4HYBA

Crystal structure of the substrate binding domain of e.coli dnak in complex with pyrrhocoricin_lyzi (residues 1 to 10)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
213
structure length
213
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone, peptide binding protein
molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
total genus 62
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4hybA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4hybA01
4EZRA 4FL9A 4EZOA 4EZTA 4E81A 4EZNA 1U00A 4F01A 2WINM 4EZQA 4F00A 4EZXA 4PO2A 3OHXM 4JN4A 2V7YA 1BPRA 3DPPA 4R5LA 4HYBA 2QXLA 4R5IA 3T46A 3L3OM 3T47A 3C7NA 1CKRA 1DG4A 1DKYA 3DPOA 4H6IA 1Q5LA 4R5GA 4EZVA 3D2FA 4JWIA 1YUWA 4JWCA 1DKXA 2BPRA 2OP6A 3DQGA 7HSCA 3D2EA 4WV5A 4JNEA 4EZSA 4JWEA 3DPQA 3T4AG 4EZZA 4EZUA 4JNFA 4R5KA 5TKYA 3T48A 4EZYA 4H6HA 3H0XA 4EZWA 3QNJA 4JWDA 5E84A 1DKZA 4B9QA 2QFFA 2KHOA 4HY9A 4EZPA 3N8EA 4WV7A 3DOBA 3T49A 4R5JA 3C7NB
chains in the Genus database with same CATH superfamily
2RAJA 4EZNA 2ND1A 4UDYX 4F01A 4F00A 3DX4A 2Z0NA 4IM3A 2QXLA 2YLAA 4AKVA 2Q13A 2JNKA 1SUFA 2NCZA 1HWWA 1SU6A 1TQVA 4IM0A 2JNSA 1OA0A 3BVWA 1TQSA 1ZWWA 3UITA 1BPRA 1I4LA 1Y2OA 2F1AA 4AZBA 2D4CA 1O7DB 3PLTA 4BNEA 3M3WA 1JQKA 3EJPA 3OWGA 3DOBA 4EZRA 4FL9A 2O0I1 3LMFA 2V7YA 3QWEA 4R5LA 1DG4A 4AVMA 2YI8A 3D52A 1I4DA 2OW7A 2YIAA 3VKHA 3DDFA 2RAKA 4IWOA 3BUBA 1YWMA 4AZ7A 4H8SA 4FZOA 4AZ5A 3DYTA 4NSWA 2Q12A 3D4YA 1LQ7A 3O3MB 3F7WA 1YUWA 3DQGA 1DKXA 2OP6A 3EJUA 4IWQA 2F7OA 4JL9A 2EFKA 2V0OA 3QNJA 4JWDA 3FD9A 2D1LA 4AZ6A 4E81A 1MJGA 4UDXX 2X5CA 3RV0A 3I2WA 3T46A 2Z0VA 5C5BB 2WYHA 3BVTA 2BPRA 4NPHA 2FICA 3BVXA 4IW0A 2ELBA 2YL8A 4I43A 3B52X 3OHXM 4HR1B 3HAJA 1CKRA 4R5IA 3T47A 3GI7A 4JLCA 2X3XA 4EZSA 4JWEA 4EZWA 1OA1A 5E84A 2OZNB 4EZOA 2Z8YA 2FYVA 3BLBA 3BUQA 3RV1A 1OAOA 3DPOA 3A98A 3D2FA 2PY6A 3CAZA 1HXKA 2GA9D 3KAVA 4DYLA 3DX2A 2QFFA 4EZPA 3I01A 2YL9A 4AZCB 1I4TA 4WV7A 4EZTA 3DDGA 1GNLA 3RPMA 4PO2A 4IWPA 3BUPA 2QKWA 3O3NB 4JNEA 