4R5LA

Crystal structure of the dnak c-terminus (dnak-sbd-c)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
225
structure length
222
Chain Sequence
HHHHIEGRVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKALNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Basis for the Inhibition of HSP70 and DnaK Chaperones by Small-Molecule Targeting of a C-Terminal Allosteric Pocket.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 61
structure length 222
sequence length 225
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4r5lA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4r5lA01
3L3OM 1Q5LA 2OP6A 4R5LA 5E84A 3T47A 4JN4A 4F00A 4EZXA 3C7NA 7HSCA 3T49A 4R5KA 4EZZA 1BPRA 3H0XA 3DPQA 4HY9A 4JWCA 5TKYA 2QFFA 3D2FA 4HYBA 4R5GA 4JWIA 4H6HA 4EZOA 3QNJA 4EZYA 4PO2A 3D2EA 4H6IA 1U00A 1DKZA 2BPRA 3T4AG 1CKRA 4EZWA 1YUWA 3DOBA 4JNEA 4FL9A 1DKXA 4EZPA 3DPOA 4EZNA 3T48A 4EZTA 4JWDA 3OHXM 4B9QA 4EZSA 4WV5A 3T46A 4EZVA 2V7YA 2QXLA 4E81A 3N8EA 4WV7A 2WINM 4EZRA 2KHOA 4R5JA 3C7NB 4JNFA 4EZUA 3DQGA 4JWEA 1DG4A 3DPPA 4EZQA 4F01A 1DKYA 4R5IA
chains in the Genus database with same CATH superfamily
3QNIA 2YIVX 2YL6A 2GAFD 2OBMA 1Y2OA 2Z0NA 3SOGA 4AZ7A 3OHXM 3O3OB 4EZSA 4M0MA 4AZIA 4EZUA 4JWEA 1DG4A 3M3WA 3DX3A 2MI7A 3BUIA 3A98A 2LXYA 1OA0A 4FZSA 3BUQA 2D4CA 3G9GA 2N3KA 4EZTA 3I01A 3T46A 4IWOA 2RAKA 4JLCA 4AZCB 4EZQA 4DCNC 1Q5LA 2ELBA 3ZEFA 1R33A 2YI8A 4ILGA 4R5GA 4JL9A 3D52A 3BVWA 4WPEA 5C5BB 3EJPA 3L3PA 1I4DA 4R5JA 3HAIA 4KIKB 2NCZA 1E2UA 3L3OM 3HAJA 3O3NB 2F1AA 5TKYA 2FICA 3ACOA 2QFFA 4I1QA 1SU7A 2YIAA 2QKWA 1GNLA 2QXLA 1O7DB 2GF4A 3OK8A 3DDFA 1BPRA 4IM0A 1LQ7A 4EZOA 1PS3A 1ZYLA 1CKRA 4EZWA 1DKXA 2X5CA 1O7DC 4AZCA 2X3VA 3BVTA 1HWWA 2F7PA 4R5LA 4JN4A 4E3CA 3DX2A 2ND1A 4FM3A 3C7NB 5KBPA 5C5BA 4EZPA 4EZNA 4G6QA 3ZEDA 2Z0OA 2WYHA 2YL9A 1TQWA 3QA8A 4IWQA 2Q13A 3Q0KA 2Q12A 3EJUA 4IWPA 3LMFA 4JWCA 2F7RA 4JNEA 1TQUA 3DPOA 3BVVA 4JWDA 2YL8A 3I2WA 4E81A 1JQKA 1W9MA 3LLLA 4AKVA 2YLAA 3DPPA 1GN9A 3LVTA 4R5IA 3ER8C 3VEAA 