4R5LA

Crystal structure of the dnak c-terminus (dnak-sbd-c)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
225
structure length
222
Chain Sequence
HHHHIEGRVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKALNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Basis for the Inhibition of HSP70 and DnaK Chaperones by Small-Molecule Targeting of a C-Terminal Allosteric Pocket.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 61
structure length 222
sequence length 225
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4r5lA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4r5lA01
4JNFA 4H6IA 1YUWA 4R5KA 4HY9A 2WINM 4B9QA 1Q5LA 4FL9A 5TKYA 3C7NB 3N8EA 4JNEA 3T4AG 3OHXM 4JWIA 4HYBA 4EZYA 4EZQA 3L3OM 3T48A 4EZSA 4F00A 3DPOA 4EZWA 3DPQA 4JWDA 4JWEA 4EZZA 1DKYA 2QFFA 1U00A 3DQGA 4JWCA 3T46A 4EZXA 2QXLA 4EZPA 2KHOA 4JN4A 3H0XA 1DG4A 1CKRA 4EZUA 3QNJA 4PO2A 1BPRA 4EZVA 4EZNA 1DKXA 3D2EA 4F01A 4EZOA 2OP6A 4WV7A 3DPPA 4R5JA 5E84A 3T47A 1DKZA 4EZRA 4R5IA 2BPRA 3DOBA 4R5GA 4WV5A 4E81A 4H6HA 7HSCA 4R5LA 3T49A 4EZTA 3C7NA 3D2FA 2V7YA
chains in the Genus database with same CATH superfamily
1ZWWA 5C5BA 3ERCC 2Z0OA 4FM3A 3C7NB 3L3OM 4EZSA 2X5CA 1TQVA 4FZOA 4EZVA 3DYTA 4MQDA 4F01A 1GNTA 3A98A 3CV5A 4R5IA 4IWQA 1GN9A 3QE6A 3T4AG 4HYBA 3DX3A 3SYVA 4I1QA 1HXKA 4JN4A 3RV0A 3M3WA 4R5JA 2YL5A 4AZCB 4AZGA 4E3CA 2YI9A 3C7NA 3LVTA 3OK8A 1TQUA 2RT6A 1Y2OA 4JNEA 4F00A 4JWDA 4AZ7A 1E1DA 1DKXA 2EWFA 3ZEDA 1OAOA 3L3PA 2OP6A 4IM3A 3T47A 4UDYX 3D2FA 3BVTA 3DX0A 1QWNA 3BUIA 1OA0A 4EZYA 4KIKB 1X04A 2YIBA 1TQWA 1YWMA 2GAFD 4DYLA 3PLTA 3DX4A 1BPRA 4EZNA 4DCNC 2OW6A 2WYHA 2ND0A 4E81A 1GNLA 1SU6A 1O7DC 4B9QA 3ABHA 3HAIA 2OO2A 2YLAA 4AZHA 3BVXA 2RAKA 4IW0A 4EZPA 2D1LA 1PS3A 2YIAA 2JNSA 1HWWA 2C08A 3DPOA 3EJPA 1YUWA 2F7RA 4KIKA 4IWOA 1R33A 3BUBA 4NPHA 2FICA 2QKWA 2MI7A 1UPXA 3D2EA 4EZOA 1MJGA 4BNEA 2OBMA 3I04A 4JL9A 3EJTA 4JNFA 3CKDA 2FYVA 2ELBA 4EZWA 3D50A 2KHOA 3D52A 4AKVA 4WPCA 1I49A 4ILGA 3EJUA 4WV5A 3DOBA 2EFKA 4R5LA 3LLLA 