4HYBA

Crystal structure of the substrate binding domain of e.coli dnak in complex with pyrrhocoricin_lyzi (residues 1 to 10)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
213
structure length
213
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone, peptide binding protein
total genus 62
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4hybA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4hybA01
2QFFA 4JNEA 4EZZA 4R5KA 3DQGA 4JNFA 3T46A 3D2EA 4HYBA 1Q5LA 4EZQA 3C7NB 1CKRA 4JWIA 4EZVA 2OP6A 2WINM 2KHOA 3DPQA 4HY9A 3T49A 4EZSA 4EZOA 4JWCA 4R5GA 1BPRA 4EZRA 3DOBA 3N8EA 2V7YA 4F01A 4R5IA 5TKYA 4EZNA 1U00A 5E84A 4PO2A 3L3OM 4E81A 1DKYA 3C7NA 3DPPA 4B9QA 1YUWA 3D2FA 4EZWA 4WV5A 1DG4A 4H6IA 2BPRA 4H6HA 7HSCA 4JWDA 3T4AG 4JN4A 3DPOA 3QNJA 4FL9A 4JWEA 4EZPA 4EZUA 4R5LA 3OHXM 3T48A 4EZYA 4WV7A 4EZXA 4F00A 4EZTA 3T47A 2QXLA 1DKZA 3H0XA 4R5JA 1DKXA
chains in the Genus database with same CATH superfamily
3O3OB 4WPCA 2KHOA 3DPQA 4NPHA 3QNIA 3HAHA 3L3PA 3DOBA 2YI9A 2X5CA 2MI7A 4PO2A 1UPXA 2N3KA 4JWDA 3DDGA 3EJRA 4WPEA 4F00A 4AZHA 3T47A 3DDFA 4ATMA 4EZZA 1TQTA 1SU7A 4H8SA 4R5GA 3M3WA 1X04A 4AZBA 4FM3A 4ILHB 1E2UA 3A98A 1W9MA 2LXYA 4KIKB 4JN4A 3DPOA 1CKRA 4EZXA 2FYVA 3I01A 2O0I1 3H0XA 1OA1A 1QWNA 4R5KA 3D2EA 4IM3A 2X3VA 3D50A 3Q84A 1QWUA 3OK8A 1GNTA 2OO2A 4H6HA 2GA9D 4EZYA 3UITA 1O7DC 4NQIA 3BUQA 3DQGA 3SBTB 3O3NB 1Q5LA 3LVTA 2QKWA 1TQUA 4AZ7A 3QE6A 5C5BB 3ERCC 3B53X 3B52X 2V7YA 3O3MB 4EZNA 3CVRA 3RV1A 2GF4A 4AVMA 3D51A 1PS3A 3SYVA 3OHXM 3VKHA 2EWFA 3BVUA 3I2WA 3BUBA 2Z0VA 1I4LA 3BVXA 3I39X 2JNSA 1LQ7A 4D8JA 5E84A 4AKVA 2F7QA 4G6QA 4EZWA 4WV5A 1OAOA 4FL9A 3BVTA 3BVWA 3RV0A 1URUA 5KBPA 3BVVA 4ILIA 2WYIA 4HY9A 2Z0NA 3EJSA 4EZOA 3SBSA 3D4ZA 2ELBA 3ER8C 5C5BA 1DG4A 4H6IA 2V0OA 1HTYA 3I04A 5FLEX 4AZIA 3HAIA 1DKYA 3BUDA 4HR1A 2F7RA 3LLLA 3C7NB 3EJTA 2Z8YA 4IWPA 2YLLA 1SUFA 4ILGA 4FZPA 2OBLA 3GI7A 1I49A 4R5LA 4IW0A 4EZTA 1I4TA 3ABHA 4JNFA 3DX0A 2EFLA 3D52A 4EZSA 3D4YA 2YI8A 