4AVMA 4R5KA 1OAOA 1GNTA 2YIBA 2BPRA 4FL9A 3RV1A 3F7WA 4FZPA 3DX4A 1TQTA 3Q84A 1HXKA 2WINM 2EWFA 2ZXQA 4FZOA 2JNKA 4EZRA 2KHOA 1X04A 3EJQA 1UPXA 4AZGA 2FYVA 2RAJA 1SU8A 1DKYA 1QWNA 1I4LA 2OP6A 2ND0A 3BUBA 3C7NA 3ABHA 1E9VA 3HAHA 3EJTA 4AZ5A 3CAZA 3PLTA 4WV7A 3KAWA 1X03A 2ALWA 1MJGA 2WYIA 3B52X 4MQDA 4NSWA 4EZZA 4PO2A 4IW0A 4H6HA 4EZYA 4IM2A 3CZNA 1YUWA 3T48A 2RT6A 1URUA 2F1BA 3OWGA 4UDXX 3QE6A 3BVUA 3DDGA 3RV0A 3DX1A 1QWUA 4HR1B 1TQVA 2C08A 3DPQA 2YKTA 4HY9A 1SUFA 4HYBA 3CKDA 4JWIA 3D2EA 3SBSA 3DOBA 2RAIA 4ATMA 3EJRA 4EZVA 2F7OA 2OO2A 4KIKA 4JNFA 3DX0A 2O0I1 3RPMA 4D8JA 3D50A 1R5EA 5E84A 3T47A 4F00A 4EZXA 3B53X 1I49A 3D2FA 3BVXA 1WDZA 2EFKA 2Z0VA 3DYTA 3O3MB 2JNSA 2LM0A 1QX1A 3BLBA 1OA1A 1I4TA 3SYVA 4UDYX 2GA9D 3FD9A 3BUDA 4NPHA 3T49A 2YLLA 3N8EA 1DKZA 3SBTB 2YL5A 4BNEA 2YI9A 2X3XA 3BUPA 1HTYA 4I43A 5FIGA 3QWEA 2F7QA 3GI7A 4DYLA 4WPCA 4HR1A 4AZHA 3KDRA 3VEBA 3H0XA 3I39X 4H6IA 3D4ZA 3EJSA 2EFLA 2V7YA 1R34A 3B51X 4ILIA 3DQGA 2OW7A 5FLEX 4AZ6A 2Z8YA 4IM3A 2PY6A 4AZBA 3ER9B 3T4AG 4H8SA 1E1DA 3D4YA 2OZNB 4ILHB 1SU6A 4NQIA 2X3WA 2D1LA 3KAVA 3UITA 3D51A 3CZSA 4F01A 1YWMA 2EX3B 7HSCA 2F18A 3CV5A 3ERCC 1TQSA 3QNJA 1U00A 3CVRA 2V0OA 1ZWWA 2OBLA 4B9QA 4WV5A 2OW6A 3I04A 3VKHA 2PMRA
chains in the Genus database with same CATH topology
2OP6A 2ND0A 4UDYX 2GA9D 3C7NA 3FD9A 4NPHA 3T49A 1BPRA 4IM0A 1E9VA 2YIVX 4EZOA 3N8EA 1ZYLA 2GAFD 1DKZA 2OBMA 3SBTB 1CKRA 4EZWA 1DKXA 2YI9A 2X5CA 3OHXM 3O3OB 4EZSA 4WV7A 4M0MA 4I43A 5FIGA 3KAWA 3GI7A 4EZUA 4JWEA 1DG4A 4HR1A 1MJGA 3B52X 4R5LA 3KDRA 3VEBA 4JN4A 4E3CA 4MQDA 2ND1A 4EZZA 3A98A 4FM3A 4PO2A 3C7NB 4IW0A 1OA0A 4H6HA 3H0XA 3I39X 4EZYA 4H6IA 4IM2A 1YUWA 2N3KA 4EZPA 4EZNA 3T48A 4EZTA 4G6QA 3ZEDA 2RT6A 3I01A 3T46A 2V7YA 4IWOA 3B51X 3OWGA 4ILIA 3QA8A 4JLCA 4UDXX 3DQGA 4IWQA 4EZQA 5FLEX 3RV0A 2Z8YA 1Q5LA 4HR1B 3ZEFA 4IWPA 4IM3A 2YI8A 3LMFA 3DPQA 4HY9A 4JWCA 2PY6A 1SUFA 4R5GA 4HYBA 3ER9B 4JWIA 4JL9A 4ILGA 3D2EA 3T4AG 3SBSA 3DOBA 1E1DA 4JNEA 3DPOA 4JWDA 4EZVA 4ILHB 4E81A 1SU6A 1JQKA 1W9MA 