3QA8A 3O3MB 4H6IA 3SBTB 5TKYA 5KBPA 3D4ZA 1JQKA 2YLLA 3DQGA 1QWUA 3LMFA 3ER9B 3OWGA 2F1BA 2YL9A 2QFFA 2F1AA 2V7YA 3DDFA 4NSWA 1WDZA 2PMRA 3G9GA 3Q0KA 3RV1A 3DPQA 4G6QA 3DX2A 3T46A 2YL6A 2QXLA 3H0XA 3GI7A 3EJSA 3BVUA 4R5GA 3I2WA 4AZIA 4ATMA 2X3XA 1SU7A 3KAWA 4UDXX 1O7DB 3Q84A 4I43A 2Z0NA 4NQIA 1X03A 1I4LA 5FLEX 4H8SA 4AZ6A 3QWEA 1HTYA 2LM0A 1URUA 3RPMA 5E84A 3HAHA 4ILHB 4JLCA 4EZTA 3D4YA 2JNKA 4IM2A 2RAJA 4JWIA 1LQ7A 4JWEA 4EZZA 2Z8YA 2LXYA 2X3VA 4WPEA 1R5EA 4EZUA 4PO2A 3I39X 3F7WA 2D4CA 2EFLA 3O3OB 1SUFA 3ZEFA 4AZ5A 3DX1A 3BVVA 3BLBA 1Q5LA 3ER8C 1TQSA 3ACOA 3CZNA 4IM0A 4ILIA 3BUQA 2O0I1 1QX1A 4AZBA 2RAIA 3D51A 3DDGA 2F18A 1TQTA 3O3NB 4H6HA 3FD9A 3EJQA 3B53X 1E9VA 3QNIA 3T48A 3VKHA 4D8JA 2EX3B 4EZXA 2Z0VA 3UITA 2ALWA 2OBLA 3VEBA 2X3WA 2GA9D 1CKRA 2NCZA 3VEAA 2GF4A 2WINM 4IWPA 3EJRA 3OHXM 1W9MA 3BUDA 3BUPA 2OZNB 1DKYA 4FZSA 1ZYLA 3BVWA 4M0MA 1DG4A 4WV7A 1E2UA 2PY6A 3DPPA 1OA1A 2BPRA 3I01A 7HSCA 4FL9A 4EZQA 4HR1B 3N8EA 1R34A 5C5BB 1I4TA 2YIVX 4AZCA 1U00A 3SOGA 4JWCA 1SU8A 3QNJA 3CVRA 2YKTA 2YI8A 2ZXQA 5FIGA 1I4DA 2ND1A 2F7OA 2YL8A 4R5KA 4FZPA 4HY9A 3CZSA 2F7QA 3CAZA 4AVMA 3KAVA 3KDRA 2Q13A 3SBSA 2F7PA 3B52X 4HR1A 3HAJA 4EZRA 1DKZA 2WYIA 2Q12A 2V0OA 2OW7A 3T49A 3B51X 2N3KA
chains in the Genus database with same CATH topology
3FD9A 3ERCC 4B9QA 4FM3A 3C7NB 3B53X 3RV1A 1E9VA 3L3OM 3T48A 4EZSA 3DPQA 4G6QA 3VKHA 2X5CA 3T46A 4D8JA 2EX3B 4EZXA 2QXLA 4IW0A 3UITA 4EZPA 3H0XA 2OBLA 4EZVA 4MQDA 3VEBA 4F01A 3GI7A 1GNTA 2YIAA 3A98A 4R5IA 2JNSA 4R5GA 2GA9D 3DPOA 1CKRA 2NCZA 3VEAA 1YUWA 2WINM 1SU7A 4KIKA 4IWQA 3KAWA 4UDXX 4IWOA 4IWPA 1GN9A 3T4AG 3OHXM 4HYBA 1W9MA 4NPHA 4I43A 1DKYA 1ZYLA 4M0MA 5FLEX 4JN4A 1DG4A 1UPXA 2LM0A 3RV0A 3D2EA 4EZOA 4WV7A 1MJGA 1E2UA 3DPPA 2PY6A 4R5JA 5E84A 1OA1A 2BPRA 2OBMA 3I04A 4ILHB 3I01A 4JL9A 4E3CA 4JLCA 2YI9A 7HSCA 4EZTA 3C7NA 4FL9A 4EZQA 4HR1B 4JNFA 4IM2A 3N8EA 2RT6A 4JNEA 4JWIA 4F00A 4EZWA 4JWDA 4JWEA 4EZZA 2YIVX 2Z8YA 1U00A 4JWCA 1E1DA 1SU8A 2KHOA 4EZUA 3QNJA 4PO2A 3I39X 2YI8A 3F7WA 1DKXA 