3BUPA 4E81A 4UDXX 3ACOA 3CAZA 3QA8A 1R34A 3ER9B 3RPMA 3CZSA 1Y2OA 3PLTA 2OBMA 1MJGA 4JLCA 2RAIA 4DCNC 2WYHA 2F1BA 4FZSA 1GN9A 3C7NA 3Q0KA 1JQKA 1TQWA 3CZNA 3QNJA 4EZPA 3T48A 1QX1A 2C08A 1SU6A 3CKDA 4IM0A 2YIAA 4M0MA 2GAFD 4KIKA 3T49A 1HWWA 1ZWWA 1TQVA 4I43A 4IWOA 2BPRA 2YKTA 4B9QA 4FZOA 4IWQA 2PMRA 3T46A 4JWIA 2OP6A 3VEBA 4AZ5A 4E3CA 4AZ6A 3HAJA 4NSWA 4MQDA 4R5IA 2EFKA 2X3WA 3QWEA 3G9GA 7HSCA 1YWMA 3T4AG 3B51X 3EJPA 4HYBA 4DYLA 3BUIA 2F18A 2ND0A 2YIBA 4AZCB 2YLAA 1ZYLA 2D1LA 3FD9A 2F7PA 2F1AA 2YL9A 5TKYA 3DX3A 2FICA 3EJUA 5FIGA 4EZUA 3SOGA 4R5JA 4JNEA 3KAVA 3F7WA 2JNKA 4EZQA 3BLBA 2YL8A 3KAWA 4JWCA 1BPRA 1R33A 1E9VA 1I4DA 3L3OM 3DPPA 1YUWA 3D2FA 1E1DA 2EX3B 2Q12A 3DX2A 2Z0OA 2QXLA 1DKZA 1WDZA 2QFFA 2RAJA 2ND1A 4EZVA 2YL5A 1GNLA 3N8EA 4F01A 2Q13A 2YIVX 4AZCA 4AZGA 3ZEFA 3ZEDA 4UDYX 4I1QA 3KDRA 2OW6A 2D4CA 4JL9A 2RAKA 3CV5A 2OZNB 3VEAA 2OW7A 2NCZA 4HR1B 1U00A 2YL6A 2PY6A 3EJQA 4WV7A 1O7DB 1X03A 2ZXQA 3OWGA 2F7OA 2X3XA 2WINM 3DYTA 1OA0A 3DX4A 4IM2A 1TQSA 2RT6A 4EZRA 4BNEA 2ALWA 1HXKA 3LMFA 4JWEA 1SU8A 1R5EA 3DX1A 2LM0A 1DKXA
chains in the Genus database with same CATH topology
4JNEA 3KAVA 3F7WA 2OBMA 4EZQA 1MJGA 3O3OB 2KHOA 3DPQA 4JLCA 4NPHA 3I39X 2JNSA 3KAWA 4JWCA 1BPRA 1E9VA 3DOBA 2YI9A 2X5CA 4D8JA 5E84A 1GN9A 3L3OM 4PO2A 3C7NA 3DPPA 1UPXA 4G6QA 1JQKA 2N3KA 3D2FA 4EZWA 1YUWA 4WV5A 1OAOA 1E1DA 2EX3B 4JWDA 3QNJA 4FL9A 4EZPA 3T48A 4F00A 3RV0A 3T47A 1SU6A 2QXLA 1DKZA 4IM0A 2YIAA 2QFFA 4EZZA 4M0MA 2GAFD 4ILIA 2ND1A 4EZVA 1SU7A 4HY9A 4KIKA 3T49A 1GNLA 4EZOA 4R5GA 3SBSA 3N8EA 4F01A 4FM3A 2YIVX 4I43A 3ER8C 4ILHB 1E2UA 3A98A 1W9MA 3ZEFA 1DG4A 4H6IA 4IWOA 4KIKB 2BPRA 3I04A 4JN4A 3DPOA 1CKRA 3ZEDA 4EZXA 5FLEX 3I01A 4B9QA 4UDYX 3H0XA 1DKYA 1OA1A 4HR1A 4IWQA 4R5KA 3KDRA 3T46A 3D2EA 3C7NB 4IM3A 4JWIA 2Z8YA 2OP6A 4JL9A 3VEBA 4IWPA 4E3CA 3VEAA 2NCZA 4MQDA 1SUFA 4ILGA 4R5IA 4HR1B 1U00A 1GNTA 4H6HA 7HSCA 2PY6A 3T4AG 2GA9D 2OBLA 3GI7A 4EZYA 4R5LA 4IW0A 4WV7A 4EZTA 3B51X 3UITA 3OWGA 3DQGA 