3QNJA

Crystal structure of the substrate binding domain of e.coli dnak in complex with the antimicrobial peptide oncocin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
210
structure length
204
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone/antimicrobial protein
molecule keywords Chaperone protein DnaK
publication title Rational Design of Oncocin Derivatives with Superior Protease Stabilities and Antibacterial Activities Based on the High-Resolution Structure of the Oncocin-DnaK Complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 54
structure length 204
sequence length 210
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3qnjA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 3qnjA01
4FL9A 4EZPA 4PO2A 4WV5A 4EZUA 7HSCA 1U00A 3L3OM 4HY9A 3C7NB 1YUWA 4JWIA 3T47A 2BPRA 3H0XA 4WV7A 4EZNA 2KHOA 3D2FA 4R5JA 3T49A 4EZWA 4EZOA 4EZQA 2WINM 3D2EA 4JNEA 4EZSA 1BPRA 2V7YA 1DKYA 2QFFA 3T4AG 4EZVA 4EZYA 3N8EA 5TKYA 2OP6A 1DKZA 3DPOA 4EZTA 3DQGA 4JWCA 4H6IA 1Q5LA 3C7NA 3DOBA 4F00A 3DPPA 4H6HA 3QNJA 4JWEA 4EZRA 4R5GA 2QXLA 1CKRA 4JNFA 4R5KA 3T46A 4B9QA 4EZZA 4F01A 4JN4A 4E81A 1DKXA 5E84A 4R5LA 3OHXM 3T48A 4EZXA 1DG4A 3DPQA 4HYBA 4R5IA 4JWDA
chains in the Genus database with same CATH superfamily
4UDXX 2FYVA 2YIBA 3ZEDA 4HR1B 2PY6A 2Z8YA 4KIKA 3DPOA 4JWCA 2OW6A 4IM0A 1QX1A 4AZBA 2OZNB 1TQTA 3D51A 5FIGA 4ILHB 3O3NB 3ACOA 3CV5A 3LMFA 7HSCA 3BVWA 2YLAA 3D2EA 1UPXA 1OAOA 4JL9A 4EZTA 3HAIA 4AZHA 4NQIA 3CZSA 1SU8A 2WYIA 3OHXM 2QKWA 1CKRA 1TQSA 3ZEFA 3Q84A 3T47A 3O3MB 2YIAA 4EZNA 3T49A 2EX3B 4WV5A 4HR1A 1PS3A 2FICA 2V0OA 3RPMA 4EZXA 4KIKB 3DX4A 3G9GA 3BUIA 4WV7A 4AZ5A 3I04A 1I49A 1DKYA 5TKYA 1SU6A 3EJRA 2RAJA 3Q0KA 2YL8A 4ATMA 3DX3A 4JLCA 3ER9B 4HYBA 2RAIA 1E1DA 3CZNA 4IM3A 3RV1A 4EZOA 4R5JA 4BNEA 2ELBA 3N8EA 1OA0A 3KDRA 4I43A 4EZRA 2F7RA 4R5GA 2OW7A 2YLLA 1I4LA 3DX0A 3I2WA 1O7DC 3CVRA 2X3VA 1URUA 4UDYX 1SU7A 4IW0A 3C7NB 4JWIA 3BVUA 4EZWA 2OBMA 3HAHA 3DQGA 1Q5LA 3SBTB 3BUDA 4R5KA 1OA1A 4JN4A 4FM3A 2EFKA 1JQKA 4JWDA 3EJTA 