3QNJA

Crystal structure of the substrate binding domain of e.coli dnak in complex with the antimicrobial peptide oncocin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
210
structure length
204
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Rational Design of Oncocin Derivatives with Superior Protease Stabilities and Antibacterial Activities Based on the High-Resolution Structure of the Oncocin-DnaK Complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/antimicrobial protein
total genus 54
structure length 204
sequence length 210
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3qnjA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 3qnjA01
3T46A 4WV5A 4WV7A 4JWDA 4EZOA 4EZPA 1CKRA 4R5KA 2KHOA 4EZNA 4F00A 2OP6A 3N8EA 4PO2A 4JNFA 4EZSA 3DPQA 1U00A 4B9QA 4EZXA 5TKYA 3D2FA 2BPRA 3D2EA 4E81A 2V7YA 3DQGA 2WINM 4HYBA 1DG4A 4JWEA 1DKYA 4EZTA 3L3OM 4EZWA 3DPOA 4HY9A 5E84A 4F01A 4EZVA 4EZRA 7HSCA 4JN4A 4R5JA 4H6HA 3DPPA 3T49A 4R5IA 4EZYA 3C7NA 3DOBA 3QNJA 3T47A 1BPRA 4FL9A 3T4AG 3OHXM 1Q5LA 1DKXA 3T48A 4H6IA 3C7NB 4EZQA 4JWIA 4EZUA 1YUWA 4JWCA 1DKZA 4JNEA 4R5GA 2QFFA 2QXLA 4EZZA 4R5LA 3H0XA
chains in the Genus database with same CATH superfamily
1X03A 2ND0A 4FZSA 3DPOA 2YIVX 4EZRA 2Z0OA 1O7DB 4H6HA 3C7NA 3BLBA 3DOBA 4UDXX 3T48A 3C7NB 4IW0A 2GF4A 3D51A 2ELBA 4I43A 4AZ6A 3O3NB 3L3OM 2F1BA 3O3OB 3T47A 3A98A 3ACOA 2Q13A 3EJTA 4E3CA 3CZNA 2F7QA 3N8EA 4F00A 1ZWWA 3BVWA 4F01A 3CV5A 3Q0KA 3DPPA 3T49A 3DDGA 4JWCA 4R5LA 5KBPA 1MJGA 4JWDA 2OBLA 3QA8A 3B53X 3BUQA 3BUPA 4UDYX 2WYHA 2YL6A 1O7DC 3LMFA 2GA9D 4EZUA 4IM0A 3BVVA 3D4YA 1TQUA 4EZOA 3OWGA 3HAHA 4IWPA 2WINM 2QKWA 3LVTA 3SBTB 4M0MA 2LXYA 2F7PA 4FL9A 3KAVA 1LQ7A 4IWQA 3CVRA 1OAOA 2F7RA 3T46A 2V0OA 3SBSA 4IM3A 2GAFD 4PO2A 2F1AA 4NSWA 3ERCC 2RT6A 2OZNB 4HY9A 4JN4A 2F18A 3PLTA 3OHXM 4H6IA 1YWMA 2NCZA 4ILHB 3ER9B 2PY6A 3M3WA 3OK8A 4JNFA 1QWNA 3RV0A 4E81A 1URUA 1DG4A 1TQTA 4AZHA 4G6QA 4EZVA 3DX2A 1SUFA 3T4AG 4DCNC 2Z0VA 4I1QA 3RPMA 1UPXA 2JNKA 1TQSA 3VEBA 3EJRA 3D52A 