4ILIA

Crystal structure of an aar2p s253e phosphomimetic mutant protein
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
304
structure length
290
Chain Sequence
NTVPFTSAPIEVTIGIDQYSFNVKENQPFHGIKDIPIGHVHVIHFQHADNSSMRYGYWFDCRMGNFYIQYDPKDGLYKMMEERDGAKFENIVHNFKERQMMVSYPKIDEDDTWYNLTEFVQMDKIRKIVRKDENQFSYVDSSMTTVQENELSSSSSDPAHSLNYTVINFKSDKSYYLNTVMLQGIFKNSSNYFGELQFAFLNAMFFGNYGSSLQWHAMIELICSEATVPKHMLDKLDEILYYQIKTLPEQYSDILLNERVWNICLYSSFQKNSLHNTEKIMENKYPELLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for dual roles of Aar2p in U5 snRNP assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Splicing
molecule keywords A1 cistron-splicing factor AAR2
total genus 75
structure length 290
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.550 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4iliA02
2.60.34.20 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4iliA01
3ZEFA 4I43A 4ILIA 3SBTB 4ILHB 3SBSA 4ILGA
chains in the Genus database with same CATH superfamily
2HE0A 2AVPA 2X6FA 2CHZA 2L6BA 4CDNA 2FEZA 1OCOE 4GMJA 4A63B 2H6IA 5D0QD 4HXIA 3PS6A 4JWCA 1HE8A 4KVMA 3UINC 4PS3A 1TNOA 1MQSA 3TGOA 4J0UA 1OWMA 2XHEA 5G2NA 3C98A 2CG3A 5EIDA 2IONA 1DNPA 4ILGA 4F3VA 3KD7A 3ASNE 4D10C 2L0TB 4FJZA 4N5CA 2LSUA 2F0YA 5ENPD 2VQ2A 5CRUA 3ASOE 1QZ2A 3GZ2A 2XQ0A 2OVFA 4UQYA 4H7YA 2DIWA 4UWFA 3CVNA 1TR4A 2IJGX 2LSVA 5LOZA 2WQ6A 2GW1A 3LS8A 4EZLA 5AQAA 5ENRD 1U00A 3RU0A 4TUMA 4FP7A 2I1JA 4F1PA 1U2VG 4KZ0A 1Z3YA 1H2TC 4DJAA 3FTYA 1WG0A 3DOBA 4BETA 5AQBA 2OCCE 4TUUA 2LUHA 5KJNA 5BNWA 1Y6IA 5FJYA 5AIJA 3LDZA 1IQRA 3FUEA 3SY2A 3SFYA 4R5JA 2C2LA 2VSXE 3Q7FA 2XENA 1FCHA 4GZ3A 2QY7A 1N11A 4J8EA 4MS6A 5B3SE 2GRNB 3CLJA 2A5UA 4JHKA 3CHRA 5LFAA 3ZN3A 3PEVB 3I5PA 4WNFA 4KYOB 3H0XA 1UJKA 3ENEA 1OCZE 5ENNA 4N2SA 2PL2A 3B13A 3UIPC 3DSWA 3FDHA 4PO2A 2DWZA 2FF4A 4NIKA 1NP7A 1JCSA 1B89A 2V4HC 4JWIA 4YDOA 4L23A 4GZDA 3MA5A 2CHXA 4BFRA 2QFCA 2WXMA 3UTMA 1EDUA 3HXBA 4JC8A 3SHFA 2J4DA 1OWOA 4YDEA 2IOSA 4GTRA 4AP2A 1QNFA 3PRZA 4GZ5A 2PM6A 1W3BA 1XNFA 4OAVB 1OCCE 3ZHEA 4BSZB 2WXHA 5CEAA 5BW8C 2GRRB 3TWRA 4GCOA 1WAO1 1E90A 3CQGB 3FTSA 5KBAA 2XEHA 1IHGA 3CVPA 4Q96A 3T9KA 4FADA 1MYOA 1SZAA 4JPSA 1NA0A 1JUQA 4I6JA 5ENSD 3APCA 4L7TA 5TKYA 1TN8A 3FTWA 4ME2A 1N4QA 3VLDA 3RIBA 4LNUD 3MX3A 4N2QA 2KC7A 1MHQA 3HG0D 2IEJA 1TJFA 2B0OE 2RG8A 4K5BA 3TG5A 3B7BA 3R7RA 3MJWA 4EZKA 2KM4A 1JPLA 4DLOA 5KCMA 5EDSA 3OXGA 3ASGA 4F53A 5LCWJ 4A1SA 4C48B 2PM7A 4ILIA 2WQ7A 4XIFA 2XEEA 3AS5A 1K1BA 1U3CA 3RKVA 1BLXB 2WXLA 3DEPA 3PVLA 2XZDG 2GGFA 