3SBTB 4JNFA 3O3NB 4HYBA 1Q5LA 2ND0A 2WINM 2YIBA 3ERCC 3B53X 4EZSA 1ZYLA 3B52X 1OA0A 3FD9A 4IM2A 2RT6A 4EZRA 2YI8A 2V7YA 3O3MB 5TKYA 4EZNA 4E81A 3RV1A 4UDXX 3QA8A 5FIGA 3LMFA 4JWEA 4EZUA 3OHXM 1SU8A 3VKHA 2EWFA 3ER9B 2LM0A 4R5JA 1DKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QFF A;  4JNE A;  4EZZ A;  4R5K A;  3DQG A;  4JNF A;  3T46 A;  3D2E A;  4HYB A;  1Q5L A;  4EZQ A;  3C7N B;  1CKR A;  4JWI A;  4EZV A;  2OP6 A;  2WIN M;  2KHO A;  3DPQ A;  4HY9 A;  3T49 A;  4EZS A;  4EZO A;  4JWC A;  4R5G A;  1BPR A;  4EZR A;  3DOB A;  3N8E A;  2V7Y A;  4F01 A;  4R5I A;  5TKY A;  4EZN A;  1U00 A;  5E84 A;  4PO2 A;  3L3O M;  4E81 A;  1DKY A;  3C7N A;  3DPP A;  4B9Q A;  1YUW A;  3D2F A;  4EZW A;  4WV5 A;  1DG4 A;  4H6I A;  2BPR A;  4H6H A;  7HSC A;  4JWD A;  3T4A G;  4JN4 A;  3DPO A;  3QNJ A;  4FL9 A;  4JWE A;  4EZP A;  4EZU A;  4R5L A;  3OHX M;  3T48 A;  4EZY A;  4WV7 A;  4EZX A;  4F00 A;  4EZT A;  3T47 A;  2QXL A;  1DKZ A;  3H0X A;  4R5J A;  1DKX A; 
#chains in the Genus database with same CATH topology
 3O3O B;  4WPC A;  2KHO A;  3DPQ A;  4NPH A;  3QNI A;  3HAH A;  3L3P A;  3DOB A;  2YI9 A;  2X5C A;  2MI7 A;  4PO2 A;  1UPX A;  2N3K A;  4JWD A;  3DDG A;  3EJR A;  4WPE A;  4F00 A;  4AZH A;  3T47 A;  3DDF A;  4ATM A;  4EZZ A;  1TQT A;  1SU7 A;  4H8S A;  4R5G A;  3M3W A;  1X04 A;  4AZB A;  4FM3 A;  4ILH B;  1E2U A;  3A98 A;  1W9M A;  2LXY A;  4KIK B;  4JN4 A;  3DPO A;  1CKR A;  4EZX A;  2FYV A;  3I01 A;  2O0I 1;  3H0X A;  1OA1 A;  1QWN A;  4R5K A;  3D2E A;  4IM3 A;  2X3V A;  3D50 A;  3Q84 A;  1QWU A;  3OK8 A;  1GNT A;  2OO2 A;  4H6H A;  2GA9 D;  4EZY A;  3UIT A;  1O7D C;  4NQI A;  3BUQ A;  3DQG A;  3SBT B;  3O3N B;  1Q5L A;  3LVT A;  2QKW A;  1TQU A;  4AZ7 A;  3QE6 A;  5C5B B;  3ERC C;  3B53 X;  3B52 X;  2V7Y A;  3O3M B;  4EZN A;  3CVR A;  3RV1 A;  2GF4 A;  4AVM A;  3D51 A;  1PS3 A;  3SYV A;  3OHX M;  3VKH A;  2EWF A;  3BVU A;  3I2W A;  3BUB A;  2Z0V A;  1I4L A;  3BVX A;  3I39 X;  