4FZPA 4R5KA 1JQKA 2JNSA 3BVUA 1E9VA 2EFLA 3CZSA 1QWUA 3Q84A 2YIAA 1BPRA 4H8SA 2Z0NA 1E1DA 4WPEA 1YUWA 2N3KA 4MQDA 4KIKA 3DX4A 4WV7A 2Z8YA 3BUBA 3D50A 3KAWA 2YLAA 2KHOA 3EJQA 3GI7A 4EZSA 4KIKB 3VKHA 1Y2OA 3O3MB 1PS3A 3I2WA 3DX1A 4EZWA 2MI7A 3DDFA 4WPCA 2X3VA 2OW7A 3UITA 1GN9A 1WDZA 3BVTA 4AVMA 3B52X 1Q5LA 1E2UA 2ALWA 4EZZA 3FD9A 1GNTA 2ND1A 4WV5A 4JL9A 1HXKA 4EZXA 1OA0A 4HYBA 3ZEDA 3VEAA 2Q12A 4AZIA 3HAJA 4EZYA 2FYVA 2YL8A 4DYLA 2FICA 4IWOA 1HWWA 2OW6A 2WYIA 4JNEA 1OA1A 1CKRA 2OO2A 3D2FA 2V7YA 5FLEX 4JWEA 4JLCA 3DYTA 2YL5A 2YI9A 4NQIA 2YI8A 2ZXQA 2YL9A 3HAIA 1HTYA 3F7WA 2QXLA 5FIGA 4ILGA 3BUDA 1I49A 4FZOA 3BVXA 1SU8A 3DPQA 3I01A 4D8JA 3QNIA 4ATMA 3LLLA 1R5EA 3G9GA 4R5JA 3KDRA 1X04A 2LM0A 4IM2A 1SU7A 4EZQA 2QFFA 4AZGA 2EWFA 4EZPA 4AZ7A 4EZNA 4AZCA 4B9QA 1I4DA 2YKTA 3DQGA 4ILIA 4BNEA 1W9MA 4AZCB 5C5BA 1DKYA 2YIBA 3BUIA 5E84A 1GNLA 3CAZA 4R5IA 5C5BB 2C08A 2X3XA 3RV1A 4JWIA 3ZEFA 1QX1A 2X3WA 4HR1A 2OP6A 5TKYA 4AZ5A 1SU6A 3B51X 4HR1B 1R33A 3ER8C 7HSCA 1TQWA 3EJPA 3I39X 3EJSA 1DKXA 3SOGA 2F7OA 3SYVA 4R5GA 2D4CA 2RAJA 3D4ZA 3ABHA 2X5CA 2RAKA 2BPRA 1ZYLA 3QWEA 3L3PA 4EZTA 3DX3A 2EX3B 1R34A 4NPHA 2D1LA 3I04A 3QNJA 2PMRA 1DKZA 4AZBA 2O0I1 4AKVA 3QE6A 1U00A 3D2EA 2YLLA 1I4LA 3CKDA 4FM3A 3DX0A 1TQVA 2EFKA 2OBMA 3EJUA 3H0XA 2RAIA 1I4TA
chains in the Genus database with same CATH topology
4WV7A 2Z8YA 2EWFA 3KAWA 4EZPA 4EZOA 2KHOA 4EZNA 3GI7A 4EZSA 3OWGA 4B9QA 4KIKB 3VKHA 4IWPA 3O3MB 3DQGA 4ILIA 2ND0A 2WINM 1W9MA 1DKYA 4EZWA 2YIBA 3DPOA 5E84A 2YIVX 1GNLA 4EZRA 3SBTB 4M0MA 4H6HA 4R5IA 4MQDA 3C7NA 3DOBA 3UITA 1GN9A 4FL9A 3KAVA 4UDXX 3B52X 4IWQA 3RV1A 3T48A 1E2UA 1Q5LA 3C7NB 1OAOA 4IW0A 4JWIA 3ZEFA 4EZZA 3FD9A 1GNTA 2ND1A 3T46A 4WV5A 3SBSA 4IM3A 4HR1A 2OP6A 2GAFD 4PO2A 4I43A 4JL9A 4EZXA 1OA0A 5TKYA 3ERCC 1SU6A 2RT6A 3O3NB 4HYBA 3B51X 4HR1B 3ZEDA 3VEAA 3L3OM 3ER8C 4HY9A 7HSCA 4JN4A 4EZYA 3I39X 3O3OB 3T47A 3OHXM 1DKXA 3A98A 4H6IA 4IWOA 2NCZA 4JNEA 4R5GA 4ILHB 1OA1A 3ER9B 2PY6A 4E3CA 1CKRA 3N8EA 2X5CA 4F00A 4JNFA 3RV0A 3D2FA 2BPRA 4E81A 2V7YA 