2EWFA 3ZEDA 1OAOA 3O3OB 2OP6A 4ILGA 4IM3A 3T47A 5FIGA 4WV5A 2ND1A 3DOBA 1SUFA 4UDYX 4R5LA 3ZEFA 3D2FA 3QA8A 3O3MB 4H6IA 4R5KA 4HY9A 3SBTB 1Q5LA 3ER8C 5TKYA 1OA0A 4IM0A 4ILIA 4EZYA 3KAVA 3KDRA 1JQKA 4KIKB 2YIBA 3DQGA 2GAFD 3SBSA 3LMFA 1BPRA 3ER9B 4EZNA 3B52X 3OWGA 4HR1A 3O3NB 4EZRA 1DKZA 2ND0A 4E81A 1GNLA 1SU6A 4H6HA 3T49A 2QFFA 3B51X 2N3KA 2V7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JNF A;  4H6I A;  1YUW A;  4R5K A;  4HY9 A;  2WIN M;  4B9Q A;  1Q5L A;  4FL9 A;  5TKY A;  3C7N B;  3N8E A;  4JNE A;  3T4A G;  3OHX M;  4JWI A;  4HYB A;  4EZY A;  4EZQ A;  3L3O M;  3T48 A;  4EZS A;  4F00 A;  3DPO A;  4EZW A;  3DPQ A;  4JWD A;  4JWE A;  4EZZ A;  1DKY A;  2QFF A;  1U00 A;  3DQG A;  4JWC A;  3T46 A;  4EZX A;  2QXL A;  4EZP A;  2KHO A;  4JN4 A;  3H0X A;  1DG4 A;  1CKR A;  4EZU A;  3QNJ A;  4PO2 A;  1BPR A;  4EZV A;  4EZN A;  1DKX A;  3D2E A;  4F01 A;  4EZO A;  2OP6 A;  4WV7 A;  3DPP A;  4R5J A;  5E84 A;  3T47 A;  1DKZ A;  4EZR A;  4R5I A;  2BPR A;  3DOB A;  4R5G A;  4WV5 A;  4E81 A;  4H6H A;  7HSC A;  4R5L A;  3T49 A;  4EZT A;  3C7N A;  3D2F A;  2V7Y A; 
#chains in the Genus database with same CATH topology
 1ZWW A;  5C5B A;  3ERC C;  2Z0O A;  4FM3 A;  3C7N B;  3L3O M;  4EZS A;  2X5C A;  1TQV A;  4FZO A;  4EZV A;  3DYT A;  4MQD A;  4F01 A;  1GNT A;  3A98 A;  3CV5 A;  4R5I A;  4IWQ A;  1GN9 A;  3QE6 A;  3T4A G;  4HYB A;  3DX3 A;  3SYV A;  4I1Q A;  1HXK A;  4JN4 A;  3RV0 A;  3M3W A;  4R5J A;  2YL5 A;  4AZC B;  4AZG A;  4E3C A;  2YI9 A;  3C7N A;  3LVT A;  3OK8 A;  1TQU A;  2RT6 A;  1Y2O A;  4JNE A;  4F00 A;  4JWD A;  4AZ7 A;  1E1D A;  1DKX A;  2EWF A;  3ZED A;  1OAO A;  3L3P A;  2OP6 A;  4IM3 A;  3T47 A;  4UDY X;  3D2F A;  3BVT A;  3DX0 A;  1QWN A;  3BUI A;  1OA0 A;  4EZY A;  4KIK B;  1X04 A;  2YIB A;  1TQW A;  1YWM A;  2GAF D;  4DYL A;  3PLT A;  3DX4 A;  1BPR A;  4EZN A;  4DCN C;  2OW6 A;  2WYH A;  2ND0 A;  4E81 A;  1GNL A;  1SU6 A;  1O7D C;  4B9Q A;  3ABH A;  3HAI A;  2OO2 A;  2YLA A;  4AZH A;  3BVX A;  2RAK