1X04A 2EFLA 2ND1A 3F7WA 2BPRA 2JNSA 3HAJA 4IWPA 3D50A 1I4TA 2GAFD 2YL6A 4ILIA 3QE6A 3EJUA 2RT6A 2MI7A 3UITA 3O3OB 4FZPA 3SOGA 2GF4A 3T48A 2QFFA 5E84A 3BUPA 4R5IA 3CKDA 4PO2A 2D1LA 4AKVA 1U00A 4WPEA 3RV0A 3BUBA 3VEBA 2F7QA 3C7NA 3DOBA 2YKTA 3EJSA 2YI8A 4B9QA 3DX1A 4R5LA 1DG4A 4NPHA 2X5CA 4FL9A 2ZXQA 3L3OM 4HY9A 1R5EA 4M0MA 2O0I1 2Z0VA 1HWWA 3B51X 2NCZA 2YIVX 1I4DA 4EZYA 1HTYA 1QWNA 3FD9A 4DYLA 4MQDA 3BLBA 3BVVA 3I39X 2EWFA 3KAWA 3EJQA 4H8SA 2C08A 2KHOA 2X3WA 4JNEA 3QA8A 3GI7A 2Z0OA 1GNLA 4F00A 3DPPA 4WPCA 2WYHA 3DDFA 3I01A 3KAVA 2OO2A 1ZYLA 3BUQA 4D8JA 1ZWWA 3EJPA 4EZQA 1BPRA 3T4AG 2ALWA 3VEAA 1R34A 1MJGA 3VKHA 1GNTA 4F01A 4AZIA 3DYTA 4EZUA 4NSWA 1LQ7A 3M3WA 1GN9A 3ER8C 1DKZA 4H6IA 2GA9D 3ABHA 4ILGA 1W9MA 4H6HA 4JWEA 2F18A 2Z0NA 1HXKA 3D52A 3LLLA 2F1AA 1DKXA 4G6QA 3BVTA 2X3XA 2RAKA 3DDGA 3OK8A 2V7YA 3QNIA 2PMRA 2YI9A 4AZ6A 2F1BA 3QNJA 2YL9A 3SBSA 2QXLA 2OBLA 3T46A 2YL5A 4AZCA 5C5BA 4IWQA 2LXYA 3DPQA 1E9VA 3D4YA 4FZSA 4AVMA 2JNKA 3D2FA 1WDZA 1TQUA 3BVXA 4EZVA 1TQVA 4IWOA 2OP6A 1QWUA 3A98A 2Q13A 3B52X 4E3CA 3QWEA 3SYVA 3LVTA 3B53X 4I1QA 1TQWA 4AZ7A 1YUWA 3ERCC 4EZSA 3DX2A 1O7DB 4DCNC 2D4CA 4FZOA 1Y2OA 1SUFA 4JNFA 3CAZA 4EZZA 4E81A 3OWGA 1YWMA 2F7OA 1R33A 3PLTA 4EZPA 2F7PA 4AZGA 1X03A 3H0XA 3L3PA 4IM2A 2WINM 2Q12A 1E2UA 4AZCB 5C5BB 2LM0A 5KBPA 5FLEX 2ND0A 2N3KA 3D4ZA
chains in the Genus database with same CATH topology
2X5CA 4FL9A 4UDXX 1E1DA 3L3OM 4HY9A 2YIBA 4IM3A 3ZEDA 4M0MA 3RV1A 4HR1B 3B51X 4R5JA 4EZOA 2NCZA 2V7YA 2PY6A 2Z8YA 2YIVX 4EZYA 3N8EA 4KIKA 3DPOA 4JWCA 2YI9A 3FD9A 1OA0A 3KDRA 4IM0A 4I43A 3QNJA 4EZRA 4R5GA 4MQDA 3SBSA 2QXLA 2OBLA 3T46A 3I39X 5FIGA 4IWQA 3O3NB 3DPQA 4ILHB 2EWFA 1E9VA 3LMFA 3KAWA 4UDYX 1SU7A 4IW0A 7HSCA 3C7NB 4JWIA 2KHOA 3D2FA 4EZWA 4JNEA 3D2EA 1UPXA 2OBMA 4EZVA 4IWOA 1OAOA 3QA8A 2OP6A 4JL9A 4EZTA 3DQGA 3GI7A 1Q5LA 3SBTB 1GNLA 3A98A 4F00A 3B52X 3DPPA 4E3CA 3I01A 3KAVA 4R5KA 1SU8A 1OA1A 4JN4A 4FM3A 3OHXM 1ZYLA 1JQKA 1CKRA 3B53X 4JWDA 3ZEFA 4D8JA 1YUWA 2ND1A 3F7WA 3T47A 2BPRA 3O3MB 2YIAA 4EZNA 2JNSA 3T49A 4EZQA 