3DQGA

Peptide-binding domain of heat shock 70 kda protein f, mitochondrial precursor, from caenorhabditis elegans.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
148
structure length
148
Chain Sequence
DVTPLSLGIETLGGIMTKLITRNTTIPTKKSQVFSTAADGQTQVQIKVFQGEREMATSNKLLGQFSLVGIPPAPRGVPQVEVTFDIDANGIVNVSARDRGTGKEQQIVIQSSGGLSKDQIENMIKEAEKNAAEDAKRKELVEVINQAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock 70 kDa protein F
publication title X-ray crystal structure of peptide-binding domain of heat shock 70 kDa protein F, mitochondrial precursor, from Caenorhabditis elegans.
rcsb
source organism Caenorhabditis elegans
molecule tags Chaperone
total genus 35
structure length 148
sequence length 148
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 3dqgA00
3DPQA 4EZWA 4F00A 3C7NA 4PO2A 4JNEA 4HYBA 4B9QA 4EZUA 4EZSA 4EZNA 4R5IA 3DPOA 4JWCA 4JN4A 4HY9A 3H0XA 3N8EA 3DQGA 4JWDA 3D2FA 3D2EA 5TKYA 4EZXA 7HSCA 3QNJA 1DKXA 1CKRA 4EZPA 4R5GA 2V7YA 4WV5A 4R5JA 4FL9A 4R5LA 4WV7A 4EZOA 3DOBA 2OP6A 1YUWA 3C7NB 1BPRA 5E84A 4EZYA 4R5KA 1DKYA 2BPRA 4EZTA 1Q5LA 4JWIA 1DG4A 2KHOA 4EZVA 3DPPA 1U00A 1DKZA 4JWEA 4F01A 4JNFA 4EZZA 4EZRA 4E81A 4EZQA 2QXLA
chains in the Genus database with same CATH superfamily
3DPQA 4EZWA 4F00A 3C7NA 4PO2A 4JNEA 4HYBA 4B9QA 4EZUA 4EZSA 4EZNA 4R5IA 3DPOA 3SBSA 4JWCA 4JN4A 3SBTB 4HY9A 3H0XA 3N8EA 3DQGA 4JWDA 3D2FA 3D2EA 5TKYA 4EZXA 7HSCA 3QNJA 1DKXA 1CKRA 4EZPA 4R5GA 2V7YA 4I43A 4ILHB 4ILIA 4ILGA 4WV5A 4R5JA 4FL9A 4R5LA 4WV7A 4EZOA 3DOBA 2OP6A 1YUWA 3C7NB 1BPRA 5E84A 4MQDA 4EZYA 4R5KA 1DKYA 2BPRA 4EZTA 1Q5LA 4JWIA 1DG4A 2KHOA 4EZVA 3DPPA 1U00A 1DKZA 4JWEA 4F01A 4JNFA 4EZZA 4EZRA 3ZEFA 4E81A 4EZQA 2QXLA
chains in the Genus database with same CATH topology
3DPQA 4EZWA 4F00A 3C7NA 4PO2A 4JNEA 4HYBA 4B9QA 4EZUA 4EZSA 4EZNA 4R5IA 3DPOA 3SBSA 4JWCA 4JN4A 3SBTB 4HY9A 3H0XA 3N8EA 3DQGA 4JWDA 3D2FA 3D2EA 5TKYA 4EZXA 7HSCA 3QNJA 1DKXA 1CKRA 4EZPA 4R5GA 2V7YA 4I43A 4ILHB 4ILIA 4ILGA 4WV5A 4R5JA 4FL9A 4R5LA 4WV7A 4EZOA 3DOBA 2OP6A 1YUWA 3C7NB 1BPRA 5E84A 4MQDA 4EZYA 4R5KA 1DKYA 2BPRA 4EZTA 1Q5LA 4JWIA 1DG4A 2KHOA 4EZVA 3DPPA 1U00A 1DKZA 4JWEA 4F01A 4JNFA 4EZZA 4EZRA 