2JNS A;  1LQ7 A;  4D8J A;  5E84 A;  4AKV A;  2F7Q A;  4G6Q A;  4EZW A;  4WV5 A;  1OAO A;  4FL9 A;  3BVT A;  3BVW A;  3RV0 A;  1URU A;  5KBP A;  3BVV A;  4ILI A;  2WYI A;  4HY9 A;  2Z0N A;  3EJS A;  4EZO A;  3SBS A;  3D4Z A;  2ELB A;  3ER8 C;  5C5B A;  1DG4 A;  4H6I A;  2V0O A;  1HTY A;  3I04 A;  5FLE X;  4AZI A;  3HAI A;  1DKY A;  3BUD A;  4HR1 A;  2F7R A;  3LLL A;  3C7N B;  3EJT A;  2Z8Y A;  4IWP A;  2YLL A;  1SUF A;  4ILG A;  4FZP A;  2OBL A;  3GI7 A;  1I49 A;  4R5L A;  4IW0 A;  4EZT A;  1I4T A;  3ABH A;  4JNF A;  3DX0 A;  2EFL A;  3D52 A;  4EZS A;  3D4Y A;  2YI8 A;  3BUP A;  4E81 A;  4UDX X;  3ACO A;  3CAZ A;  3QA8 A;  1R34 A;  3ER9 B;  3RPM A;  3CZS A;  1Y2O A;  3PLT A;  2OBM A;  1MJG A;  4JLC A;  2RAI A;  4DCN C;  2WYH A;  2F1B A;  4FZS A;  1GN9 A;  3C7N A;  3Q0K A;  1JQK A;  1TQW A;  3CZN A;  3QNJ A;  4EZP A;  3T48 A;  1QX1 A;  2C08 A;  1SU6 A;  3CKD A;  4IM0 A;  2YIA A;  4M0M A;  2GAF D;  4KIK A;  3T49 A;  1HWW A;  1ZWW A;  1TQV A;  4I43 A;  4IWO A;  2BPR A;  2YKT A;  4B9Q A;  4FZO A;  4IWQ A;  2PMR A;  3T46 A;  4JWI A;  2OP6 A;  3VEB A;  4AZ5 A;  4E3C A;  4AZ6 A;  3HAJ A;  4NSW A;  4MQD A;  4R5I A;  2EFK A;  2X3W A;  3QWE A;  3G9G A;  7HSC A;  1YWM A;  3T4A G;  3B51 X;  3EJP A;  4HYB A;  4DYL A;  3BUI A;  2F18 A;  2ND0 A;  2YIB A;  4AZC B;  2YLA A;  1ZYL A;  2D1L A;  3FD9 A;  2F7P A;  2F1A A;  2YL9 A;  5TKY A;  3DX3 A;  2FIC A;  3EJU A;  5FIG A;  4EZU A;  3SOG A;  4R5J A;  4JNE A;  3KAV A;  3F7W A;  2JNK A;  4EZQ A;  3BLB A;  2YL8 A;  3KAW A;  4JWC A;  1BPR A;  1R33 A;  1E9V A;  1I4D A;  3L3O M;  3DPP A;  1YUW A;  3D2F A;  1E1D A;  2EX3 B;  2Q12 A;  3DX2 A;  2Z0O A;  2QXL A;  1DKZ A;  1WDZ A;  2QFF A;  2RAJ A;  2ND1 A;  4EZV A;  2YL5 A;  1GNL A;  3N8E A;  4F01 A;  2Q13 A;  2YIV X;  4AZC A;  4AZG A;  3ZEF A;  3ZED A;  4UDY X;  4I1Q A;  3KDR A;  2OW6 A;  2D4C A;  4JL9 A;  2RAK A;  3CV5 A;  2OZN B;  3VEA A;  2OW7 A;  2NCZ A;  4HR1 B;  1U00 A;  2YL6 A;  2PY6 A;  3EJQ A;  4WV7 A;  1O7D B;  1X03 A;  2ZXQ A;  3OWG A;  2F7O A;  2X3X A;  2WIN M;  3DYT A;  1OA0 A;  3DX4 A;  4IM2 A;  1TQS A;  2RT6 A;  4EZR A;  4BNE A;  2ALW A;  1HXK A;  3LMF A;  4JWE A;  1SU8 A;  1R5E A;  3DX1 A;  2LM0 A;  1DKX A; 