A;  4IW0 A;  4EZP A;  2D1L A;  1PS3 A;  2YIA A;  2JNS A;  1HWW A;  2C08 A;  3DPO A;  3EJP A;  1YUW A;  2F7R A;  4KIK A;  4IWO A;  1R33 A;  3BUB A;  4NPH A;  2FIC A;  2QKW A;  2MI7 A;  1UPX A;  3D2E A;  4EZO A;  1MJG A;  4BNE A;  2OBM A;  3I04 A;  4JL9 A;  3EJT A;  4JNF A;  3CKD A;  2FYV A;  2ELB A;  4EZW A;  3D50 A;  2KHO A;  3D52 A;  4AKV A;  4WPC A;  1I49 A;  4ILG A;  3EJU A;  4WV5 A;  3DOB A;  2EFK A;  4R5L A;  3LLL A;  3QA8 A;  3O3M B;  4H6I A;  3SBT B;  5TKY A;  5KBP A;  3D4Z A;  1JQK A;  2YLL A;  3DQG A;  1QWU A;  3LMF A;  3ER9 B;  3OWG A;  2F1B A;  2YL9 A;  2QFF A;  2F1A A;  2V7Y A;  3DDF A;  4NSW A;  1WDZ A;  2PMR A;  3G9G A;  3Q0K A;  3RV1 A;  3DPQ A;  4G6Q A;  3DX2 A;  3T46 A;  2YL6 A;  2QXL A;  3H0X A;  3GI7 A;  3EJS A;  3BVU A;  4R5G A;  3I2W A;  4AZI A;  4ATM A;  2X3X A;  1SU7 A;  3KAW A;  4UDX X;  1O7D B;  3Q84 A;  4I43 A;  2Z0N A;  4NQI A;  1X03 A;  1I4L A;  5FLE X;  4H8S A;  4AZ6 A;  3QWE A;  1HTY A;  2LM0 A;  1URU A;  3RPM A;  5E84 A;  3HAH A;  4ILH B;  4JLC A;  4EZT A;  3D4Y A;  2JNK A;  4IM2 A;  2RAJ A;  4JWI A;  1LQ7 A;  4JWE A;  4EZZ A;  2Z8Y A;  2LXY A;  2X3V A;  4WPE A;  1R5E A;  4EZU A;  4PO2 A;  3I39 X;  3F7W A;  2D4C A;  2EFL A;  3O3O B;  1SUF A;  3ZEF A;  4AZ5 A;  3DX1 A;  3BVV A;  3BLB A;  1Q5L A;  3ER8 C;  1TQS A;  3ACO A;  3CZN A;  4IM0 A;  4ILI A;  3BUQ A;  2O0I 1;  1QX1 A;  4AZB A;  2RAI A;  3D51 A;  3DDG A;  2F18 A;  1TQT A;  3O3N B;  4H6H A;  3FD9 A;  3EJQ A;  3B53 X;  1E9V A;  3QNI A;  3T48 A;  3VKH A;  4D8J A;  2EX3 B;  4EZX A;  2Z0V A;  3UIT A;  2ALW A;  2OBL A;  3VEB A;  2X3W A;  2GA9 D;  1CKR A;  2NCZ A;  3VEA A;  2GF4 A;  2WIN M;  4IWP A;  3EJR A;  3OHX M;  1W9M A;  3BUD A;  3BUP A;  2OZN B;  1DKY A;  4FZS A;  1ZYL A;  3BVW A;  4M0M A;  1DG4 A;  4WV7 A;  1E2U A;  2PY6 A;  3DPP A;  1OA1 A;  2BPR A;  3I01 A;  7HSC A;  4FL9 A;  4EZQ A;  4HR1 B;  3N8E A;  1R34 A;  5C5B B;  1I4T A;  2YIV X;  4AZC A;  1U00 A;  3SOG A;  4JWC A;  1SU8 A;  3QNJ A;  3CVR A;  2YKT A;  2YI8 A;  2ZXQ A;  5FIG A;  1I4D A;  2ND1 A;  2F7O A;  2YL8 A;  4R5K A;  4FZP A;  4HY9 A;  3CZS A;  2F7Q A;  3CAZ A;  4AVM A;  3KAV A;  3KDR A;  2Q13 A;  3SBS A;  2F7P A;  3B52 X;  4HR1 A;  3HAJ A;  4EZR A;  1DKZ A;  2WYI A;  2Q12 A;  2V0O A;  2OW7 A;  3T49 A;  3B51 X;  2N3K A; 