3KAVA 4KIKA 4R5JA 4JNFA 3UITA 4KIKB 2NCZA 3DPPA 1GN9A 4F01A 4D8JA 2EX3B 4R5IA 1E2UA 3ER8C 3L3OM 3VEAA 5E84A 3T47A 3O3NB 4F00A 4EZXA 3B53X 7HSCA 4R5KA 5TKYA 2QFFA 3D2FA 3ERCC 1OAOA 1GNTA 1SU7A 2YIAA 3QNJA 2YIBA 1U00A 2BPRA 4FL9A 3RV1A 3F7WA 2OBLA 1GNLA 4B9QA 4WV5A 2QXLA 3I04A 2WINM 2EWFA 3VKHA 3O3MB 4EZRA 2KHOA 2JNSA 2LM0A 1UPXA 1SU8A 1DKYA 1OA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L3O M;  1Q5L A;  2OP6 A;  4R5L A;  5E84 A;  3T47 A;  4JN4 A;  4F00 A;  4EZX A;  3C7N A;  7HSC A;  3T49 A;  4R5K A;  4EZZ A;  1BPR A;  3H0X A;  3DPQ A;  4HY9 A;  4JWC A;  5TKY A;  2QFF A;  3D2F A;  4HYB A;  4R5G A;  4JWI A;  4H6H A;  4EZO A;  3QNJ A;  4EZY A;  4PO2 A;  3D2E A;  4H6I A;  1U00 A;  1DKZ A;  2BPR A;  3T4A G;  1CKR A;  4EZW A;  1YUW A;  3DOB A;  4JNE A;  4FL9 A;  1DKX A;  4EZP A;  3DPO A;  4EZN A;  3T48 A;  4EZT A;  4JWD A;  3OHX M;  4B9Q A;  4EZS A;  4WV5 A;  3T46 A;  4EZV A;  2V7Y A;  2QXL A;  4E81 A;  3N8E A;  4WV7 A;  2WIN M;  4EZR A;  2KHO A;  4R5J A;  3C7N B;  4JNF A;  4EZU A;  3DQG A;  4JWE A;  1DG4 A;  3DPP A;  4EZQ A;  4F01 A;  1DKY A;  4R5I A; 
#chains in the Genus database with same CATH topology
 3QNI A;  2YIV X;  2YL6 A;  2GAF D;  2OBM A;  1Y2O A;  2Z0N A;  3SOG A;  4AZ7 A;  3OHX M;  3O3O B;  4EZS A;  4M0M A;  4AZI A;  4EZU A;  4JWE A;  1DG4 A;  3M3W A;  3DX3 A;  2MI7 A;  3BUI A;  3A98 A;  2LXY A;  1OA0 A;  4FZS A;  3BUQ A;  2D4C A;  3G9G A;  2N3K A;  4EZT A;  3I01 A;  3T46 A;  4IWO A;  2RAK A;  4JLC A;  4AZC B;  4EZQ A;  4DCN C;  1Q5L A;  2ELB A;  3ZEF A;  1R33 A;  2YI8 A;  4ILG A;  4R5G A;  4JL9 A;  3D52 A;  3BVW A;  4WPE A;  5C5B B;  3EJP A;  3L3P A;  1I4D A;  4R5J A;  3HAI A;  4KIK B;  2NCZ A;  1E2U A;  3L3O M;  3HAJ A;  3O3N B;  2F1A A;  5TKY A;  2FIC A;  3ACO A;  2QFF A;  4I1Q A;  1SU7 A;  2YIA A;  2QKW A;  1GNL A;  2QXL A;  1O7D B;  2GF4 A;  3OK8 A;  3DDF A;  1BPR A;  4IM0 A;  1LQ7 A;  4EZO A;  1PS3 A;  1ZYL A;  1CKR A;  4EZW A;  1DKX A;  2X5C A;  1O7D C;  4AZC A;  2X3V A;  3BVT A;  1HWW