4R5LA

Crystal structure of the dnak c-terminus (dnak-sbd-c)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
225
structure length
222
Chain Sequence
HHHHIEGRVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKALNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Chaperone protein DnaK
publication title Structural Basis for the Inhibition of HSP70 and DnaK Chaperones by Small-Molecule Targeting of a C-Terminal Allosteric Pocket.
pubmed doi rcsb
source organism Escherichia coli
total genus 61
structure length 222
sequence length 225
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4r5lA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4r5lA01
2BPRA 4F01A 3D2FA 4JNEA 4JWEA 4EZNA 2QXLA 3H0XA 4EZTA 4PO2A 1DG4A 4JWDA 3T47A 4B9QA 4EZQA 4EZZA 1YUWA 4R5JA 2WINM 4H6IA 4R5LA 4EZPA 3C7NB 3D2EA 3DQGA 4EZXA 4R5GA 4EZUA 3T48A 4EZWA 3DPQA 4JN4A 1BPRA 4F00A 3DPOA 4WV7A 4EZRA 4JWIA 1DKXA 3DPPA 2QFFA 4HY9A 3T46A 3T49A 4WV5A 1Q5LA 1CKRA 3OHXM 3DOBA 7HSCA 4EZVA 1U00A 4R5KA 4H6HA 4R5IA 2V7YA 5E84A 3N8EA 4EZSA 4HYBA 3QNJA 2KHOA 4JNFA 3T4AG 2OP6A 4EZOA 4FL9A 3L3OM 4EZYA 1DKZA 4E81A 1DKYA 5TKYA 3C7NA 4JWCA
chains in the Genus database with same CATH superfamily
3CKDA 3ZEDA 1DG4A 2OO2A 4EZZA 1OA0A 1SU8A 3ERCC 3HAIA 1MJGA 3OWGA 2ALWA 3O3NB 3SOGA 3CZSA 3B52X 3CAZA 2RAKA 3QE6A 3ACOA 2RAIA 4JWEA 4ILIA 2YL5A 2YI8A 1R5EA 3KDRA 3GI7A 2GAFD 2YLLA 4JL9A 1DKXA 1CKRA 1U00A 2EFKA 3BUDA 1PS3A 3LLLA 3B51X 2EFLA 3I2WA 4E81A 4AZ5A 2OBMA 1E1DA 1YUWA 2YI9A 2X5CA 5FLEX 4ATMA 1TQSA 4EZUA 3DPOA 3EJQA 3D4YA 2ND1A 3G9GA 4JNFA 3VEAA 1DKYA 2C08A 5TKYA 2Q13A 1JQKA 3UITA 4BNEA 3KAWA 4JNEA 2V0OA 2WYIA 4IM0A 1LQ7A 3BVUA 4HR1B 3LVTA 4NQIA 2PY6A 3T49A 2N3KA 3DX4A 3N8EA 3EJUA 1HTYA 1SUFA 4AKVA 4HR1A 4EZPA 4R5LA 4AZGA 3EJSA 4EZWA 4JN4A 1O7DC 4HY9A 3CV5A 4WPEA 3OHXM 3T4AG 4IWQA 4HYBA 4JWCA 2LXYA 3Q0KA 4FZOA 1SU7A 2JNKA 2Z0VA 2ZXQA 4WV7A 2X3WA 4D8JA 3RV1A 2EWFA 1Q5LA 5E84A 3QWEA 1GNTA 4IM2A 4B9QA 2F7PA 1ZWWA 2WINM 3D2EA 4EZXA 2OW6A 3DX0A 1E2UA 5FIGA 1TQWA 3D52A 