3ZEFA 4E81A 4EZQA 2QXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DPQ A;  4EZW A;  4F00 A;  3C7N A;  4PO2 A;  4JNE A;  4HYB A;  4B9Q A;  4EZU A;  4EZS A;  4EZN A;  4R5I A;  3DPO A;  4JWC A;  4JN4 A;  4HY9 A;  3H0X A;  3N8E A;  3DQG A;  4JWD A;  3D2F A;  3D2E A;  5TKY A;  4EZX A;  7HSC A;  3QNJ A;  1DKX A;  1CKR A;  4EZP A;  4R5G A;  2V7Y A;  4WV5 A;  4R5J A;  4FL9 A;  4R5L A;  4WV7 A;  4EZO A;  3DOB A;  2OP6 A;  1YUW A;  3C7N B;  1BPR A;  5E84 A;  4EZY A;  4R5K A;  1DKY A;  2BPR A;  4EZT A;  1Q5L A;  4JWI A;  1DG4 A;  2KHO A;  4EZV A;  3DPP A;  1U00 A;  1DKZ A;  4JWE A;  4F01 A;  4JNF A;  4EZZ A;  4EZR A;  4E81 A;  4EZQ A;  2QXL A; 
#chains in the Genus database with same CATH topology
 3DPQ A;  4EZW A;  4F00 A;  3C7N A;  4PO2 A;  4JNE A;  4HYB A;  4B9Q A;  4EZU A;  4EZS A;  4EZN A;  4R5I A;  3DPO A;  3SBS A;  4JWC A;  4JN4 A;  3SBT B;  4HY9 A;  3H0X A;  3N8E A;  3DQG A;  4JWD A;  3D2F A;  3D2E A;  5TKY A;  4EZX A;  7HSC A;  3QNJ A;  1DKX A;  1CKR A;  4EZP A;  4R5G A;  2V7Y A;  4I43 A;  4ILH B;  4ILI A;  4ILG A;  4WV5 A;  4R5J A;  4FL9 A;  4R5L A;  4WV7 A;  4EZO A;  3DOB A;  2OP6 A;  1YUW A;  3C7N B;  1BPR A;  5E84 A;  4MQD A;  4EZY A;  4R5K A;  1DKY A;  2BPR A;  4EZT A;  1Q5L A;  4JWI A;  1DG4 A;  2KHO A;  4EZV A;  3DPP A;  1U00 A;  1DKZ A;  4JWE A;  4F01 A;  4JNF A;  4EZZ A;  4EZR A;  3ZEF A;  4E81 A;  4EZQ A;  2QXL A; 
#chains in the Genus database with same CATH homology
 3DPQ A;  4EZW A;  4F00 A;  3C7N A;  4PO2 A;  4JNE A;  4HYB A;  4B9Q A;  4EZU A;  4EZS A;  4EZN A;  4R5I A;  3DPO A;  3SBS A;  4JWC A;  4JN4 A;  3SBT B;  4HY9 A;  3H0X A;  3N8E A;  3DQG A;  4JWD A;  3D2F A;  3D2E A;  5TKY A;  4EZX A;  7HSC A;  3QNJ A;  1DKX A;  1CKR A;  4EZP A;  4R5G A;  2V7Y A;  4I43 A;  4ILH B;  4ILI A;  4ILG A;  4WV5 A;  4R5J A;  4FL9 A;  4R5L A;  4WV7 A;  4EZO A;  3DOB A;  2OP6 A;  1YUW A;  3C7N B;  1BPR A;  5E84 A;  4MQD A;  4EZY A;  4R5K A;  1DKY A;  2BPR A;  4EZT A;  1Q5L A;  4JWI A;  1DG4 A;  2KHO A;  4EZV A;  3DPP A;  1U00 A;  1DKZ A;  4JWE A;  4F01 A;  4JNF A;  4EZZ A;  4EZR A;  3ZEF A;  4E81 A;  4EZQ A;  2QXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...