1ZYLA 5FLEX 1DG4A 4JWEA 4JLCA 4EZTA 4G6QA 4F01A 4EZVA 1SUFA 2EX3B 3DPPA 3T49A 4NPHA 2YI9A 3I04A 3QNJA 2YI8A 3T4AG 1UPXA 4JWCA 1DKZA 3F7WA 2QXLA 4R5LA 3VEBA 1MJGA 5FIGA 4ILGA 4JWDA 2OBLA 4R5KA 1JQKA 2JNSA 1SU8A 3DPQA 1U00A 3QA8A 3D2EA 3I01A 3B53X 4D8JA 1E9VA 4FM3A 4UDYX 4R5JA 3LMFA 3KDRA 2OBMA 2LM0A 2YIAA 1BPRA 4IM2A 4IM0A 1SU7A 1E1DA 4EZQA 2GA9D 4EZUA 1YUWA 3H0XA 2QFFA 2N3KA 4KIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T46 A;  4WV5 A;  4WV7 A;  4JWD A;  4EZO A;  4EZP A;  1CKR A;  4R5K A;  2KHO A;  4EZN A;  4F00 A;  2OP6 A;  3N8E A;  4PO2 A;  4JNF A;  4EZS A;  3DPQ A;  1U00 A;  4B9Q A;  4EZX A;  5TKY A;  3D2F A;  2BPR A;  3D2E A;  4E81 A;  2V7Y A;  3DQG A;  2WIN M;  4HYB A;  1DG4 A;  4JWE A;  1DKY A;  4EZT A;  3L3O M;  4EZW A;  3DPO A;  4HY9 A;  5E84 A;  4F01 A;  4EZV A;  4EZR A;  7HSC A;  4JN4 A;  4R5J A;  4H6H A;  3DPP A;  3T49 A;  4R5I A;  4EZY A;  3C7N A;  3DOB A;  3QNJ A;  3T47 A;  1BPR A;  4FL9 A;  3T4A G;  3OHX M;  1Q5L A;  1DKX A;  3T48 A;  4H6I A;  3C7N B;  4EZQ A;  4JWI A;  4EZU A;  1YUW A;  4JWC A;  1DKZ A;  4JNE A;  4R5G A;  2QFF A;  2QXL A;  4EZZ A;  4R5L A;  3H0X A; 
#chains in the Genus database with same CATH topology
 1X03 A;  2ND0 A;  4FZS A;  3DPO A;  2YIV X;  4EZR A;  2Z0O A;  1O7D B;  4H6H A;  3C7N A;  3BLB A;  3DOB A;  4UDX X;  3T48 A;  3C7N B;  4IW0 A;  2GF4 A;  3D51 A;  2ELB A;  4I43 A;  4AZ6 A;  3O3N B;  3L3O M;  2F1B A;  3O3O B;  3T47 A;  3A98 A;  3ACO A;  2Q13 A;  3EJT A;  4E3C A;  3CZN A;  2F7Q A;  3N8E A;  4F00 A;  1ZWW A;  3BVW A;  4F01 A;  3CV5 A;  3Q0K A;  3DPP A;  3T49 A;  3DDG A;  4JWC A;  4R5L A;  5KBP A;  1MJG A;  4JWD A;  2OBL A;  3QA8 A;  3B53 X;  3BUQ A;  3BUP A;  4UDY X;  2WYH A;  2YL6 A;  1O7D C;  3LMF A;  2GA9 D;  4EZU A;  4IM0 A;  3BVV A;  3D4Y A;  1TQU A;  4EZO A;  3OWG A;  3HAH A;  4IWP A;  2WIN M;  2QKW A;  3LVT A;  3SBT B;  4M0M A;  2LXY A;  2F7P A;  4FL9 A;  3KAV A;  1LQ7 A;  4IWQ A;  3CVR A;  1OAO A;  2F7R A;  3T46 A;  2V0O A;  3SBS A;  4IM3 A;  2GAF D;  4PO2 