3QNJA

Crystal structure of the substrate binding domain of e.coli dnak in complex with the antimicrobial peptide oncocin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
210
structure length
204
Chain Sequence
b'VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Rational Design of Oncocin Derivatives with Superior Protease Stabilities and Antibacterial Activities Based on the High-Resolution Structure of the Oncocin-DnaK Complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/antimicrobial protein
total genus 54
structure length 204
sequence length 210
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3qnjA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 3qnjA01
3DPPA 4R5LA 2QXLA 3D2FA 1DKXA 4EZQA 3C7NB 5E84A 3D2EA 4HYBA 3DPQA 2V7YA 3H0XA 4E81A 7HSCA 4EZZA 4R5IA 4EZUA 4EZPA 2WINM 2OP6A 2KHOA 4JWIA 1YUWA 1DKYA 3DPOA 1U00A 2BPRA 4EZXA 4EZTA 4EZRA 5TKYA 4FL9A 3L3OM 4HY9A 4JNFA 3DQGA 1Q5LA 4JNEA 3T49A 4EZVA 4R5GA 1BPRA 3N8EA 4R5JA 4H6HA 4H6IA 1CKRA 3T47A 4JWDA 3T46A 3C7NA 3T4AG 3T48A 4EZWA 4F00A 4B9QA 4EZOA 1DG4A 2QFFA 4JWEA 1DKZA 4WV5A 4JN4A 4WV7A 4F01A 4EZNA 4PO2A 4R5KA 3OHXM 4JWCA 3QNJA 4EZSA 4EZYA 3DOBA
chains in the Genus database with same CATH superfamily
3D2FA 2RAIA 7HSCA 1I49A 4NSWA 4EZTA 4E3CA 4I1QA 4ILIA 4G6QA 3T47A 3SBTB 1URUA 1TQSA 2YKTA 3O3MB 2OW7A 4EZQA 3D52A 3B53X 4E81A 4IWQA 2PMRA 1DKYA 1SU7A 3EJTA 3QA8A 4FZOA 3Q84A 3BUPA 2V0OA 2RAKA 4AZ5A 3ER8C 4AZCA 4H6IA 3DX3A 4ATMA 3BUBA 4EZWA 3CZNA 2RT6A 4AKVA 4JLCA 3SBSA 3C7NB 3D2EA 3H0XA 2Q12A 1I4TA 3RV1A 3DX2A 4FZSA 4EZRA 4JL9A 3RV0A 3T49A 1GNTA 4R5JA 2YI8A 3B51X 1DG4A 3I01A 2JNSA 3GI7A 3B52X 3EJRA 1HWWA 2YL5A 4AZBA 4M0MA 3LLLA 1O7DB 3DX1A 3Q0KA 2D1LA 4R5IA 3OK8A 3BUIA 2FICA 3EJSA 2F1AA 3QE6A 4D8JA 3T48A 2WYHA 2YIVX 4FL9A 4HR1B 2EX3B 3BVWA 3DPQA 1WDZA 2YIBA 1SUFA 2GA9D 1QWNA 4BNEA 3ZEFA 3N8EA 3ER9B 4AZ6A 2LM0A 4NPHA 4IM2A 1R5EA 2Q13A 2GF4A 4F01A 3QWEA 2ELBA 4AZGA 2QXLA 3CAZA 4DCNC 1SU8A 4KIKB 3DDFA 3BVUA 4WPCA 4EZVA 4R5GA 3DX4A 3A98A 3LVTA 3VEAA 5KBPA 