#chains in the Genus database with same CATH homology
 4JNE A;  3KAV A;  3F7W A;  2OBM A;  4EZQ A;  1MJG A;  3O3O B;  2KHO A;  3DPQ A;  4JLC A;  4NPH A;  3I39 X;  2JNS A;  3KAW A;  4JWC A;  1BPR A;  1E9V A;  3DOB A;  2YI9 A;  2X5C A;  4D8J A;  5E84 A;  1GN9 A;  3L3O M;  4PO2 A;  3C7N A;  3DPP A;  1UPX A;  4G6Q A;  1JQK A;  2N3K A;  3D2F A;  4EZW A;  1YUW A;  4WV5 A;  1OAO A;  1E1D A;  2EX3 B;  4JWD A;  3QNJ A;  4FL9 A;  4EZP A;  3T48 A;  4F00 A;  3RV0 A;  3T47 A;  1SU6 A;  2QXL A;  1DKZ A;  4IM0 A;  2YIA A;  2QFF A;  4EZZ A;  4M0M A;  2GAF D;  4ILI A;  2ND1 A;  4EZV A;  1SU7 A;  4HY9 A;  4KIK A;  3T49 A;  1GNL A;  4EZO A;  4R5G A;  3SBS A;  3N8E A;  4F01 A;  4FM3 A;  2YIV X;  4I43 A;  3ER8 C;  4ILH B;  1E2U A;  3A98 A;  1W9M A;  3ZEF A;  1DG4 A;  4H6I A;  4IWO A;  4KIK B;  2BPR A;  3I04 A;  4JN4 A;  3DPO A;  1CKR A;  3ZED A;  4EZX A;  5FLE X;  3I01 A;  4B9Q A;  4UDY X;  3H0X A;  1DKY A;  1OA1 A;  4HR1 A;  4IWQ A;  4R5K A;  3KDR A;  3T46 A;  3D2E A;  3C7N B;  4IM3 A;  4JWI A;  2Z8Y A;  2OP6 A;  4JL9 A;  3VEB A;  4IWP A;  4E3C A;  3VEA A;  2NCZ A;  4MQD A;  1SUF A;  4ILG A;  4R5I A;  4HR1 B;  1U00 A;  1GNT A;  4H6H A;  7HSC A;  2PY6 A;  3T4A G;  2GA9 D;  2OBL A;  3GI7 A;  4EZY A;  4R5L A;  4IW0 A;  4WV7 A;  4EZT A;  3B51 X;  3UIT A;  3OWG A;  3DQG A;  3SBT B;  4JNF A;  3O3N B;  4HYB A;  1Q5L A;  2ND0 A;  2WIN M;  2YIB A;  3ERC C;  3B53 X;  4EZS A;  1ZYL A;  3B52 X;  1OA0 A;  3FD9 A;  4IM2 A;  2RT6 A;  4EZR A;  2YI8 A;  2V7Y A;  3O3M B;  5TKY A;  4EZN A;  4E81 A;  3RV1 A;  4UDX X;  3QA8 A;  5FIG A;  3LMF A;  4JWE A;  4EZU A;  3OHX M;  1SU8 A;  3VKH A;  2EWF A;  3ER9 B;  2LM0 A;  4R5J A;  1DKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...