A;  2F1A A;  4NSW A;  3ERC C;  2RT6 A;  2OZN B;  4HY9 A;  4JN4 A;  2F18 A;  3PLT A;  3OHX M;  4H6I A;  1YWM A;  2NCZ A;  4ILH B;  3ER9 B;  2PY6 A;  3M3W A;  3OK8 A;  4JNF A;  1QWN A;  3RV0 A;  4E81 A;  1URU A;  1DG4 A;  1TQT A;  4AZH A;  4G6Q A;  4EZV A;  3DX2 A;  1SUF A;  3T4A G;  4DCN C;  2Z0V A;  4I1Q A;  3RPM A;  1UPX A;  2JNK A;  1TQS A;  3VEB A;  3EJR A;  3D52 A;  4FZP A;  4R5K A;  1JQK A;  2JNS A;  3BVU A;  1E9V A;  2EFL A;  3CZS A;  1QWU A;  3Q84 A;  2YIA A;  1BPR A;  4H8S A;  2Z0N A;  1E1D A;  4WPE A;  1YUW A;  2N3K A;  4MQD A;  4KIK A;  3DX4 A;  4WV7 A;  2Z8Y A;  3BUB A;  3D50 A;  3KAW A;  2YLA A;  2KHO A;  3EJQ A;  3GI7 A;  4EZS A;  4KIK B;  3VKH A;  1Y2O A;  3O3M B;  1PS3 A;  3I2W A;  3DX1 A;  4EZW A;  2MI7 A;  3DDF A;  4WPC A;  2X3V A;  2OW7 A;  3UIT A;  1GN9 A;  1WDZ A;  3BVT A;  4AVM A;  3B52 X;  1Q5L A;  1E2U A;  2ALW A;  4EZZ A;  3FD9 A;  1GNT A;  2ND1 A;  4WV5 A;  4JL9 A;  1HXK A;  4EZX A;  1OA0 A;  4HYB A;  3ZED A;  3VEA A;  2Q12 A;  4AZI A;  3HAJ A;  4EZY A;  2FYV A;  2YL8 A;  4DYL A;  2FIC A;  4IWO A;  1HWW A;  2OW6 A;  2WYI A;  4JNE A;  1OA1 A;  1CKR A;  2OO2 A;  3D2F A;  2V7Y A;  5FLE X;  4JWE A;  4JLC A;  3DYT A;  2YL5 A;  2YI9 A;  4NQI A;  2YI8 A;  2ZXQ A;  2YL9 A;  3HAI A;  1HTY A;  3F7W A;  2QXL A;  5FIG A;  4ILG A;  3BUD A;  1I49 A;  4FZO A;  3BVX A;  1SU8 A;  3DPQ A;  3I01 A;  4D8J A;  3QNI A;  4ATM A;  3LLL A;  1R5E A;  3G9G A;  4R5J A;  3KDR A;  1X04 A;  2LM0 A;  4IM2 A;  1SU7 A;  4EZQ A;  2QFF A;  4AZG A;  2EWF A;  4EZP A;  4AZ7 A;  4EZN A;  4AZC A;  4B9Q A;  1I4D A;  2YKT A;  3DQG A;  4ILI A;  4BNE A;  1W9M A;  4AZC B;  5C5B A;  1DKY A;  2YIB A;  3BUI A;  5E84 A;  1GNL A;  3CAZ A;  4R5I A;  5C5B B;  2C08 A;  2X3X A;  3RV1 A;  4JWI A;  3ZEF A;  1QX1 A;  2X3W A;  4HR1 A;  2OP6 A;  5TKY A;  4AZ5 A;  1SU6 A;  3B51 X;  4HR1 B;  1R33 A;  3ER8 C;  7HSC A;  1TQW A;  3EJP A;  3I39 X;  3EJS A;  1DKX A;  3SOG A;  2F7O A;  3SYV A;  4R5G A;  2D4C A;  2RAJ A;  3D4Z A;  3ABH A;  2X5C A;  2RAK A;  2BPR A;  1ZYL A;  3QWE A;  3L3P A;  4EZT A;  3DX3 A;  2EX3 B;  1R34 A;  4NPH A;  2D1L A;  3I04 A;  3QNJ A;  2PMR A;  1DKZ A;  4AZB A;  2O0I 1;  4AKV A;  3QE6 A;  1U00 A;  3D2E A;  2YLL A;  1I4L A;  3CKD A;  4FM3 A;  3DX0 A;  1TQV A;  2EFK A;  2OBM A;  3EJU A;  3H0X A;  2RAI A;  1I4T A; 