2QFFA 4UDYX 2YLLA 1SU6A 4EZYA 1GNLA 3DOBA 3ERCC 2OBMA 4HYBA 4EZUA 1YUWA 5FLEX 3HAJA 4HY9A 3ACOA 3HAHA 3D4ZA 4HR1A 3KAWA 1TQUA 1UPXA 3KAVA 3QNJA 3O3NB 2Z0VA 4AVMA 3SYVA 4UDXX 2F1BA 4IWOA 3DDGA 5FIGA 1JQKA 2OW6A 4JWEA 1LQ7A 1TQWA 3I2WA 4KIKA 3BVXA 1Q5LA 1ZWWA 3CV5A 2FYVA 2X3WA 3D50A 3ZEDA 2ZXQA 2ND1A 1QX1A 4IM3A 2GAFD 2YLAA 4JNFA 2ALWA 4WPEA 4H6HA 1PS3A 2YL9A 3FD9A 2LXYA 3BLBA 1Y2OA 4JWCA 4R5LA 1I4DA 2EFLA 4AZ7A 1E2UA 2EWFA 2X3XA 3HAIA 3EJPA 2OZNB 1TQVA 1E1DA 2F7PA 1CKRA 3CKDA 3UITA 3C7NA 4B9QA 1DKZA 3D51A 4WV5A 3PLTA 4R5KA 3RPMA 3L3PA 4AZHA 4AZCB 2Z8YA 5C5BB 1DKXA 4EZPA 2YL8A 1I4LA 1TQTA 3L3OM 2YL6A 4JNEA 1X03A 3T46A 3VEBA 4EZOA 3F7WA 1GN9A 4WV7A 4EZNA 1QWUA 2OO2A 2OP6A 2KHOA 3KDRA 4ILGA 4IWPA 4I43A 2Z0OA 1BPRA 3EJQA 2X5CA 1O7DC 4ILHB 1YWMA 4JN4A 2OBLA 4DYLA 3VKHA 4NQIA 3DPPA 2D4CA 2X3VA 5E84A 2F18A 4EZZA 3QNIA 5TKYA 2NCZA 3BVVA 4H8SA 2YIAA 5C5BA 3I39X 4JWDA 3SOGA 1ZYLA 2F7QA 1MJGA 1X04A 4MQDA 3M3WA 2F7RA 2ND0A 3ABHA 1W9MA 2YI9A 2PY6A 3I04A 1U00A 2Z0NA 3DQGA 4FZPA 3DYTA 2EFKA 2RAJA 2WYIA 2JNKA 1E9VA 3OHXM 3LMFA 4EZSA 2QKWA 1OAOA 3O3OB 1HTYA 2BPRA 4IM0A 1HXKA 1OA1A 2F7OA 2MI7A 3T4AG 4AZIA 3CZSA 4PO2A 3OWGA 2O0I1 2C08A 4FM3A 2V7YA 2N3KA 1R34A 4JWIA 3BVTA 3DPOA 3CVRA 3DX0A 3BUDA 1OA0A 3G9GA 4IW0A 4F00A 1R33A 3EJUA 3D4YA 2WINM 4EZXA 3BUQA
chains in the Genus database with same CATH topology
3DPPA 3D2FA 2EX3B 5E84A 3DPQA 3ZEDA 7HSCA 4EZZA 2YIBA 2ND1A 1SUFA 4EZTA 2GA9D 5TKYA 4IM3A 2GAFD 4E3CA 4JNFA 2NCZA 3ZEFA 2YIAA 4ILIA 3N8EA 4G6QA 4H6HA 3ER9B 3I39X 3T47A 4JWDA 3FD9A 1ZYLA 2LM0A 1MJGA 3SBTB 4NPHA 4IM2A 4MQDA 2ND0A 4JWCA 4F01A 3O3MB 1W9MA 4R5LA 2QXLA 2YI9A 4EZQA 3B53X 4E81A 2PY6A 1SU8A 3I04A 1E2UA 2EWFA 4IWQA 1DKYA 1U00A 4KIKB 1SU7A 3QA8A 3DQGA 1Q5LA 1E1DA 4EZVA 4R5GA 3ER8C 4H6IA 1CKRA 3A98A 4EZWA 3UITA 3C7NA 3VEAA 4B9QA 2QFFA 4UDYX 2RT6A 1DKZA 4WV5A 4R5KA 1E9VA 1SU6A 3OHXM 3LMFA 4EZSA 4EZYA 1GNLA 4JLCA 2Z8YA 3ERCC 3DOBA 3SBSA 1DKXA 3C7NB 1OAOA 2OBMA 3D2EA 4HYBA 3H0XA 3O3OB 4EZUA 4EZPA 2WINM 3RV1A 1YUWA 2BPRA 5FLEX 4EZRA 3L3OM 