA 2OBLA 3BUDA 3SYVA 2F1BA 4IW0A 4HYBA 1YWMA 2JNKA 3HAHA 4I43A 4HR1A 4AZ6A 2RAIA 1QWUA 2RT6A 4UDXX 2YIBA 4EZXA 4R5JA 4F01A 1UPXA 3QNJA 4H6HA 4PO2A 2ALWA 4ATMA 4EZUA 1I4LA 2QKWA 3D52A 2X3XA 3CAZA 1HWWA 4H6IA 3LLLA 3VKHA 4WV7A 1QX1A 5C5BB 4JNFA 2JNSA 2YIVX 2O0I1 4EZRA 3T4AG 2ND1A 2YL9A 1URUA 3D50A 4JL9A 3T47A 3QE6A 2OBMA 2OW6A 2V0OA 3BVXA 4R5KA 4FM3A 4IWPA 4AZGA 1O7DC 1TQUA 3D2EA 3I01A 1HXKA 3VEAA 2GA9D 4DYLA 3I39X 2RAJA 2NCZA 2F18A 2N3KA 3O3NB 3VEBA 1OA0A 3BUIA 2OW7A 4DCNC 3KAWA 1SU6A 1I49A 4JWIA 1JQKA 2FICA 3EJPA 1GNTA 4R5LA 4ILGA 2YL5A 5C5BA 4NQIA 3HAJA 3HAIA 1R33A 4JN4A 2F1AA 4FL9A 2YI9A 3N8EA 2OO2A 3CZNA 2Z0OA 4D8JA 1MJGA 2LM0A 3OHXM 1U00A 2ELBA 1LQ7A 2GAFD 2F7OA 4M0MA 1DKZA 3DPPA 4F00A 3I04A 3EJSA 2EFKA 3PLTA 1OAOA 2F7PA 2QFFA 3Q84A 3BUQA 7HSCA 1X03A 3EJQA 3DQGA 3C7NB 4E81A 2FYVA 1W9MA 2MI7A 3BVTA 4KIKA 2KHOA 3DX1A 2WYIA 1YUWA 3T46A 2BPRA 4R5GA 2YLAA 1I4DA 1E9VA 3SBTB 1SU7A 2Q12A 3G9GA 3RPMA 4IM3A 1SU8A 1I4TA 2OP6A 4EZTA 3CV5A 2PY6A 1CKRA 3BUPA 1PS3A 3SOGA 3KAVA 1HTYA 4JNEA 2X3WA 1DKYA 5E84A 5FLEX 3CKDA 2LXYA 3ER9B 3D2FA 3EJRA 3M3WA 3C7NA 2PMRA 1ZWWA 3DDFA 3QA8A 4EZZA 3ABHA 3DX0A 3EJUA 4MQDA 3DYTA 4JWDA 4B9QA 4IM0A 3ZEDA 1GNLA 2YIAA 1E2UA 1DKXA 2EX3B 3BLBA 3QNIA 3DPOA 3EJTA 3T49A 4AZBA 1SUFA 4G6QA 3I2WA 4ILHB 3B52X 2OZNB 2Z0VA 3O3OB 3A98A 4EZWA 3GI7A 1O7DB 1ZYLA 2V7YA 3CVRA 3FD9A 2X3VA 3B53X 3DX4A 1QWNA 3BVUA 1R34A 4EZQA 2Z8YA 2GF4A 4AZHA 3F7WA 4EZOA 3OWGA 3Q0KA 2WYHA 1TQSA 3DOBA 1DG4A 2D1LA 1TQWA 2ND0A 3LVTA 4EZYA 5KBPA 1X04A 2F7RA 4EZSA 3BUBA 4FZSA 2RAKA 4JWEA 4E3CA 3ER8C 4I1QA 1BPRA 3L3OM 4EZVA 4AVMA 5FIGA 2F7QA 4JWCA 3ERCC 2Q13A 4EZPA 3ZEFA 3T48A 5TKYA 4EZNA 3L3PA 2C08A 2YL8A 3LMFA 4AZCB 3D4ZA 1Q5LA 4H8SA 3DX3A 4WPEA 3ACOA 3CZSA 4AKVA 2EWFA 3OK8A 1GN9A 4IM2A 4FZPA 4WPCA 4ILIA 2X5CA 3SBSA 3RV1A 4JLCA 3RV0A 1OA1A 4FZOA 2EFLA 4HR1B 1E1DA 3O3MB 2QXLA 4IWQA 4IWOA 1TQTA 2YKTA 2Z0NA 4AZIA 4HY9A 3BVWA 3D51A 4NSWA 2ZXQA 3D4YA 4BNEA 1WDZA 4KIKB 4AZ5A 3KDRA 4NPHA 3B51X 4WV5A 2D4CA 3BVVA 4R5IA 4AZCA 3UITA 3DX2A 2WINM 3H0XA 2YI8A 4UDYX 2YLLA 3DPQA 1Y2OA 3QWEA
chains in the Genus database with same CATH topology