3DPQA 1X04A 3EJQA 2KHOA 3VEBA 4NQIA 4I1QA 3ER9B 3C7NB 2F18A 1E2UA 4KIKB 3D51A 2Z0OA 2OO2A 3CVRA 2X3VA 3EJTA 4H6IA 1QWUA 3KAWA 4ILGA 2YIVX 5C5BA 1HTYA 2X3WA 4HY9A 1R33A 4DCNC 3N8EA 3B51X 3CZSA 3I39X 1QX1A 3BVVA 3ERCC 2LXYA 3CKDA 2OBLA 2GAFD 4JWIA 7HSCA 4HR1A 4IM2A 3BUIA 4FM3A 4EZZA 4EZUA 3SBTB 3HAIA 3ZEDA 1U00A 4AZIA 2WINM 4AZGA 1GNTA 2MI7A 3L3OM 2YL5A 3L3PA 3B53X 4WV5A 1TQWA 2RT6A 3BVUA 3T4AG 2ND0A 3HAHA 4R5JA 1R34A 1URUA 1R5EA 3QA8A 4FZPA 4MQDA 3EJSA 2OBMA 4AZCA 2N3KA 2F7QA 3LLLA 1DKYA 1SU8A 3BUDA 4G6QA 3G9GA 2RAIA 3VEAA 4M0MA 4JNFA 4WPEA 1WDZA 3O3OB 3DX0A 2LM0A 2ZXQA 3ER8C 4EZQA 1GN9A 3QE6A 5FIGA 4ATMA 4JN4A 2EX3B 4ILHB 2YIBA 3C7NA 2OW6A 2GF4A 4JWCA 4KIKA 2YL6A 3CV5A 4H6HA 2F7RA 1X03A 1E9VA 4AZHA 2WYIA 4WPCA 4EZXA 4ILIA 2EWFA 5FLEX 3ZEFA 3SOGA 3H0XA 2YKTA 4R5KA 5TKYA 4B9QA 1TQTA 1UPXA 3D4ZA 1E1DA 5KBPA 3DX3A 3DPPA 4HYBA 3QNIA 2ALWA 1Q5LA 4R5GA 4EZVA 2YI9A 3D2EA 3Q0KA 1W9MA 3SYVA 3T48A 1DKZA 3SBSA 2F1BA 1I49A 3I04A 1SU7A 3EJRA 3CZNA 3KDRA 3LVTA 4D8JA 2YLLA 2C08A 2EFLA 1TQUA 3ABHA 3D50A 4FZSA 1PS3A 2F7PA 4E3CA 3ACOA 1ZYLA 2PMRA 3DX1A 3OK8A 3Q84A 4EZYA 1O7DC 1QWNA 3T49A
chains in the Genus database with same CATH topology
1GN9A 4E81A 4EZNA 1MJGA 2ND1A 1E2UA 4UDYX 4KIKB 4UDXX 5FIGA 2X5CA 4F01A 4F00A 4JN4A 3RV0A 2EX3B 4ILHB 4IM3A 2QXLA 3T46A 2YIBA 3C7NA 4H6IA 4KIKA 4JWCA 2BPRA 4NPHA 3KAWA 1SUFA 4ILGA 2NCZA 2YIVX 1SU6A 4H6HA 4IM0A 4HY9A 3N8EA 2JNSA 1OA0A 4IW0A 1E9VA 4I43A 3B51X 3I39X 4EZXA 3B52X 3OHXM 4ILIA 4HR1B 3UITA 3ERCC 1BPRA 1CKRA 4R5IA 2EWFA 3T47A 5FLEX 2OBLA 2GAFD 4JWIA 7HSCA 3ZEFA 3GI7A 4JLCA 4HR1A 4EZSA 4IM2A 4JWEA 4FM3A 4EZZA 4EZUA 4R5KA 5TKYA 3H0XA 4EZWA 1OA1A 5E84A 4B9QA 3SBTB 1JQKA 3OWGA 1UPXA 3DOBA 3ZEDA 4EZRA 4EZOA 4FL9A 2Z8YA 1U00A 2WINM 1E1DA 1GNTA 3LMFA 2V7YA 3DPPA 4R5LA 4HYBA 3RV1A 1DG4A 2YI8A 3L3OM 1OAOA 3DPOA 1Q5LA 4R5GA 3A98A 4EZVA 3D2FA 2YI9A 2YIAA 3D2EA 3B53X 3VKHA 4WV5A 2RT6A 2PY6A 4IWOA 1W9MA 3T4AG 2GA9D 3T48A 3KAVA 2ND0A 1DKZA 4EZPA 2QFFA 3SBSA 3I01A 3I04A 