4G6QA 2EX3B 3D50A 2Q12A 2V7YA 4EZSA 3M3WA 1GN9A 1QWNA 1TQVA 3ZEFA 2FYVA 3L3PA 5C5BB 4NPHA 3T47A 4NSWA 1ZYLA 3BVWA 4AZHA 2O0I1 2RAJA 1W9MA 4MQDA 3DPPA 2QFFA 1HXKA 3PLTA 4JLCA 3OK8A 4DYLA 2D1LA 5C5BA 3O3OB 3ER9B 3L3OM 1DKZA 3D4ZA 2GA9D 3BUIA 4IM3A 2F1AA 4F01A 3D51A 3H0XA 4EZTA 1Y2OA 3ER8C 4R5JA 3C7NB 4KIKB 3BUQA 4IW0A 1SU6A 2GF4A 3EJTA 4FM3A 1GNLA 2YIBA 1URUA 3EJRA 3KAVA 2PMRA 4R5IA 3ABHA 3I39X 3C7NA 1QX1A 4KIKA 3BUPA 2F7OA 3DQGA 4R5GA 1I4TA 3SYVA 4I1QA 1OAOA 3BVVA 4EZRA 2JNSA 3T46A 1TQUA 4FZSA 4R5KA 4EZOA 2Z0NA 4AZCB 1QWUA 3DDGA 3SBSA 3A98A 2YKTA 2ND0A 4AZ7A 3BVTA 3FD9A 1UPXA 1BPRA 4AZCA 4AZ6A 3VKHA 4IWOA 2WYHA 3RPMA 2Z0OA 1R33A 4AZIA 2KHOA 2YL8A 2OP6A 1R34A 3O3MB 1X03A 2RT6A 1I4LA 3HAJA 3Q84A 1HWWA 3DDFA 3B53X 4JWDA 4EZQA 2YL6A 3CZNA 3RV0A 3DOBA 3DYTA 4DCNC 3HAHA 1YWMA 3D2FA 4PO2A 4UDXX 3I01A 2F1BA 3DPQA 4UDYX 4ILHB 4E3CA 4M0MA 4FZPA 2ELBA 3F7WA 4EZNA 2F7QA 2D4CA 3CVRA 3DX1A 4WV5A 1I49A 2YL9A 2LM0A 1E9VA 2FICA 2F7RA 4H6HA 2YLAA 3BVXA 3QNJA 4FL9A 2OBLA 5KBPA 4EZYA 2OZNB 4AVMA 3LMFA 2QKWA 3DX3A 1O7DB 3QA8A 2F18A 4H6IA 1I4DA 4ILGA 4IWPA 3T48A 4F00A 1X04A 3VEBA 3EJPA 3SBTB 3DX2A 7HSCA 3I04A 4I43A 3BLBA 2BPRA 2YIVX 2OW7A 2QXLA 4H8SA 2Z8YA 2X3XA 4WPCA 1WDZA 4JWIA 2NCZA 2X3VA 4AZBA 4EZVA 2YIAA 2MI7A 1OA1A 3QNIA 3BUBA 1TQTA
chains in the Genus database with same CATH topology
4IM3A 4F01A 3D2FA 3ZEDA 4HR1A 3H0XA 4EZTA 4PO2A 1DG4A 3ER8C 4EZZA 1OA0A 4R5JA 4EZPA 3C7NB 4R5LA 4UDXX 4KIKB 1SU8A 3ERCC 3I01A 4IW0A 1SU6A 4EZWA 3DPQA 4UDYX 4JN4A 4ILHB 4FM3A 4E3CA 1MJGA 1GNLA 4HY9A 3OWGA 4M0MA 2YIBA 3KAVA 3O3NB 3OHXM 3B52X 4R5IA 3T4AG 3I39X 4IWQA 3C7NA 4HYBA 4JWCA 4KIKA 3F7WA 4JWEA 4EZNA 4ILIA 2YI8A 3DQGA 3KDRA 4R5GA 3GI7A 2GAFD 1SU7A 4JL9A 1OAOA 4WV7A 4EZRA 2JNSA 1DKXA 3T46A 4D8JA 4WV5A 3RV1A 2EWFA 1Q5LA 1CKRA 2LM0A 1E9VA 1U00A 4R5KA 4H6HA 5E84A 3QNJA 1GNTA 3B51X 4EZOA 4FL9A 2OBLA 4EZYA 4E81A 3LMFA 4IM2A 2OBMA 3SBSA 3A98A 3QA8A 2ND0A 1E1DA 4B9QA 1YUWA 2YI9A 2WINM 2X5CA 4H6IA 5FLEX 3D2EA 4EZXA 4ILGA 3FD9A 4EZUA 4IWPA 1E2UA 1UPXA 3T48A 1BPRA 