5FLEX 4JWIA 4EZSA 3ER9B 3D2FA 4JWEA 4E3CA 1JQKA 3ER8C 1GNTA 1BPRA 3C7NA 4R5LA 4ILGA 2OBLA 3L3OM 4EZVA 3QA8A 4IW0A 4HYBA 5FIGA 4EZZA 4JWCA 4I43A 4HR1A 3ERCC 4EZPA 3ZEFA 2RT6A 3T48A 4JN4A 5TKYA 4EZNA 4FL9A 2YI9A 4UDXX 2YIBA 4EZXA 3N8EA 4MQDA 4R5JA 3LMFA 4JWDA 4D8JA 1MJGA 2LM0A 3OHXM 4B9QA 4IM0A 3ZEDA 1GNLA 1U00A 2YIAA 4F01A 1E2UA 1DKXA 1UPXA 1Q5LA 3QNJA 4H6HA 4PO2A 2GAFD 4M0MA 4EZUA 1DKZA 3DPPA 4F00A 2EX3B 3I04A 2EWFA 1OAOA 2QFFA 3DPOA 7HSCA 1GN9A 4H6IA 3T49A 1SUFA 4IM2A 3VKHA 4WV7A 3DQGA 4G6QA 4ILIA 3C7NB 2X5CA 3SBSA 4E81A 4ILHB 3RV1A 4JLCA 3RV0A 4JNFA 2JNSA 1OA1A 3B52X 3O3OB 2YIVX 1W9MA 3A98A 3GI7A 4EZWA 4HR1B 1ZYLA 1E1DA 4KIKA 2KHOA 3O3MB 3T4AG 2QXLA 4EZRA 2ND1A 3T46A 1YUWA 4IWQA 2BPRA 4IWOA 2V7YA 4R5GA 3FD9A 3B53X 4HY9A 4JL9A 3T47A 2OBMA 1E9VA 3SBTB 1SU7A 4EZQA 4KIKB 2Z8YA 4R5KA 4FM3A 4IWPA 4IM3A 3I01A 3D2EA 1SU8A 3KDRA 3VEAA 3F7WA 4EZOA 4NPHA 2GA9D 2OP6A 4EZTA 3B51X 3OWGA 3I39X 4WV5A 2PY6A 1CKRA 3DOBA 1DG4A 2NCZA 4R5IA 3UITA 2ND0A 2WINM 2N3KA 3H0XA 2YI8A 3KAVA 3O3NB 3VEBA 4UDYX 1OA0A 4JNEA 4EZYA 3DPQA 1DKYA 3KAWA 5E84A 1SU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWI A;  4E81 A;  4EZS A;  4R5J A;  4JWD A;  3OHX M;  4B9Q A;  4EZO A;  4JNF A;  1U00 A;  4F01 A;  4EZT A;  2OP6 A;  4EZW A;  1DKX A;  3D2F A;  4JWE A;  1Q5L A;  3QNJ A;  4H6H A;  4PO2 A;  4WV5 A;  4EZU A;  4EZR A;  1CKR A;  2KHO A;  1DKZ A;  3C7N A;  2QXL A;  3DPP A;  4R5L A;  3T46 A;  3T4A G;  4F00 A;  1BPR A;  1YUW A;  2BPR A;  3L3O M;  2V7Y A;  4EZV A;  3DOB A;  1DG4 A;  4R5G A;  4R5I A;  3DQG A;  4HY9 A;  4HYB A;  3T47 A;  4EZZ A;  2WIN M;  3H0X A;  4JWC A;  2QFF A;  3DPO A;  7HSC A;  4EZP A;  4JNE A;  4EZY A;  3T48 A;  4JN4 A;  3DPQ A;  4H6I A;  3T49 A;  5TKY A;  4EZN A;  4EZQ A;  1DKY A;  3N8E A;  4FL9 A;  4WV7 A;  4R5K A;  4EZX A;  5E84 A;  3C7N B;  3D2E A; 
#chains in the Genus database with same CATH topology
 4AZ7 A;  2YL6 A;  3DDG A;  1TQV A;  1R5E A;  2OBL A;  3BUD A;  3SYV A;  2F1B A;  4IW0 A;  4HYB A;  1YWM A;  2JNK A;  3HAH A;  4I43 A;  4HR1 A;  4AZ6 A;  2RAI A;  1QWU A;  2RT6 A;  4UDX X;  2YIB A;  4EZX A;  4R5J A;  4F01 A;  1UPX A;  3QNJ A;  4H6H A;  4PO2 A;  2ALW A;  4ATM A;  4EZU A;  1I4L A;  2QKW A;  3D52 A;  2X3X A;  3CAZ A;  1HWW A;  4H6I A;  3LLL A;  3VKH A;  4WV7 A;  1QX1 A;  5C5B B;  4JNF A;  2JNS A;  