4WV7A 4R5JA 1SU7A 4EZTA 3KDRA 4D8JA 1GNLA 3QA8A 4PO2A 4MQDA 2OBMA 4IWPA 2N3KA 1DKYA 3O3MB 4E3CA 3F7WA 1ZYLA 3O3NB 1YUWA 3DQGA 1DKXA 2OP6A 1SU8A 4G6QA 4IWQA 4JNEA 3VEAA 3DPQA 4M0MA 4JL9A 4JNFA 4EZYA 3QNJA 4JWDA 3O3OB 2KHOA 3VEBA 2LM0A 3ER8C 3T49A 4EZQA 3FD9A 3C7NB 3ER9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZR A;  4FL9 A;  4EZO A;  4EZT A;  4E81 A;  4EZN A;  1U00 A;  4F01 A;  2WIN M;  4EZQ A;  4F00 A;  4EZX A;  4PO2 A;  3OHX M;  4JN4 A;  2V7Y A;  1BPR A;  3DPP A;  4R5L A;  4HYB A;  2QXL A;  4R5I A;  3T46 A;  3L3O M;  3T47 A;  3C7N A;  1CKR A;  1DG4 A;  1DKY A;  3DPO A;  4H6I A;  1Q5L A;  4R5G A;  4EZV A;  3D2F A;  4JWI A;  1YUW A;  4JWC A;  1DKX A;  2BPR A;  2OP6 A;  3DQG A;  7HSC A;  3D2E A;  4WV5 A;  4JNE A;  4EZS A;  4JWE A;  3DPQ A;  3T4A G;  4EZZ A;  4EZU A;  4JNF A;  4R5K A;  5TKY A;  3T48 A;  4EZY A;  4H6H A;  3H0X A;  4EZW A;  3QNJ A;  4JWD A;  5E84 A;  1DKZ A;  4B9Q A;  2QFF A;  2KHO A;  4HY9 A;  4EZP A;  3N8E A;  4WV7 A;  3DOB A;  3T49 A;  4R5J A;  3C7N B; 
#chains in the Genus database with same CATH topology
 2RAJ A;  4EZN A;  2ND1 A;  4UDY X;  4F01 A;  4F00 A;  3DX4 A;  2Z0N A;  4IM3 A;  2QXL A;  2YLA A;  4AKV A;  2Q13 A;  2JNK A;  1SUF A;  2NCZ A;  1HWW A;  1SU6 A;  1TQV A;  4IM0 A;  2JNS A;  1OA0 A;  3BVW A;  1TQS A;  1ZWW A;  3UIT A;  1BPR A;  1I4L A;  1Y2O A;  2F1A A;  4AZB A;  2D4C A;  1O7D B;  3PLT A;  4BNE A;  3M3W A;  1JQK A;  3EJP A;  3OWG A;  3DOB A;  4EZR A;  4FL9 A;  2O0I 1;  3LMF A;  2V7Y A;  3QWE A;  4R5L A;  1DG4 A;  4AVM A;  2YI8 A;  3D52 A;  1I4D A;  2OW7 A;  2YIA A;  3VKH A;  3DDF A;  2RAK A;  4IWO A;  3BUB A;  1YWM A;  4AZ7 A;  4H8S A;  4FZO A;  4AZ5 A;  3DYT A;  4NSW A;  2Q12 A;  3D4Y A;  1LQ7 A;  3O3M B;  3F7W A;  1YUW A;  3DQG A;  1DKX A;  2OP6 A;  3EJU A;  4IWQ A;  2F7O A;  4JL9 A;  2EFK A;  2V0O A;  3QNJ A;  4JWD A;  3FD9 A;  2D1L A;  4AZ6 A;  4E81 A;  1MJG A;  4UDX X;  2X5C A;  3RV0 A;  3I2W A;  3T46 A;  2Z0V A;  5C5B B;  2WYH A;  3BVT