4HY9A 4JL9A 4JNEA 3RV0A 3T49A 1GNTA 4HR1A 4IM0A 4R5JA 2YI8A 1OA1A 3T46A 3T4AG 3B51X 3KAWA 3VEBA 4EZOA 1DG4A 3F7WA 1GN9A 3I01A 4WV7A 4PO2A 4EZNA 1UPXA 2JNSA 3GI7A 3B52X 3KAVA 3OWGA 3QNJA 3O3NB 4FM3A 4M0MA 2V7YA 2N3KA 4R5IA 2OP6A 2KHOA 3KDRA 4JWIA 4ILGA 3DPOA 4UDXX 4IWPA 4I43A 4IWOA 5FIGA 1OA0A 1JQKA 1BPRA 2X5CA 4IW0A 4F00A 4D8JA 3T48A 4ILHB 4JWEA 4JN4A 2OBLA 4KIKA 3VKHA 2YIVX 4FL9A 4HR1B 4EZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DPP A;  4R5L A;  2QXL A;  3D2F A;  1DKX A;  4EZQ A;  3C7N B;  5E84 A;  3D2E A;  4HYB A;  3DPQ A;  2V7Y A;  3H0X A;  4E81 A;  7HSC A;  4EZZ A;  4R5I A;  4EZU A;  4EZP A;  2WIN M;  2OP6 A;  2KHO A;  4JWI A;  1YUW A;  1DKY A;  3DPO A;  1U00 A;  2BPR A;  4EZX A;  4EZT A;  4EZR A;  5TKY A;  4FL9 A;  3L3O M;  4HY9 A;  4JNF A;  3DQG A;  1Q5L A;  4JNE A;  3T49 A;  4EZV A;  4R5G A;  1BPR A;  3N8E A;  4R5J A;  4H6H A;  4H6I A;  1CKR A;  3T47 A;  4JWD A;  3T46 A;  3C7N A;  3T4A G;  3T48 A;  4EZW A;  4F00 A;  4B9Q A;  4EZO A;  1DG4 A;  2QFF A;  4JWE A;  1DKZ A;  4WV5 A;  4JN4 A;  4WV7 A;  4F01 A;  4EZN A;  4PO2 A;  4R5K A;  3OHX M;  4JWC A;  3QNJ A;  4EZS A;  4EZY A;  3DOB A; 
#chains in the Genus database with same CATH topology
 3D2F A;  2RAI A;  7HSC A;  1I49 A;  4NSW A;  4EZT A;  4E3C A;  4I1Q A;  4ILI A;  4G6Q A;  3T47 A;  3SBT B;  1URU A;  1TQS A;  2YKT A;  3O3M B;  2OW7 A;  4EZQ A;  3D52 A;  3B53 X;  4E81 A;  4IWQ A;  2PMR A;  1DKY A;  1SU7 A;  3EJT A;  3QA8 A;  4FZO A;  3Q84 A;  3BUP A;  2V0O A;  2RAK A;  4AZ5 A;  3ER8 C;  4AZC A;  4H6I A;  3DX3 A;  4ATM A;  3BUB A;  4EZW A;  3CZN A;  2RT6 A;  4AKV A;  4JLC A;  3SBS A;  3C7N B;  3D2E A;  3H0X A;  2Q12 A;  1I4T A;  3RV1 A;  3DX2 A;  4FZS A;  4EZR A;  4JL9 A;  3RV0 A;  3T49 A;  1GNT A;  4R5J A;  2YI8 A;  3B51 X;  1DG4 A;  3I01 A;  2JNS A;  3GI7 A;  3B52 X;  3EJR A;  1HWW A;  2YL5 A;  4AZB A;  4M0M A;  3LLL A;  1O7D B;  3DX1 A;  3Q0K A;  2D1L A;  4R5I A;  3OK8 A;  3BUI A;  2FIC A;  3EJS A;  2F1A A;  3QE6 A;  4D8J A;  3T48 A;  2WYH A;  2YIV X;  