4EZSA 2EX3B 4IWPA 3ERCC 1BPRA 4WV5A 3T4AG 3VEAA 2GAFD 1MJGA 3VKHA 4ILIA 2RT6A 4HR1A 1SUFA 3UITA 1GNTA 4JNFA 3O3OB 4EZZA 4F01A 4E81A 3OWGA 3T48A 2QFFA 5E84A 4EZXA 4R5IA 4EZPA 4PO2A 4EZUA 4KIKB 1U00A 3H0XA 4WV7A 3I04A 3RV0A 4IM2A 2WINM 1GN9A 1DKYA 3VEBA 5TKYA 3ER8C 1DKZA 1SU6A 4H6IA 1E2UA 3C7NA 2GA9D 2LM0A 3DOBA 1W9MA 4ILGA 4H6HA 2YI8A 4JWEA 5FLEX 4JLCA 2ND0A 4B9QA 2N3KA 1DKXA 4R5LA 3ER9B 1DG4A 4G6QA 4NPHA 4HYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FL9 A;  4EZP A;  4PO2 A;  4WV5 A;  4EZU A;  7HSC A;  1U00 A;  3L3O M;  4HY9 A;  3C7N B;  1YUW A;  4JWI A;  3T47 A;  2BPR A;  3H0X A;  4WV7 A;  4EZN A;  2KHO A;  3D2F A;  4R5J A;  3T49 A;  4EZW A;  4EZO A;  4EZQ A;  2WIN M;  3D2E A;  4JNE A;  4EZS A;  1BPR A;  2V7Y A;  1DKY A;  2QFF A;  3T4A G;  4EZV A;  4EZY A;  3N8E A;  5TKY A;  2OP6 A;  1DKZ A;  3DPO A;  4EZT A;  3DQG A;  4JWC A;  4H6I A;  1Q5L A;  3C7N A;  3DOB A;  4F00 A;  3DPP A;  4H6H A;  3QNJ A;  4JWE A;  4EZR A;  4R5G A;  2QXL A;  1CKR A;  4JNF A;  4R5K A;  3T46 A;  4B9Q A;  4EZZ A;  4F01 A;  4JN4 A;  4E81 A;  1DKX A;  5E84 A;  4R5L A;  3OHX M;  3T48 A;  4EZX A;  1DG4 A;  3DPQ A;  4HYB A;  4R5I A;  4JWD A; 
#chains in the Genus database with same CATH topology
 4UDX X;  2FYV A;  2YIB A;  3ZED A;  4HR1 B;  2PY6 A;  2Z8Y A;  4KIK A;  3DPO A;  4JWC A;  2OW6 A;  4IM0 A;  1QX1 A;  4AZB A;  2OZN B;  1TQT A;  3D51 A;  5FIG A;  4ILH B;  3O3N B;  3ACO A;  3CV5 A;  3LMF A;  7HSC A;  3BVW A;  2YLA A;  3D2E A;  1UPX A;  1OAO A;  4JL9 A;  4EZT A;  3HAI A;  4AZH A;  4NQI A;  3CZS A;  1SU8 A;  2WYI A;  3OHX M;  2QKW A;  1CKR A;  1TQS A;  3ZEF A;  3Q84 A;  3T47 A;  3O3M B;  2YIA A;  4EZN A;  3T49 A;  2EX3 B;  4WV5 A;  4HR1 A;  1PS3 A;  2FIC A;  2V0O A;  3RPM A;  4EZX A;  4KIK B;  3DX4 A;  3G9G A;  3BUI A;  4WV7 A;  4AZ5 A;  3I04 A;  1I49 A;  1DKY A;  5TKY A;  1SU6 A;  3EJR A;  2RAJ A;  3Q0K A;  2YL8 A;  4ATM A;  3DX3 A;  4JLC A;  3ER9 B;  4HYB A;  2RAI A;  1E1D A;  3CZN A;  4IM3 A;  3RV1 A;  4EZO A;  4R5J A;  4BNE A;  2ELB A;  3N8E