2YIV X;  2O0I 1;  4EZR A;  3T4A G;  2ND1 A;  2YL9 A;  1URU A;  3D50 A;  4JL9 A;  3T47 A;  3QE6 A;  2OBM A;  2OW6 A;  2V0O A;  3BVX A;  4R5K A;  4FM3 A;  4IWP A;  4AZG A;  1O7D C;  1TQU A;  3D2E A;  3I01 A;  1HXK A;  3VEA A;  2GA9 D;  4DYL A;  3I39 X;  2RAJ A;  2NCZ A;  2F18 A;  2N3K A;  3O3N B;  3VEB A;  1OA0 A;  3BUI A;  2OW7 A;  4DCN C;  3KAW A;  1SU6 A;  1I49 A;  4JWI A;  1JQK A;  2FIC A;  3EJP A;  1GNT A;  4R5L A;  4ILG A;  2YL5 A;  5C5B A;  4NQI A;  3HAJ A;  3HAI A;  1R33 A;  4JN4 A;  2F1A A;  4FL9 A;  2YI9 A;  3N8E A;  2OO2 A;  3CZN A;  2Z0O A;  4D8J A;  1MJG A;  2LM0 A;  3OHX M;  1U00 A;  2ELB A;  1LQ7 A;  2GAF D;  2F7O A;  4M0M A;  1DKZ A;  3DPP A;  4F00 A;  3I04 A;  3EJS A;  2EFK A;  3PLT A;  1OAO A;  2F7P A;  2QFF A;  3Q84 A;  3BUQ A;  7HSC A;  1X03 A;  3EJQ A;  3DQG A;  3C7N B;  4E81 A;  2FYV A;  1W9M A;  2MI7 A;  3BVT A;  4KIK A;  2KHO A;  3DX1 A;  2WYI A;  1YUW A;  3T46 A;  2BPR A;  4R5G A;  2YLA A;  1I4D A;  1E9V A;  3SBT B;  1SU7 A;  2Q12 A;  3G9G A;  3RPM A;  4IM3 A;  1SU8 A;  1I4T A;  2OP6 A;  4EZT A;  3CV5 A;  2PY6 A;  1CKR A;  3BUP A;  1PS3 A;  3SOG A;  3KAV A;  1HTY A;  4JNE A;  2X3W A;  1DKY A;  5E84 A;  5FLE X;  3CKD A;  2LXY A;  3ER9 B;  3D2F A;  3EJR A;  3M3W A;  3C7N A;  2PMR A;  1ZWW A;  3DDF A;  3QA8 A;  4EZZ A;  3ABH A;  3DX0 A;  3EJU A;  4MQD A;  3DYT A;  4JWD A;  4B9Q A;  4IM0 A;  3ZED A;  1GNL A;  2YIA A;  1E2U A;  1DKX A;  2EX3 B;  3BLB A;  3QNI A;  3DPO A;  3EJT A;  3T49 A;  4AZB A;  1SUF A;  4G6Q A;  3I2W A;  4ILH B;  3B52 X;  2OZN B;  2Z0V A;  3O3O B;  3A98 A;  4EZW A;  3GI7 A;  1O7D B;  1ZYL A;  2V7Y A;  3CVR A;  3FD9 A;  2X3V A;  3B53 X;  3DX4 A;  1QWN A;  3BVU A;  1R34 A;  4EZQ A;  2Z8Y A;  2GF4 A;  4AZH A;  3F7W A;  4EZO A;  3OWG A;  3Q0K A;  2WYH A;  1TQS A;  3DOB A;  1DG4 A;  2D1L A;  1TQW A;  2ND0 A;  3LVT A;  4EZY A;  5KBP A;  1X04 A;  2F7R A;  4EZS A;  3BUB A;  4FZS A;  2RAK A;  4JWE A;  4E3C A;  3ER8 C;  4I1Q A;  1BPR A;  3L3O M;  4EZV A;  4AVM A;  5FIG A;  2F7Q A;  4JWC A;  3ERC C;  2Q13 A;  4EZP A;  3ZEF A;  3T48 A;  5TKY A;  4EZN A;  3L3P A;  2C08 A;  2YL8 A;  3LMF A;  4AZC B;  3D4Z A;  1Q5L A;  4H8S A;  3DX3 A;  4WPE A;  3ACO A;  3CZS A;  4AKV A;  2EWF A;  