A;  2BPR A;  4NPH A;  2FIC A;  3BVX A;  4IW0 A;  2ELB A;  2YL8 A;  4I43 A;  3B52 X;  3OHX M;  4HR1 B;  3HAJ A;  1CKR A;  4R5I A;  3T47 A;  3GI7 A;  4JLC A;  2X3X A;  4EZS A;  4JWE A;  4EZW A;  1OA1 A;  5E84 A;  2OZN B;  4EZO A;  2Z8Y A;  2FYV A;  3BLB A;  3BUQ A;  3RV1 A;  1OAO A;  3DPO A;  3A98 A;  3D2F A;  2PY6 A;  3CAZ A;  1HXK A;  2GA9 D;  3KAV A;  4DYL A;  3DX2 A;  2QFF A;  4EZP A;  3I01 A;  2YL9 A;  4AZC B;  1I4T A;  4WV7 A;  4EZT A;  3DDG A;  1GNL A;  3RPM A;  4PO2 A;  4IWP A;  3BUP A;  2QKW A;  3O3N B;  4JNE A;  3DPQ A;  1X04 A;  3EJQ A;  2KHO A;  3VEB A;  4NQI A;  4I1Q A;  3ER9 B;  3C7N B;  2F18 A;  1E2U A;  4KIK B;  3D51 A;  2Z0O A;  2OO2 A;  3CVR A;  2X3V A;  3EJT A;  4H6I A;  1QWU A;  3KAW A;  4ILG A;  2YIV X;  5C5B A;  1HTY A;  2X3W A;  4HY9 A;  1R33 A;  4DCN C;  3N8E A;  3B51 X;  3CZS A;  3I39 X;  1QX1 A;  3BVV A;  3ERC C;  2LXY A;  3CKD A;  2OBL A;  2GAF D;  4JWI A;  7HSC A;  4HR1 A;  4IM2 A;  3BUI A;  4FM3 A;  4EZZ A;  4EZU A;  3SBT B;  3HAI A;  3ZED A;  1U00 A;  4AZI A;  2WIN M;  4AZG A;  1GNT A;  2MI7 A;  3L3O M;  2YL5 A;  3L3P A;  3B53 X;  4WV5 A;  1TQW A;  2RT6 A;  3BVU A;  3T4A G;  2ND0 A;  3HAH A;  4R5J A;  1R34 A;  1URU A;  1R5E A;  3QA8 A;  4FZP A;  4MQD A;  3EJS A;  2OBM A;  4AZC A;  2N3K A;  2F7Q A;  3LLL A;  1DKY A;  1SU8 A;  3BUD A;  4G6Q A;  3G9G A;  2RAI A;  3VEA A;  4M0M A;  4JNF A;  4WPE A;  1WDZ A;  3O3O B;  3DX0 A;  2LM0 A;  2ZXQ A;  3ER8 C;  4EZQ A;  1GN9 A;  3QE6 A;  5FIG A;  4ATM A;  4JN4 A;  2EX3 B;  4ILH B;  2YIB A;  3C7N A;  2OW6 A;  2GF4 A;  4JWC A;  4KIK A;  2YL6 A;  3CV5 A;  4H6H A;  2F7R A;  1X03 A;  1E9V A;  4AZH A;  2WYI A;  4WPC A;  4EZX A;  4ILI A;  2EWF A;  5FLE X;  3ZEF A;  3SOG A;  3H0X A;  2YKT A;  4R5K A;  5TKY A;  4B9Q A;  1TQT A;  1UPX A;  3D4Z A;  1E1D A;  5KBP A;  3DX3 A;  3DPP A;  4HYB A;  3QNI A;  2ALW A;  1Q5L A;  4R5G A;  4EZV A;  2YI9 A;  3D2E A;  3Q0K A;  1W9M A;  3SYV A;  3T48 A;  1DKZ A;  3SBS A;  2F1B A;  1I49 A;  3I04 A;  1SU7 A;  3EJR A;  3CZN A;  3KDR A;  3LVT A;  4D8J A;  2YLL A;  2C08 A;  2EFL A;  1TQU A;  3ABH A;  3D50 A;  4FZS A;  1PS3 A;  2F7P A;  4E3C A;  3ACO A;  1ZYL A;  2PMR A;  3DX1 A;  3OK8 A;  3Q84 A;  4EZY A;  1O7D C;  1QWN A;  3T49 A; 