5FIGA 3DPOA 4F00A 4G6QA 3VEBA 2EX3B 3SBTB 3VKHA 4IWOA 7HSCA 3I04A 2ND1A 2V7YA 4I43A 4EZSA 2KHOA 4JNFA 2OP6A 1GN9A 3O3MB 3VEAA 3ZEFA 1DKYA 5TKYA 2RT6A 2BPRA 1JQKA 3UITA 2YIVX 3KAWA 4JNEA 4NPHA 2QXLA 3B53X 4JWDA 3T47A 4IM0A 4EZQA 1ZYLA 2Z8YA 4HR1B 3RV0A 4JWIA 1W9MA 2PY6A 3DPPA 4MQDA 2QFFA 3T49A 2NCZA 4JLCA 3DOBA 4EZVA 2N3KA 2YIAA 3N8EA 1OA1A 3O3OB 3ER9B 3L3OM 1DKZA 1SUFA 2GA9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BPR A;  4F01 A;  3D2F A;  4JNE A;  4JWE A;  4EZN A;  2QXL A;  3H0X A;  4EZT A;  4PO2 A;  1DG4 A;  4JWD A;  3T47 A;  4B9Q A;  4EZQ A;  4EZZ A;  1YUW A;  4R5J A;  2WIN M;  4H6I A;  4R5L A;  4EZP A;  3C7N B;  3D2E A;  3DQG A;  4EZX A;  4R5G A;  4EZU A;  3T48 A;  4EZW A;  3DPQ A;  4JN4 A;  1BPR A;  4F00 A;  3DPO A;  4WV7 A;  4EZR A;  4JWI A;  1DKX A;  3DPP A;  2QFF A;  4HY9 A;  3T46 A;  3T49 A;  4WV5 A;  1Q5L A;  1CKR A;  3OHX M;  3DOB A;  7HSC A;  4EZV A;  1U00 A;  4R5K A;  4H6H A;  4R5I A;  2V7Y A;  5E84 A;  3N8E A;  4EZS A;  4HYB A;  3QNJ A;  2KHO A;  4JNF A;  3T4A G;  2OP6 A;  4EZO A;  4FL9 A;  3L3O M;  4EZY A;  1DKZ A;  4E81 A;  1DKY A;  5TKY A;  3C7N A;  4JWC A; 
#chains in the Genus database with same CATH topology
 3CKD A;  3ZED A;  1DG4 A;  2OO2 A;  4EZZ A;  1OA0 A;  1SU8 A;  3ERC C;  3HAI A;  1MJG A;  3OWG A;  2ALW A;  3O3N B;  3SOG A;  3CZS A;  3B52 X;  3CAZ A;  2RAK A;  3QE6 A;  3ACO A;  2RAI A;  4JWE A;  4ILI A;  2YL5 A;  2YI8 A;  1R5E A;  3KDR A;  3GI7 A;  2GAF D;  2YLL A;  4JL9 A;  1DKX A;  1CKR A;  1U00 A;  2EFK A;  3BUD A;  1PS3 A;  3LLL A;  3B51 X;  2EFL A;  3I2W A;  4E81 A;  4AZ5 A;  2OBM A;  1E1D A;  1YUW A;  2YI9 A;  2X5C A;  5FLE X;  4ATM A;  1TQS A;  4EZU A;  3DPO A;  3EJQ A;  3D4Y A;  2ND1 A;  3G9G A;  4JNF A;  3VEA A;  1DKY A;  2C08 A;  5TKY A;  2Q13 A;  1JQK A;  3UIT A;  4BNE A;  3KAW A;  4JNE A;  2V0O A;  2WYI A;  4IM0 A;  1LQ7 A;  3BVU A;  4HR1 B;  3LVT A;  4NQI A;  2PY6 A;  3T49 A;  2N3K A;  3DX4 A;  3N8E A;  3EJU A;  1HTY A;  1SUF A;  4AKV A;  4HR1 A;  4EZP A;  4R5L A;  