A;  2F7P A;  4R5L A;  4JN4 A;  4E3C A;  3DX2 A;  2ND1 A;  4FM3 A;  3C7N B;  5KBP A;  5C5B A;  4EZP A;  4EZN A;  4G6Q A;  3ZED A;  2Z0O A;  2WYH A;  2YL9 A;  1TQW A;  3QA8 A;  4IWQ A;  2Q13 A;  3Q0K A;  2Q12 A;  3EJU A;  4IWP A;  3LMF A;  4JWC A;  2F7R A;  4JNE A;  1TQU A;  3DPO A;  3BVV A;  4JWD A;  2YL8 A;  3I2W A;  4E81 A;  1JQK A;  1W9M A;  3LLL A;  4AKV A;  2YLA A;  3DPP A;  1GN9 A;  3LVT A;  4R5I A;  3ER8 C;  3VEA A;  4AVM A;  4R5K A;  1OAO A;  1GNT A;  2YIB A;  2BPR A;  4FL9 A;  3RV1 A;  3F7W A;  4FZP A;  3DX4 A;  1TQT A;  3Q84 A;  1HXK A;  2WIN M;  2EWF A;  2ZXQ A;  4FZO A;  2JNK A;  4EZR A;  2KHO A;  1X04 A;  3EJQ A;  1UPX A;  4AZG A;  2FYV A;  2RAJ A;  1SU8 A;  1DKY A;  1QWN A;  1I4L A;  2OP6 A;  2ND0 A;  3BUB A;  3C7N A;  3ABH A;  1E9V A;  3HAH A;  3EJT A;  4AZ5 A;  3CAZ A;  3PLT A;  4WV7 A;  3KAW A;  1X03 A;  2ALW A;  1MJG A;  2WYI A;  3B52 X;  4MQD A;  4NSW A;  4EZZ A;  4PO2 A;  4IW0 A;  4H6H A;  4EZY A;  4IM2 A;  3CZN A;  1YUW A;  3T48 A;  2RT6 A;  1URU A;  2F1B A;  3OWG A;  4UDX X;  3QE6 A;  3BVU A;  3DDG A;  3RV0 A;  3DX1 A;  1QWU A;  4HR1 B;  1TQV A;  2C08 A;  3DPQ A;  2YKT A;  4HY9 A;  1SUF A;  4HYB A;  3CKD A;  4JWI A;  3D2E A;  3SBS A;  3DOB A;  2RAI A;  4ATM A;  3EJR A;  4EZV A;  2F7O A;  2OO2 A;  4KIK A;  4JNF A;  3DX0 A;  2O0I 1;  3RPM A;  4D8J A;  3D50 A;  1R5E A;  5E84 A;  3T47 A;  4F00 A;  4EZX A;  3B53 X;  1I49 A;  3D2F A;  3BVX A;  1WDZ A;  2EFK A;  2Z0V A;  3DYT A;  3O3M B;  2JNS A;  2LM0 A;  1QX1 A;  3BLB A;  1OA1 A;  1I4T A;  3SYV A;  4UDY X;  2GA9 D;  3FD9 A;  3BUD A;  4NPH A;  3T49 A;  2YLL A;  3N8E A;  1DKZ A;  3SBT B;  2YL5 A;  4BNE A;  2YI9 A;  2X3X A;  3BUP A;  1HTY A;  4I43 A;  5FIG A;  3QWE A;  2F7Q A;  3GI7 A;  4DYL A;  4WPC A;  4HR1 A;  4AZH A;  3KDR A;  3VEB A;  3H0X A;  3I39 X;  4H6I A;  3D4Z A;  3EJS A;  2EFL A;  2V7Y A;  1R34 A;  3B51 X;  4ILI A;  3DQG A;  2OW7 A;  5FLE X;  4AZ6 A;  2Z8Y A;  4IM3 A;  2PY6 A;  4AZB A;  3ER9 B;  3T4A G;  4H8S A;  1E1D A;  3D4Y A;  2OZN B;  4ILH B;  1SU6 A;  4NQI A;  2X3W A;  2D1L A;  3KAV A;  3UIT A;  3D51 A;  3CZS A;  4F01 A;  1YWM A;  2EX3 B;  7HSC A;  2F18 A;  3CV5 A;  3ERC C;  1TQS A;  3QNJ A;  1U00 A;  3CVR A;  2V0O A;  1ZWW A;  2OBL A;  4B9Q A;  4WV5 A;  2OW6 A;  3I04 A;  3VKH A;  2PMR A; 