A;  1OA0 A;  3KDR A;  4I43 A;  4EZR A;  2F7R A;  4R5G A;  2OW7 A;  2YLL A;  1I4L A;  3DX0 A;  3I2W A;  1O7D C;  3CVR A;  2X3V A;  1URU A;  4UDY X;  1SU7 A;  4IW0 A;  3C7N B;  4JWI A;  3BVU A;  4EZW A;  2OBM A;  3HAH A;  3DQG A;  1Q5L A;  3SBT B;  3BUD A;  4R5K A;  1OA1 A;  4JN4 A;  4FM3 A;  2EFK A;  1JQK A;  4JWD A;  3EJT A;  1X04 A;  2EFL A;  2ND1 A;  3F7W A;  2BPR A;  2JNS A;  3HAJ A;  4IWP A;  3D50 A;  1I4T A;  2GAF D;  2YL6 A;  4ILI A;  3QE6 A;  3EJU A;  2RT6 A;  2MI7 A;  3UIT A;  3O3O B;  4FZP A;  3SOG A;  2GF4 A;  3T48 A;  2QFF A;  5E84 A;  3BUP A;  4R5I A;  3CKD A;  4PO2 A;  2D1L A;  4AKV A;  1U00 A;  4WPE A;  3RV0 A;  3BUB A;  3VEB A;  2F7Q A;  3C7N A;  3DOB A;  2YKT A;  3EJS A;  2YI8 A;  4B9Q A;  3DX1 A;  4R5L A;  1DG4 A;  4NPH A;  2X5C A;  4FL9 A;  2ZXQ A;  3L3O M;  4HY9 A;  1R5E A;  4M0M A;  2O0I 1;  2Z0V A;  1HWW A;  3B51 X;  2NCZ A;  2YIV X;  1I4D A;  4EZY A;  1HTY A;  1QWN A;  3FD9 A;  4DYL A;  4MQD A;  3BLB A;  3BVV A;  3I39 X;  2EWF A;  3KAW A;  3EJQ A;  4H8S A;  2C08 A;  2KHO A;  2X3W A;  4JNE A;  3QA8 A;  3GI7 A;  2Z0O A;  1GNL A;  4F00 A;  3DPP A;  4WPC A;  2WYH A;  3DDF A;  3I01 A;  3KAV A;  2OO2 A;  1ZYL A;  3BUQ A;  4D8J A;  1ZWW A;  3EJP A;  4EZQ A;  1BPR A;  3T4A G;  2ALW A;  3VEA A;  1R34 A;  1MJG A;  3VKH A;  1GNT A;  4F01 A;  4AZI A;  3DYT A;  4EZU A;  4NSW A;  1LQ7 A;  3M3W A;  1GN9 A;  3ER8 C;  1DKZ A;  4H6I A;  2GA9 D;  3ABH A;  4ILG A;  1W9M A;  4H6H A;  4JWE A;  2F18 A;  2Z0N A;  1HXK A;  3D52 A;  3LLL A;  2F1A A;  1DKX A;  4G6Q A;  3BVT A;  2X3X A;  2RAK A;  3DDG A;  3OK8 A;  2V7Y A;  3QNI A;  2PMR A;  2YI9 A;  4AZ6 A;  2F1B A;  3QNJ A;  2YL9 A;  3SBS A;  2QXL A;  2OBL A;  3T46 A;  2YL5 A;  4AZC A;  5C5B A;  4IWQ A;  2LXY A;  3DPQ A;  1E9V A;  3D4Y A;  4FZS A;  4AVM A;  2JNK A;  3D2F A;  1WDZ A;  1TQU A;  3BVX A;  4EZV A;  1TQV A;  4IWO A;  2OP6 A;  1QWU A;  3A98 A;  2Q13 A;  3B52 X;  4E3C A;  3QWE A;  3SYV A;  3LVT A;  3B53 X;  4I1Q A;  1TQW A;  4AZ7 A;  1YUW A;  3ERC C;  4EZS A;  3DX2 A;  1O7D B;  4DCN C;  2D4C A;  4FZO A;  1Y2O A;  1SUF A;  4JNF A;  3CAZ A;  4EZZ A;  4E81 A;  3OWG A;  1YWM A;  2F7O A;  1R33 A;  3PLT A;  4EZP A;  2F7P A;  4AZG A;  1X03 A;  3H0X A;  3L3P A;  4IM2 A;  2WIN M;  2Q12 A;  1E2U A;  4AZC B;  5C5B B;  2LM0 A;  5KBP A;  5FLE X;  2ND0 A;  2N3K A;  3D4Z A; 