3OK8 A;  1GN9 A;  4IM2 A;  4FZP A;  4WPC A;  4ILI A;  2X5C A;  3SBS A;  3RV1 A;  4JLC A;  3RV0 A;  1OA1 A;  4FZO A;  2EFL A;  4HR1 B;  1E1D A;  3O3M B;  2QXL A;  4IWQ A;  4IWO A;  1TQT A;  2YKT A;  2Z0N A;  4AZI A;  4HY9 A;  3BVW A;  3D51 A;  4NSW A;  2ZXQ A;  3D4Y A;  4BNE A;  1WDZ A;  4KIK B;  4AZ5 A;  3KDR A;  4NPH A;  3B51 X;  4WV5 A;  2D4C A;  3BVV A;  4R5I A;  4AZC A;  3UIT A;  3DX2 A;  2WIN M;  3H0X A;  2YI8 A;  4UDY X;  2YLL A;  3DPQ A;  1Y2O A;  3QWE A; 
#chains in the Genus database with same CATH homology
 5FLE X;  4JWI A;  4EZS A;  3ER9 B;  3D2F A;  4JWE A;  4E3C A;  1JQK A;  3ER8 C;  1GNT A;  1BPR A;  3C7N A;  4R5L A;  4ILG A;  2OBL A;  3L3O M;  4EZV A;  3QA8 A;  4IW0 A;  4HYB A;  5FIG A;  4EZZ A;  4JWC A;  4I43 A;  4HR1 A;  3ERC C;  4EZP A;  3ZEF A;  2RT6 A;  3T48 A;  4JN4 A;  5TKY A;  4EZN A;  4FL9 A;  2YI9 A;  4UDX X;  2YIB A;  4EZX A;  3N8E A;  4MQD A;  4R5J A;  3LMF A;  4JWD A;  4D8J A;  1MJG A;  2LM0 A;  3OHX M;  4B9Q A;  4IM0 A;  3ZED A;  1GNL A;  1U00 A;  2YIA A;  4F01 A;  1E2U A;  1DKX A;  1UPX A;  1Q5L A;  3QNJ A;  4H6H A;  4PO2 A;  2GAF D;  4M0M A;  4EZU A;  1DKZ A;  3DPP A;  4F00 A;  2EX3 B;  3I04 A;  2EWF A;  1OAO A;  2QFF A;  3DPO A;  7HSC A;  1GN9 A;  4H6I A;  3T49 A;  1SUF A;  4IM2 A;  3VKH A;  4WV7 A;  3DQG A;  4G6Q A;  4ILI A;  3C7N B;  2X5C A;  3SBS A;  4E81 A;  4ILH B;  3RV1 A;  4JLC A;  3RV0 A;  4JNF A;  2JNS A;  1OA1 A;  3B52 X;  3O3O B;  2YIV X;  1W9M A;  3A98 A;  3GI7 A;  4EZW A;  4HR1 B;  1ZYL A;  1E1D A;  4KIK A;  2KHO A;  3O3M B;  3T4A G;  2QXL A;  4EZR A;  2ND1 A;  3T46 A;  1YUW A;  4IWQ A;  2BPR A;  4IWO A;  2V7Y A;  4R5G A;  3FD9 A;  3B53 X;  4HY9 A;  4JL9 A;  3T47 A;  2OBM A;  1E9V A;  3SBT B;  1SU7 A;  4EZQ A;  4KIK B;  2Z8Y A;  4R5K A;  4FM3 A;  4IWP A;  4IM3 A;  3I01 A;  3D2E A;  1SU8 A;  3KDR A;  3VEA A;  3F7W A;  4EZO A;  4NPH A;  2GA9 D;  2OP6 A;  4EZT A;  3B51 X;  3OWG A;  3I39 X;  4WV5 A;  2PY6 A;  1CKR A;  3DOB A;  1DG4 A;  2NCZ A;  4R5I A;  3UIT A;  2ND0 A;  2WIN M;  2N3K A;  3H0X A;  2YI8 A;  3KAV A;  3O3N B;  3VEB A;  4UDY X;  1OA0 A;  4JNE A;  4EZY A;  3DPQ A;  1DKY A;  3KAW A;  5E84 A;  1SU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...