#chains in the Genus database with same CATH homology
 1GN9 A;  4E81 A;  4EZN A;  1MJG A;  2ND1 A;  1E2U A;  4UDY X;  4KIK B;  4UDX X;  5FIG A;  2X5C A;  4F01 A;  4F00 A;  4JN4 A;  3RV0 A;  2EX3 B;  4ILH B;  4IM3 A;  2QXL A;  3T46 A;  2YIB A;  3C7N A;  4H6I A;  4KIK A;  4JWC A;  2BPR A;  4NPH A;  3KAW A;  1SUF A;  4ILG A;  2NCZ A;  2YIV X;  1SU6 A;  4H6H A;  4IM0 A;  4HY9 A;  3N8E A;  2JNS A;  1OA0 A;  4IW0 A;  1E9V A;  4I43 A;  3B51 X;  3I39 X;  4EZX A;  3B52 X;  3OHX M;  4ILI A;  4HR1 B;  3UIT A;  3ERC C;  1BPR A;  1CKR A;  4R5I A;  2EWF A;  3T47 A;  5FLE X;  2OBL A;  2GAF D;  4JWI A;  7HSC A;  3ZEF A;  3GI7 A;  4JLC A;  4HR1 A;  4EZS A;  4IM2 A;  4JWE A;  4FM3 A;  4EZZ A;  4EZU A;  4R5K A;  5TKY A;  3H0X A;  4EZW A;  1OA1 A;  5E84 A;  4B9Q A;  3SBT B;  1JQK A;  3OWG A;  1UPX A;  3DOB A;  3ZED A;  4EZR A;  4EZO A;  4FL9 A;  2Z8Y A;  1U00 A;  2WIN M;  1E1D A;  1GNT A;  3LMF A;  2V7Y A;  3DPP A;  4R5L A;  4HYB A;  3RV1 A;  1DG4 A;  2YI8 A;  3L3O M;  1OAO A;  3DPO A;  1Q5L A;  4R5G A;  3A98 A;  4EZV A;  3D2F A;  2YI9 A;  2YIA A;  3D2E A;  3B53 X;  3VKH A;  4WV5 A;  2RT6 A;  2PY6 A;  4IWO A;  1W9M A;  3T4A G;  2GA9 D;  3T48 A;  3KAV A;  2ND0 A;  1DKZ A;  4EZP A;  2QFF A;  3SBS A;  3I01 A;  3I04 A;  4WV7 A;  4R5J A;  1SU7 A;  4EZT A;  3KDR A;  4D8J A;  1GNL A;  3QA8 A;  4PO2 A;  4MQD A;  2OBM A;  4IWP A;  2N3K A;  1DKY A;  3O3M B;  4E3C A;  3F7W A;  1ZYL A;  3O3N B;  1YUW A;  3DQG A;  1DKX A;  2OP6 A;  1SU8 A;  4G6Q A;  4IWQ A;  4JNE A;  3VEA A;  3DPQ A;  4M0M A;  4JL9 A;  4JNF A;  4EZY A;  3QNJ A;  4JWD A;  3O3O B;  2KHO A;  3VEB A;  2LM0 A;  3ER8 C;  3T49 A;  4EZQ A;  3FD9 A;  3C7N B;  3ER9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...