#chains in the Genus database with same CATH homology
 2OP6 A;  2ND0 A;  4UDY X;  2GA9 D;  3C7N A;  3FD9 A;  4NPH A;  3T49 A;  1BPR A;  4IM0 A;  1E9V A;  2YIV X;  4EZO A;  3N8E A;  1ZYL A;  2GAF D;  1DKZ A;  2OBM A;  3SBT B;  1CKR A;  4EZW A;  1DKX A;  2YI9 A;  2X5C A;  3OHX M;  3O3O B;  4EZS A;  4WV7 A;  4M0M A;  4I43 A;  5FIG A;  3KAW A;  3GI7 A;  4EZU A;  4JWE A;  1DG4 A;  4HR1 A;  1MJG A;  3B52 X;  4R5L A;  3KDR A;  3VEB A;  4JN4 A;  4E3C A;  4MQD A;  2ND1 A;  4EZZ A;  3A98 A;  4FM3 A;  4PO2 A;  3C7N B;  4IW0 A;  1OA0 A;  4H6H A;  3H0X A;  3I39 X;  4EZY A;  4H6I A;  4IM2 A;  1YUW A;  2N3K A;  4EZP A;  4EZN A;  3T48 A;  4EZT A;  4G6Q A;  3ZED A;  2RT6 A;  3I01 A;  3T46 A;  2V7Y A;  4IWO A;  3B51 X;  3OWG A;  4ILI A;  3QA8 A;  4JLC A;  4UDX X;  3DQG A;  4IWQ A;  4EZQ A;  5FLE X;  3RV0 A;  2Z8Y A;  1Q5L A;  4HR1 B;  3ZEF A;  4IWP A;  4IM3 A;  2YI8 A;  3LMF A;  3DPQ A;  4HY9 A;  4JWC A;  2PY6 A;  1SUF A;  4R5G A;  4HYB A;  3ER9 B;  4JWI A;  4JL9 A;  4ILG A;  3D2E A;  3T4A G;  3SBS A;  3DOB A;  1E1D A;  4JNE A;  3DPO A;  4JWD A;  4EZV A;  4ILH B;  4E81 A;  1SU6 A;  1JQK A;  1W9M A;  3KAV A;  4KIK A;  4R5J A;  4JNF A;  3UIT A;  4KIK B;  2NCZ A;  3DPP A;  1GN9 A;  4F01 A;  4D8J A;  2EX3 B;  4R5I A;  1E2U A;  3ER8 C;  3L3O M;  3VEA A;  5E84 A;  3T47 A;  3O3N B;  4F00 A;  4EZX A;  3B53 X;  7HSC A;  4R5K A;  5TKY A;  2QFF A;  3D2F A;  3ERC C;  1OAO A;  1GNT A;  1SU7 A;  2YIA A;  3QNJ A;  2YIB A;  1U00 A;  2BPR A;  4FL9 A;  3RV1 A;  3F7W A;  2OBL A;  1GNL A;  4B9Q A;  4WV5 A;  2QXL A;  3I04 A;  2WIN M;  2EWF A;  3VKH A;  3O3M B;  4EZR A;  2KHO A;  2JNS A;  2LM0 A;  1UPX A;  1SU8 A;  1DKY A;  1OA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...