#chains in the Genus database with same CATH homology
 4WV7 A;  2Z8Y A;  2EWF A;  3KAW A;  4EZP A;  4EZO A;  2KHO A;  4EZN A;  3GI7 A;  4EZS A;  3OWG A;  4B9Q A;  4KIK B;  3VKH A;  4IWP A;  3O3M B;  3DQG A;  4ILI A;  2ND0 A;  2WIN M;  1W9M A;  1DKY A;  4EZW A;  2YIB A;  3DPO A;  5E84 A;  2YIV X;  1GNL A;  4EZR A;  3SBT B;  4M0M A;  4H6H A;  4R5I A;  4MQD A;  3C7N A;  3DOB A;  3UIT A;  1GN9 A;  4FL9 A;  3KAV A;  4UDX X;  3B52 X;  4IWQ A;  3RV1 A;  3T48 A;  1E2U A;  1Q5L A;  3C7N B;  1OAO A;  4IW0 A;  4JWI A;  3ZEF A;  4EZZ A;  3FD9 A;  1GNT A;  2ND1 A;  3T46 A;  4WV5 A;  3SBS A;  4IM3 A;  4HR1 A;  2OP6 A;  2GAF D;  4PO2 A;  4I43 A;  4JL9 A;  4EZX A;  1OA0 A;  5TKY A;  3ERC C;  1SU6 A;  2RT6 A;  3O3N B;  4HYB A;  3B51 X;  4HR1 B;  3ZED A;  3VEA A;  3L3O M;  3ER8 C;  4HY9 A;  7HSC A;  4JN4 A;  4EZY A;  3I39 X;  3O3O B;  3T47 A;  3OHX M;  1DKX A;  3A98 A;  4H6I A;  4IWO A;  2NCZ A;  4JNE A;  4R5G A;  4ILH B;  1OA1 A;  3ER9 B;  2PY6 A;  4E3C A;  1CKR A;  3N8E A;  2X5C A;  4F00 A;  4JNF A;  3RV0 A;  3D2F A;  2BPR A;  4E81 A;  2V7Y A;  1ZYL A;  5FLE X;  1DG4 A;  4JWE A;  4JLC A;  4EZT A;  4G6Q A;  4F01 A;  4EZV A;  1SUF A;  2EX3 B;  3DPP A;  3T49 A;  4NPH A;  2YI9 A;  3I04 A;  3QNJ A;  2YI8 A;  3T4A G;  1UPX A;  4JWC A;  1DKZ A;  3F7W A;  2QXL A;  4R5L A;  3VEB A;  1MJG A;  5FIG A;  4ILG A;  4JWD A;  2OBL A;  4R5K A;  1JQK A;  2JNS A;  1SU8 A;  3DPQ A;  1U00 A;  3QA8 A;  3D2E A;  3I01 A;  3B53 X;  4D8J A;  1E9V A;  4FM3 A;  4UDY X;  4R5J A;  3LMF A;  3KDR A;  2OBM A;  2LM0 A;  2YIA A;  1BPR A;  4IM2 A;  4IM0 A;  1SU7 A;  1E1D A;  4EZQ A;  2GA9 D;  4EZU A;  1YUW A;  3H0X A;  2QFF A;  2N3K A;  4KIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...