4AZG A;  3EJS A;  4EZW A;  4JN4 A;  1O7D C;  4HY9 A;  3CV5 A;  4WPE A;  3OHX M;  3T4A G;  4IWQ A;  4HYB A;  4JWC A;  2LXY A;  3Q0K A;  4FZO A;  1SU7 A;  2JNK A;  2Z0V A;  2ZXQ A;  4WV7 A;  2X3W A;  4D8J A;  3RV1 A;  2EWF A;  1Q5L A;  5E84 A;  3QWE A;  1GNT A;  4IM2 A;  4B9Q A;  2F7P A;  1ZWW A;  2WIN M;  3D2E A;  4EZX A;  2OW6 A;  3DX0 A;  1E2U A;  5FIG A;  1TQW A;  3D52 A;  4G6Q A;  2EX3 B;  3D50 A;  2Q12 A;  2V7Y A;  4EZS A;  3M3W A;  1GN9 A;  1QWN A;  1TQV A;  3ZEF A;  2FYV A;  3L3P A;  5C5B B;  4NPH A;  3T47 A;  4NSW A;  1ZYL A;  3BVW A;  4AZH A;  2O0I 1;  2RAJ A;  1W9M A;  4MQD A;  3DPP A;  2QFF A;  1HXK A;  3PLT A;  4JLC A;  3OK8 A;  4DYL A;  2D1L A;  5C5B A;  3O3O B;  3ER9 B;  3L3O M;  1DKZ A;  3D4Z A;  2GA9 D;  3BUI A;  4IM3 A;  2F1A A;  4F01 A;  3D51 A;  3H0X A;  4EZT A;  1Y2O A;  3ER8 C;  4R5J A;  3C7N B;  4KIK B;  3BUQ A;  4IW0 A;  1SU6 A;  2GF4 A;  3EJT A;  4FM3 A;  1GNL A;  2YIB A;  1URU A;  3EJR A;  3KAV A;  2PMR A;  4R5I A;  3ABH A;  3I39 X;  3C7N A;  1QX1 A;  4KIK A;  3BUP A;  2F7O A;  3DQG A;  4R5G A;  1I4T A;  3SYV A;  4I1Q A;  1OAO A;  3BVV A;  4EZR A;  2JNS A;  3T46 A;  1TQU A;  4FZS A;  4R5K A;  4EZO A;  2Z0N A;  4AZC B;  1QWU A;  3DDG A;  3SBS A;  3A98 A;  2YKT A;  2ND0 A;  4AZ7 A;  3BVT A;  3FD9 A;  1UPX A;  1BPR A;  4AZC A;  4AZ6 A;  3VKH A;  4IWO A;  2WYH A;  3RPM A;  2Z0O A;  1R33 A;  4AZI A;  2KHO A;  2YL8 A;  2OP6 A;  1R34 A;  3O3M B;  1X03 A;  2RT6 A;  1I4L A;  3HAJ A;  3Q84 A;  1HWW A;  3DDF A;  3B53 X;  4JWD A;  4EZQ A;  2YL6 A;  3CZN A;  3RV0 A;  3DOB A;  3DYT A;  4DCN C;  3HAH A;  1YWM A;  3D2F A;  4PO2 A;  4UDX X;  3I01 A;  2F1B A;  3DPQ A;  4UDY X;  4ILH B;  4E3C A;  4M0M A;  4FZP A;  2ELB A;  3F7W A;  4EZN A;  2F7Q A;  2D4C A;  3CVR A;  3DX1 A;  4WV5 A;  1I49 A;  2YL9 A;  2LM0 A;  1E9V A;  2FIC A;  2F7R A;  4H6H A;  2YLA A;  3BVX A;  3QNJ A;  4FL9 A;  2OBL A;  5KBP A;  4EZY A;  2OZN B;  4AVM A;  3LMF A;  2QKW A;  3DX3 A;  1O7D B;  3QA8 A;  2F18 A;  4H6I A;  1I4D A;  4ILG A;  4IWP A;  3T48 A;  4F00 A;  1X04 A;  3VEB A;  3EJP A;  3SBT B;  3DX2 A;  7HSC A;  3I04 A;  4I43 A;  3BLB A;  2BPR A;  2YIV X;  2OW7 A;  2QXL A;  4H8S A;  2Z8Y A;  2X3X A;  4WPC A;  1WDZ A;  4JWI A;  2NCZ A;  2X3V A;  4AZB A;  4EZV A;  2YIA A;  2MI7 A;  1OA1 A;  3QNI A;  3BUB A;  1TQT A; 
