1DG4A

Nmr structure of the substrate binding domain of dnak in the apo form
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
111
structure length
111
Chain Sequence
LSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNAK
publication title Structural insights into substrate binding by the molecular chaperone DnaK.
pubmed doi rcsb
molecule tags Chaperone
total genus 15
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 1999-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 1dg4A00
4F00A 1YUWA 4R5KA 5TKYA 3D2FA 4JWCA 3C7NA 3DPPA 4WV5A 4EZUA 4EZRA 4PO2A 4E81A 4JWEA 4R5LA 4EZQA 1DG4A 4B9QA 4F01A 2OP6A 4WV7A 1DKXA 4EZWA 1BPRA 4EZXA 2KHOA 1DKYA 4EZYA 4JN4A 1CKRA 2V7YA 5E84A 7HSCA 3DPQA 4JWIA 4EZNA 3C7NB 4JNFA 3QNJA 4EZPA 4JWDA 1DKZA 1U00A 3DQGA 4EZTA 4FL9A 4R5IA 4EZZA 2BPRA 4EZSA 3DOBA 4EZOA 3D2EA 1Q5LA 4EZVA 4R5JA 3H0XA 4R5GA 4HY9A 4HYBA 4JNEA 2QXLA 3DPOA 3N8EA
chains in the Genus database with same CATH superfamily
4F00A 1YUWA 4MQDA 3SBTB 3SBSA 4R5KA 5TKYA 3D2FA 4ILIA 3C7NA 3DPPA 4JWCA 4WV5A 4EZUA 4EZRA 4PO2A 4E81A 4JWEA 4R5LA 4EZQA 4ILGA 1DG4A 4B9QA 4F01A 2OP6A 4WV7A 1DKXA 4I43A 4EZWA 1BPRA 4EZXA 2KHOA 1DKYA 4EZYA 4JN4A 1CKRA 4ILHB 2V7YA 5E84A 7HSCA 3DPQA 4JWIA 4EZNA 3C7NB 4JNFA 3QNJA 4EZPA 4JWDA 1DKZA 1U00A 3DQGA 4EZTA 4FL9A 4R5IA 4EZZA 2BPRA 4EZSA 3DOBA 4EZOA 3D2EA 1Q5LA 4EZVA 3ZEFA 4R5JA 3H0XA 4R5GA 4HY9A 4HYBA 4JNEA 2QXLA 3DPOA 3N8EA
chains in the Genus database with same CATH topology
4F00A 1YUWA 4MQDA 3SBTB 3SBSA 4R5KA 5TKYA 3D2FA 4ILIA 3C7NA 3DPPA 4JWCA 4WV5A 4EZUA 4EZRA 4PO2A 4E81A 4JWEA 4R5LA 4EZQA 4ILGA 1DG4A 4B9QA 4F01A 2OP6A 4WV7A 1DKXA 4I43A 4EZWA 1BPRA 4EZXA 2KHOA 1DKYA 4EZYA 4JN4A 1CKRA 4ILHB 2V7YA 5E84A 7HSCA 3DPQA 4JWIA 4EZNA 3C7NB 4JNFA 3QNJA 4EZPA 4JWDA 1DKZA 1U00A 3DQGA 4EZTA 4FL9A 4R5IA 4EZZA 2BPRA 4EZSA 3DOBA 4EZOA 3D2EA 1Q5LA 4EZVA 3ZEFA 4R5JA 3H0XA 4R5GA 4HY9A 4HYBA 4JNEA 2QXLA 3DPOA 3N8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F00 A;  1YUW A;  4R5K A;  5TKY A;  3D2F A;  4JWC A;  3C7N A;  3DPP A;  4WV5 A;  4EZU A;  4EZR A;  4PO2 A;  4E81 A;  4JWE A;  4R5L A;  4EZQ A;  1DG4 A;  4B9Q A;  4F01 A;  2OP6 A;  4WV7 A;  1DKX A;  4EZW A;  1BPR A;  4EZX A;  2KHO A;  1DKY A;  4EZY A;  4JN4 A;  1CKR A;  2V7Y A;  5E84 A;  7HSC A;  3DPQ A;  4JWI A;  4EZN A;  3C7N B;  4JNF A;  3QNJ A;  4EZP A;  4JWD A;  1DKZ A;  1U00 A;  3DQG A;  4EZT A;  4FL9 A;  4R5I A;  4EZZ A;  2BPR A;  4EZS A;  3DOB A;  4EZO A;  3D2E A;  1Q5L A;  4EZV A;  4R5J A;  3H0X A;  4R5G A;  4HY9 A;  4HYB A;  4JNE A;  2QXL A;  3DPO A;  3N8E A; 
#chains in the Genus database with same CATH topology
 4F00 A;  1YUW A;  4MQD A;  3SBT B;  3SBS A;  4R5K A;  5TKY A;  3D2F A;  4ILI A;  3C7N A;  3DPP A;  4JWC A;  4WV5 A;  4EZU A;  4EZR A;  4PO2 A;  4E81 A;  4JWE A;  4R5L A;  4EZQ A;  4ILG A;  1DG4 A;  4B9Q A;  4F01 A;  2OP6 A;  4WV7 A;  1DKX A;  4I43 A;  4EZW A;  1BPR A;  4EZX A;  2KHO A;  1DKY A;  4EZY A;  4JN4 A;  1CKR A;  4ILH B;  2V7Y A;  5E84 A;  7HSC A;  3DPQ A;  4JWI A;  4EZN A;  3C7N B;  4JNF A;  3QNJ A;  4EZP A;  4JWD A;  1DKZ A;  1U00 A;  3DQG A;  4EZT A;  4FL9 A;  4R5I A;  4EZZ A;  2BPR A;  4EZS A;  3DOB A;  4EZO A;  3D2E A;  1Q5L A;  4EZV A;  3ZEF A;  4R5J A;  3H0X A;  4R5G A;  4HY9 A;  4HYB A;  4JNE A;  2QXL A;  3DPO A;  3N8E A; 
#chains in the Genus database with same CATH homology
 4F00 A;  1YUW A;  4MQD A;  3SBT B;  3SBS A;  4R5K A;  5TKY A;  3D2F A;  4ILI A;  3C7N A;  3DPP A;  4JWC A;  4WV5 A;  4EZU A;  4EZR A;  4PO2 A;  4E81 A;  4JWE A;  4R5L A;  4EZQ A;  4ILG A;  1DG4 A;  4B9Q A;  4F01 A;  2OP6 A;  4WV7 A;  1DKX A;  4I43 A;  4EZW A;  1BPR A;  4EZX A;  2KHO A;  1DKY A;  4EZY A;  4JN4 A;  1CKR A;  4ILH B;  2V7Y A;  5E84 A;  7HSC A;  3DPQ A;  4JWI A;  4EZN A;  3C7N B;  4JNF A;  3QNJ A;  4EZP A;  4JWD A;  1DKZ A;  1U00 A;  3DQG A;  4EZT A;  4FL9 A;  4R5I A;  4EZZ A;  2BPR A;  4EZS A;  3DOB A;  4EZO A;  3D2E A;  1Q5L A;  4EZV A;  3ZEF A;  4R5J A;  3H0X A;  4R5G A;  4HY9 A;  4HYB A;  4JNE A;  2QXL A;  3DPO A;  3N8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...