1CKRA

High resolution solution structure of the heat shock cognate-70 kd substrate binding domain obtained by multidimensional nmr techniques
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
159
structure length
159
Chain Sequence
SENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK SUBSTRATE BINDING DOMAIN OF HSC-70
publication title High-resolution solution structure of the 18 kDa substrate-binding domain of the mammalian chaperone protein Hsc70.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Chaperone
total genus 37
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 1999-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 1ckrA00
1DKYA 4B9QA 4WV5A 4HYBA 4JWEA 2OP6A 1Q5LA 3DQGA 4R5JA 4JWDA 1BPRA 4EZNA 4EZPA 5E84A 1CKRA 4EZWA 5TKYA 4JNEA 2QXLA 4EZZA 1DG4A 4E81A 4EZTA 1DKZA 1DKXA 3DPPA 1YUWA 7HSCA 1U00A 4JNFA 4JWCA 4EZUA 4EZSA 3N8EA 4PO2A 3DPOA 3C7NB 3H0XA 3C7NA 4F00A 4R5LA 3DPQA 2BPRA 3D2EA 3DOBA 4JWIA 4R5KA 4EZVA 4WV7A 3QNJA 4R5IA 4R5GA 2KHOA 4EZOA 4EZYA 4EZRA 4HY9A 3D2FA 4F01A 4EZXA 2V7YA 4EZQA 4JN4A 4FL9A
chains in the Genus database with same CATH superfamily
1DKYA 4MQDA 4B9QA 4WV5A 4HYBA 4JWEA 2OP6A 1Q5LA 4ILGA 3DQGA 4R5JA 4JWDA 1BPRA 4EZNA 4EZSA 4EZPA 5E84A 1CKRA 4EZWA 5TKYA 4JNEA 2QXLA 4EZZA 1DG4A 4E81A 3ZEFA 4EZTA 1DKZA 1DKXA 3DPPA 1YUWA 7HSCA 1U00A 4ILIA 4ILHB 4JNFA 4JWCA 3N8EA 4EZUA 3DPOA 3C7NB 3H0XA 3C7NA 4F00A 4PO2A 4R5LA 3DPQA 2BPRA 3D2EA 3DOBA 4JWIA 4R5KA 3SBTB 4WV7A 4EZVA 3QNJA 4R5IA 4R5GA 2KHOA 4EZOA 4EZYA 4EZRA 4HY9A 4I43A 3D2FA 4F01A 4EZXA 2V7YA 3SBSA 4EZQA 4JN4A 4FL9A
chains in the Genus database with same CATH topology
1DKYA 4MQDA 4B9QA 4WV5A 4HYBA 4JWEA 2OP6A 1Q5LA 4ILGA 3DQGA 4R5JA 4JWDA 1BPRA 4EZNA 4EZSA 4EZPA 5E84A 1CKRA 4EZWA 5TKYA 4JNEA 2QXLA 4EZZA 1DG4A 4E81A 3ZEFA 4EZTA 1DKZA 1DKXA 3DPPA 1YUWA 7HSCA 1U00A 4ILIA 4ILHB 4JNFA 4JWCA 3N8EA 4EZUA 3DPOA 3C7NB 3H0XA 3C7NA 4F00A 4PO2A 4R5LA 3DPQA 2BPRA 3D2EA 3DOBA 4JWIA 4R5KA 3SBTB 4WV7A 4EZVA 3QNJA 4R5IA 4R5GA 2KHOA 4EZOA 4EZYA 4EZRA 4HY9A 4I43A 3D2FA 4F01A 4EZXA 2V7YA 3SBSA 4EZQA 4JN4A 4FL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DKY A;  4B9Q A;  4WV5 A;  4HYB A;  4JWE A;  2OP6 A;  1Q5L A;  3DQG A;  4R5J A;  4JWD A;  1BPR A;  4EZN A;  4EZP A;  5E84 A;  1CKR A;  4EZW A;  5TKY A;  4JNE A;  2QXL A;  4EZZ A;  1DG4 A;  4E81 A;  4EZT A;  1DKZ A;  1DKX A;  3DPP A;  1YUW A;  7HSC A;  1U00 A;  4JNF A;  4JWC A;  4EZU A;  4EZS A;  3N8E A;  4PO2 A;  3DPO A;  3C7N B;  3H0X A;  3C7N A;  4F00 A;  4R5L A;  3DPQ A;  2BPR A;  3D2E A;  3DOB A;  4JWI A;  4R5K A;  4EZV A;  4WV7 A;  3QNJ A;  4R5I A;  4R5G A;  2KHO A;  4EZO A;  4EZY A;  4EZR A;  4HY9 A;  3D2F A;  4F01 A;  4EZX A;  2V7Y A;  4EZQ A;  4JN4 A;  4FL9 A; 
#chains in the Genus database with same CATH topology
 1DKY A;  4MQD A;  4B9Q A;  4WV5 A;  4HYB A;  4JWE A;  2OP6 A;  1Q5L A;  4ILG A;  3DQG A;  4R5J A;  4JWD A;  1BPR A;  4EZN A;  4EZS A;  4EZP A;  5E84 A;  1CKR A;  4EZW A;  5TKY A;  4JNE A;  2QXL A;  4EZZ A;  1DG4 A;  4E81 A;  3ZEF A;  4EZT A;  1DKZ A;  1DKX A;  3DPP A;  1YUW A;  7HSC A;  1U00 A;  4ILI A;  4ILH B;  4JNF A;  4JWC A;  3N8E A;  4EZU A;  3DPO A;  3C7N B;  3H0X A;  3C7N A;  4F00 A;  4PO2 A;  4R5L A;  3DPQ A;  2BPR A;  3D2E A;  3DOB A;  4JWI A;  4R5K A;  3SBT B;  4WV7 A;  4EZV A;  3QNJ A;  4R5I A;  4R5G A;  2KHO A;  4EZO A;  4EZY A;  4EZR A;  4HY9 A;  4I43 A;  3D2F A;  4F01 A;  4EZX A;  2V7Y A;  3SBS A;  4EZQ A;  4JN4 A;  4FL9 A; 
#chains in the Genus database with same CATH homology
 1DKY A;  4MQD A;  4B9Q A;  4WV5 A;  4HYB A;  4JWE A;  2OP6 A;  1Q5L A;  4ILG A;  3DQG A;  4R5J A;  4JWD A;  1BPR A;  4EZN A;  4EZS A;  4EZP A;  5E84 A;  1CKR A;  4EZW A;  5TKY A;  4JNE A;  2QXL A;  4EZZ A;  1DG4 A;  4E81 A;  3ZEF A;  4EZT A;  1DKZ A;  1DKX A;  3DPP A;  1YUW A;  7HSC A;  1U00 A;  4ILI A;  4ILH B;  4JNF A;  4JWC A;  3N8E A;  4EZU A;  3DPO A;  3C7N B;  3H0X A;  3C7N A;  4F00 A;  4PO2 A;  4R5L A;  3DPQ A;  2BPR A;  3D2E A;  3DOB A;  4JWI A;  4R5K A;  3SBT B;  4WV7 A;  4EZV A;  3QNJ A;  4R5I A;  4R5G A;  2KHO A;  4EZO A;  4EZY A;  4EZR A;  4HY9 A;  4I43 A;  3D2F A;  4F01 A;  4EZX A;  2V7Y A;  3SBS A;  4EZQ A;  4JN4 A;  4FL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...