#chains in the Genus database with same CATH homology
 4IM3 A;  4F01 A;  3D2F A;  3ZED A;  4HR1 A;  3H0X A;  4EZT A;  4PO2 A;  1DG4 A;  3ER8 C;  4EZZ A;  1OA0 A;  4R5J A;  4EZP A;  3C7N B;  4R5L A;  4UDX X;  4KIK B;  1SU8 A;  3ERC C;  3I01 A;  4IW0 A;  1SU6 A;  4EZW A;  3DPQ A;  4UDY X;  4JN4 A;  4ILH B;  4FM3 A;  4E3C A;  1MJG A;  1GNL A;  4HY9 A;  3OWG A;  4M0M A;  2YIB A;  3KAV A;  3O3N B;  3OHX M;  3B52 X;  4R5I A;  3T4A G;  3I39 X;  4IWQ A;  3C7N A;  4HYB A;  4JWC A;  4KIK A;  3F7W A;  4JWE A;  4EZN A;  4ILI A;  2YI8 A;  3DQG A;  3KDR A;  4R5G A;  3GI7 A;  2GAF D;  1SU7 A;  4JL9 A;  1OAO A;  4WV7 A;  4EZR A;  2JNS A;  1DKX A;  3T46 A;  4D8J A;  4WV5 A;  3RV1 A;  2EWF A;  1Q5L A;  1CKR A;  2LM0 A;  1E9V A;  1U00 A;  4R5K A;  4H6H A;  5E84 A;  3QNJ A;  1GNT A;  3B51 X;  4EZO A;  4FL9 A;  2OBL A;  4EZY A;  4E81 A;  3LMF A;  4IM2 A;  2OBM A;  3SBS A;  3A98 A;  3QA8 A;  2ND0 A;  1E1D A;  4B9Q A;  1YUW A;  2YI9 A;  2WIN M;  2X5C A;  4H6I A;  5FLE X;  3D2E A;  4EZX A;  4ILG A;  3FD9 A;  4EZU A;  4IWP A;  1E2U A;  1UPX A;  3T48 A;  1BPR A;  5FIG A;  3DPO A;  4F00 A;  4G6Q A;  3VEB A;  2EX3 B;  3SBT B;  3VKH A;  4IWO A;  7HSC A;  3I04 A;  2ND1 A;  2V7Y A;  4I43 A;  4EZS A;  2KHO A;  4JNF A;  2OP6 A;  1GN9 A;  3O3M B;  3VEA A;  3ZEF A;  1DKY A;  5TKY A;  2RT6 A;  2BPR A;  1JQK A;  3UIT A;  2YIV X;  3KAW A;  4JNE A;  4NPH A;  2QXL A;  3B53 X;  4JWD A;  3T47 A;  4IM0 A;  4EZQ A;  1ZYL A;  2Z8Y A;  4HR1 B;  3RV0 A;  4JWI A;  1W9M A;  2PY6 A;  3DPP A;  4MQD A;  2QFF A;  3T49 A;  2NCZ A;  4JLC A;  3DOB A;  4EZV A;  2N3K A;  2YIA A;  3N8E A;  1OA1 A;  3O3O B;  3ER9 B;  3L3O M;  1DKZ A;  1SUF A;  2GA9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...