#chains in the Genus database with same CATH homology
 3FD9 A;  3ERC C;  4B9Q A;  4FM3 A;  3C7N B;  3B53 X;  3RV1 A;  1E9V A;  3L3O M;  3T48 A;  4EZS A;  3DPQ A;  4G6Q A;  3VKH A;  2X5C A;  3T46 A;  4D8J A;  2EX3 B;  4EZX A;  2QXL A;  4IW0 A;  3UIT A;  4EZP A;  3H0X A;  2OBL A;  4EZV A;  4MQD A;  3VEB A;  4F01 A;  3GI7 A;  1GNT A;  2YIA A;  3A98 A;  4R5I A;  2JNS A;  4R5G A;  2GA9 D;  3DPO A;  1CKR A;  2NCZ A;  3VEA A;  1YUW A;  2WIN M;  1SU7 A;  4KIK A;  4IWQ A;  3KAW A;  4UDX X;  4IWO A;  4IWP A;  1GN9 A;  3T4A G;  3OHX M;  4HYB A;  1W9M A;  4NPH A;  4I43 A;  1DKY A;  1ZYL A;  4M0M A;  5FLE X;  4JN4 A;  1DG4 A;  1UPX A;  2LM0 A;  3RV0 A;  3D2E A;  4EZO A;  4WV7 A;  1MJG A;  1E2U A;  3DPP A;  2PY6 A;  4R5J A;  5E84 A;  1OA1 A;  2BPR A;  2OBM A;  3I04 A;  4ILH B;  3I01 A;  4JL9 A;  4E3C A;  4JLC A;  2YI9 A;  7HSC A;  4EZT A;  3C7N A;  4FL9 A;  4EZQ A;  4HR1 B;  4JNF A;  4IM2 A;  3N8E A;  2RT6 A;  4JNE A;  4JWI A;  4F00 A;  4EZW A;  4JWD A;  4JWE A;  4EZZ A;  2YIV X;  2Z8Y A;  1U00 A;  4JWC A;  1E1D A;  1SU8 A;  2KHO A;  4EZU A;  3QNJ A;  4PO2 A;  3I39 X;  2YI8 A;  3F7W A;  1DKX A;  2EWF A;  3ZED A;  1OAO A;  3O3O B;  2OP6 A;  4ILG A;  4IM3 A;  3T47 A;  5FIG A;  4WV5 A;  2ND1 A;  3DOB A;  1SUF A;  4UDY X;  4R5L A;  3ZEF A;  3D2F A;  3QA8 A;  3O3M B;  4H6I A;  4R5K A;  4HY9 A;  3SBT B;  1Q5L A;  3ER8 C;  5TKY A;  1OA0 A;  4IM0 A;  4ILI A;  4EZY A;  3KAV A;  3KDR A;  1JQK A;  4KIK B;  2YIB A;  3DQG A;  2GAF D;  3SBS A;  3LMF A;  1BPR A;  3ER9 B;  4EZN A;  3B52 X;  3OWG A;  4HR1 A;  3O3N B;  4EZR A;  1DKZ A;  2ND0 A;  4E81 A;  1GNL A;  1SU6 A;  4H6H A;  3T49 A;  2QFF A;  3B51 X;  2N3K A;  2V7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...