#chains in the Genus database with same CATH homology
 2X5C A;  4FL9 A;  4UDX X;  1E1D A;  3L3O M;  4HY9 A;  2YIB A;  4IM3 A;  3ZED A;  4M0M A;  3RV1 A;  4HR1 B;  3B51 X;  4R5J A;  4EZO A;  2NCZ A;  2V7Y A;  2PY6 A;  2Z8Y A;  2YIV X;  4EZY A;  3N8E A;  4KIK A;  3DPO A;  4JWC A;  2YI9 A;  3FD9 A;  1OA0 A;  3KDR A;  4IM0 A;  4I43 A;  3QNJ A;  4EZR A;  4R5G A;  4MQD A;  3SBS A;  2QXL A;  2OBL A;  3T46 A;  3I39 X;  5FIG A;  4IWQ A;  3O3N B;  3DPQ A;  4ILH B;  2EWF A;  1E9V A;  3LMF A;  3KAW A;  4UDY X;  1SU7 A;  4IW0 A;  7HSC A;  3C7N B;  4JWI A;  2KHO A;  3D2F A;  4EZW A;  4JNE A;  3D2E A;  1UPX A;  2OBM A;  4EZV A;  4IWO A;  1OAO A;  3QA8 A;  2OP6 A;  4JL9 A;  4EZT A;  3DQG A;  3GI7 A;  1Q5L A;  3SBT B;  1GNL A;  3A98 A;  4F00 A;  3B52 X;  3DPP A;  4E3C A;  3I01 A;  3KAV A;  4R5K A;  1SU8 A;  1OA1 A;  4JN4 A;  4FM3 A;  3OHX M;  1ZYL A;  1JQK A;  1CKR A;  3B53 X;  4JWD A;  3ZEF A;  4D8J A;  1YUW A;  2ND1 A;  3F7W A;  3T47 A;  2BPR A;  3O3M B;  2YIA A;  4EZN A;  2JNS A;  3T49 A;  4EZQ A;  4EZS A;  2EX3 B;  4IWP A;  3ERC C;  1BPR A;  4WV5 A;  3T4A G;  3VEA A;  2GAF D;  1MJG A;  3VKH A;  4ILI A;  2RT6 A;  4HR1 A;  1SUF A;  3UIT A;  1GNT A;  4JNF A;  3O3O B;  4EZZ A;  4F01 A;  4E81 A;  3OWG A;  3T48 A;  2QFF A;  5E84 A;  4EZX A;  4R5I A;  4EZP A;  4PO2 A;  4EZU A;  4KIK B;  1U00 A;  3H0X A;  4WV7 A;  3I04 A;  3RV0 A;  4IM2 A;  2WIN M;  1GN9 A;  1DKY A;  3VEB A;  5TKY A;  3ER8 C;  1DKZ A;  1SU6 A;  4H6I A;  1E2U A;  3C7N A;  2GA9 D;  2LM0 A;  3DOB A;  1W9M A;  4ILG A;  4H6H A;  2YI8 A;  4JWE A;  5FLE X;  4JLC A;  2ND0 A;  4B9Q A;  2N3K A;  1DKX A;  4R5L A;  3ER9 B;  1DG4 A;  4G6Q A;  4NPH A;  4HYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...