4FL9 A;  4HR1 B;  2EX3 B;  3BVW A;  3DPQ A;  1WDZ A;  2YIB A;  1SUF A;  2GA9 D;  1QWN A;  4BNE A;  3ZEF A;  3N8E A;  3ER9 B;  4AZ6 A;  2LM0 A;  4NPH A;  4IM2 A;  1R5E A;  2Q13 A;  2GF4 A;  4F01 A;  3QWE A;  2ELB A;  4AZG A;  2QXL A;  3CAZ A;  4DCN C;  1SU8 A;  4KIK B;  3DDF A;  3BVU A;  4WPC A;  4EZV A;  4R5G A;  3DX4 A;  3A98 A;  3LVT A;  3VEA A;  5KBP A;  2QFF A;  4UDY X;  2YLL A;  1SU6 A;  4EZY A;  1GNL A;  3DOB A;  3ERC C;  2OBM A;  4HYB A;  4EZU A;  1YUW A;  5FLE X;  3HAJ A;  4HY9 A;  3ACO A;  3HAH A;  3D4Z A;  4HR1 A;  3KAW A;  1TQU A;  1UPX A;  3KAV A;  3QNJ A;  3O3N B;  2Z0V A;  4AVM A;  3SYV A;  4UDX X;  2F1B A;  4IWO A;  3DDG A;  5FIG A;  1JQK A;  2OW6 A;  4JWE A;  1LQ7 A;  1TQW A;  3I2W A;  4KIK A;  3BVX A;  1Q5L A;  1ZWW A;  3CV5 A;  2FYV A;  2X3W A;  3D50 A;  3ZED A;  2ZXQ A;  2ND1 A;  1QX1 A;  4IM3 A;  2GAF D;  2YLA A;  4JNF A;  2ALW A;  4WPE A;  4H6H A;  1PS3 A;  2YL9 A;  3FD9 A;  2LXY A;  3BLB A;  1Y2O A;  4JWC A;  4R5L A;  1I4D A;  2EFL A;  4AZ7 A;  1E2U A;  2EWF A;  2X3X A;  3HAI A;  3EJP A;  2OZN B;  1TQV A;  1E1D A;  2F7P A;  1CKR A;  3CKD A;  3UIT A;  3C7N A;  4B9Q A;  1DKZ A;  3D51 A;  4WV5 A;  3PLT A;  4R5K A;  3RPM A;  3L3P A;  4AZH A;  4AZC B;  2Z8Y A;  5C5B B;  1DKX A;  4EZP A;  2YL8 A;  1I4L A;  1TQT A;  3L3O M;  2YL6 A;  4JNE A;  1X03 A;  3T46 A;  3VEB A;  4EZO A;  3F7W A;  1GN9 A;  4WV7 A;  4EZN A;  1QWU A;  2OO2 A;  2OP6 A;  2KHO A;  3KDR A;  4ILG A;  4IWP A;  4I43 A;  2Z0O A;  1BPR A;  3EJQ A;  2X5C A;  1O7D C;  4ILH B;  1YWM A;  4JN4 A;  2OBL A;  4DYL A;  3VKH A;  4NQI A;  3DPP A;  2D4C A;  2X3V A;  5E84 A;  2F18 A;  4EZZ A;  3QNI A;  5TKY A;  2NCZ A;  3BVV A;  4H8S A;  2YIA A;  5C5B A;  3I39 X;  4JWD A;  3SOG A;  1ZYL A;  2F7Q A;  1MJG A;  1X04 A;  4MQD A;  3M3W A;  2F7R A;  2ND0 A;  3ABH A;  1W9M A;  2YI9 A;  2PY6 A;  3I04 A;  1U00 A;  2Z0N A;  3DQG A;  4FZP A;  3DYT A;  2EFK A;  2RAJ A;  2WYI A;  2JNK A;  1E9V A;  3OHX M;  3LMF A;  4EZS A;  2QKW A;  1OAO A;  3O3O B;  1HTY A;  2BPR A;  4IM0 A;  1HXK A;  1OA1 A;  2F7O A;  2MI7 A;  3T4A G;  4AZI A;  3CZS A;  4PO2 A;  3OWG A;  2O0I 1;  2C08 A;  4FM3 A;  2V7Y A;  2N3K A;  1R34 A;  4JWI A;  3BVT A;  3DPO A;  3CVR A;  3DX0 A;  3BUD A;  1OA0 A;  3G9G A;  4IW0 A;  4F00 A;  1R33 A;  3EJU A;  3D4Y A;  2WIN M;  4EZX A;  3BUQ A; 
#chains in the Genus database with same CATH homology
 3DPP A;  3D2F A;  2EX3 B;  5E84 A;  3DPQ A;  3ZED A;  7HSC A;  4EZZ A;  2YIB A;  2ND1 A;  1SUF A;  4EZT A;  2GA9 D;  5TKY A;  4IM3 A;  2GAF D;  4E3C A;  4JNF A;  2NCZ A;  3ZEF A;  2YIA A;  4ILI A;  3N8E A;  4G6Q A;  4H6H A;  3ER9 B;  3I39 X;  3T47 A;  4JWD A;  3FD9 A;  1ZYL A;  2LM0 A;  1MJG A;  3SBT B;  4NPH A;  4IM2 A;  4MQD A;  2ND0 A;  4JWC A;  4F01 A;  3O3M B;  1W9M A;  4R5L A;  2QXL A;  2YI9 A;  4EZQ A;  3B53 X;  4E81 A;  2PY6 A;  1SU8 A;  3I04 A;  1E2U A;  2EWF A;  4IWQ A;  1DKY A;  1U00 A;  4KIK B;  1SU7 A;  3QA8 A;  3DQG A;  1Q5L A;  1E1D A;  4EZV A;  4R5G A;  3ER8 C;  4H6I A;  1CKR A;  3A98 A;  4EZW A;  3UIT A;  3C7N A;  3VEA A;  4B9Q A;  2QFF A;  4UDY X;  2RT6 A;  1DKZ A;  4WV5 A;  4R5K A;  1E9V A;  1SU6 A;  3OHX M;  3LMF A;  4EZS A;  4EZY A;  1GNL A;  4JLC A;  2Z8Y A;  3ERC C;  3DOB A;  3SBS A;  1DKX A;  3C7N B;  1OAO A;  2OBM A;  3D2E A;  4HYB A;  3H0X A;  3O3O B;  4EZU A;  4EZP A;  2WIN M;  3RV1 A;  1YUW A;  2BPR A;  5FLE X;  4EZR A;  3L3O M;  4HY9 A;  4JL9 A;  4JNE A;  3RV0 A;  3T49 A;  1GNT A;  4HR1 A;  4IM0 A;  4R5J A;  2YI8 A;  1OA1 A;  3T46 A;  3T4A G;  3B51 X;  3KAW A;  3VEB A;  4EZO A;  1DG4 A;  3F7W A;  1GN9 A;  3I01 A;  4WV7 A;  4PO2 A;  4EZN A;  1UPX A;  2JNS A;  3GI7 A;  3B52 X;  3KAV A;  3OWG A;  3QNJ A;  3O3N B;  4FM3 A;  4M0M A;  2V7Y A;  2N3K A;  4R5I A;  2OP6 A;  2KHO A;  3KDR A;  4JWI A;  4ILG A;  3DPO A;  4UDX X;  4IWP A;  4I43 A;  4IWO A;  5FIG A;  1OA0 A;  1JQK A;  1BPR A;  2X5C A;  4IW0 A;  4F00 A;  4D8J A;  3T48 A;  4ILH B;  4JWE A;  4JN4 A;  2OBL A;  4KIK A;  3VKH A;  2YIV X;  4FL9 A;  4HR1 B;  4EZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...