3NF1A 3DRAA 1MX4A 5EYLA 3LPZA 3VTXA 3DQGA 1Q2ZA 2KATA 5HI7A 4GYYA 2IOLA 1BPOA 1IXVA 3UIOC 2V5QC 4DPRA 2VGXB 4EZTA 3UMVA 3BG1B 3Q15A 2BF0X 2I9CA 3TWTA 5J08A 4U96D 2DYSE 3ULEG 2DYRE 4JWEA 2X3MA 3LKUA 3GYZA 3C72A 4O1OA 3CKBA 2WPVA 4F7AA 5HS0A 1ZU2A 3E34A 4G2VA 1N4SA 4R5IA 1E8XA 4I1AA 3BQOA 1HG2A 4GTPA 4JA9A 3I4RB 3CKCA 3UM3A 4FC8A 5AYWD 5HQ8A 1DCQA 4BSXA 4RQIA 3QWWA 3CSFA 4KXKB 2AXUA 1NZNA 3CK8A 5KNGA 4GZ6A 2V4LA 4NRHB 4GTSA 5AJDA 4HLLA 5EN5D 1BI8B 3MZLB 5JHAA 4HRNA 4EZJA 2EQXA 3APFA 4Q69A 2BTDA 3B7SA 3FUJA 4EPZA 3D9HA 1S63A 2UY1A 1NFIE 2HYZA 5G04C 1FVHA 1PY1A 4DX6D 1O1SA 3G2VA 5BXUA 4G24A 5E75A 4AVXA 2P9PG 1X5BA 1N0QA 4A55A 3SNXA 3HDXA 3Q79A 2VGXA 4AEZC 3C7NB 3EDTB 1ZB1A 4U95D 1JWFA 3FU6A 3CHPA 3I3NA 3PZ1A 3ZRHA 2XPZA 3B7UX 1SVXA 1WM5A 2R17C 4B0ZA 2YHEA 2C0MA 3PZDA 1YYHA 5KWDA 2GRLA 4JXTA 2ONDA 5J90A 2XRZA 3FUNA 5CBNA 4GTTA 3CVWA 4UWGA 4U0SA 2NC9A 4NURA 3FFLA 4N39A 3G2WA 2WXKA 3TG4A 3LEWA 4FHKA 3UM0A 5BV1A 5BV0A 1S70B 3G2TA 3FTZA 4J6IA 4CT4A 2KHOA 2Y4TA 1UJJA 2UWJG 3SI5A 2XCBA 2P58C 4ACLA 3Q5MA 3N71A 4J8FA 2VGEA 2LAIA 2I2OA 3QC1A 3K9IA 3AS8A 4HBDA 5A6CA 3L13A 2WQHA 3TJPA 4TXRA 3D2EA 5FQ8A 4WWOA 3C3RA 4G8LA 4TXPA 1S64A 2DBAA 4HI8A 3V31A 3L16A 4C9BB 5BUZA 3EHMA 5AQ9A 1BD8A 4JL0A 4N3AA 4U8HA 4YDYA 2MHKA 3SQVA 3QARA 2WMNA 4KMOA 4JWDA 4YVOA 4E6HA 4JEHA 3JCKC 5C2YA 3LY9A 4G25A 1E8WA 4XEIG 4CDMA 2H6FA 2A4ZA 2NXPA 3PEUB 4AOFA 3DWLG 5A23A 1HH8A 3ZUVB 4JN4A 1ELKA 5FQ4A 3OXLA 3NZUA 4GU5A 1L5JA 1Q5LA 1HFAA 5G05C 3CR3A 3C3OA 3LY7A 4EZPA 4WNGA 3JUEA 2KCLA 2QYUA 4HQDA 4JD2G 5EX3A 4GTMA 4XX5A 2KZTB 2Y69E 2PQRA 3D2FA 4PS7A 1TNYA 4IN3B 2OEVA 2XPIA 4DX1A 2X6JA 1DKXA 3OXFA 2E2EA 3KEAA 3SFXA 4APOA 1K1AA 2F37A 1AP7A 2QXLA 3HVEA 3TAXA 4EZOA 4NQ0A 5CRVA 3FTUA 4GMLA 2GRPB 3D3MA 3E33A 4F00A 5ANLA 5KNHD 1Z6TA 2J09A 2VGYA 3UM2A 3MKQA 4C0MA 3JXJA 4MKTA 4DI3A 2P9SG 4I17A 2V5FA 3B95A 3JQ1A 4GA1A 4ZHBA 2PNNA 3ESKA 4XI0A 3CHSA 4EECA 3HXCA 3S7DA 3ZNGA 2ZGGA 4ANWA 4B94A 5DBKA 4P29A 5JMND 3S7BA 2NSZA 4I1OB 3ASDA 5JHBA 1A17A 3QB2A 4G1TA 5G04J 2I6HA 3T8MA 4ZFHA 1OY3D 3DPQA 4FULA 3LVRE 1HO8A 2KCKA 2AJAA 1FVFA 4CCAA 3DSXA 3C3QA 2XGOA 4IRUA 3R9AB 1YA0A 1OCRE 3ZU7B 5CBOA 3FU3A 1E7VA 4GYOA 4JHRA 4U07A 1XGWA 2V0PA 5AJLA 5CECB 1DC2A 3KEZA 4E85A 1Z3XA 4OVVA 3QKYA 5FZRA 3APDA 5CEDB 3VTYA 3TWSA 4U63A 2V7YA 4HOQA 1UW4B 4WNEA 1OUVA 2ILRA 3HHMA 3L22A 3TXNA 3IKOB 4U8VD 1ELRA 1N9AA 4BERA 3SFZA 2WXNA 4LSZE 4CYMD 1ZBPA 3J5QB 2IY0C 4GTVA 1H2UA 2A5EA 1LD8A 3CGHA 3UXGA 2OV8A 2J4BA 3IHYA 2H6GA 3U4TA 2IF4A 4A1GA 2WM9A 4BT9A 4JNEA 4CDRA 7HSCA 1YMPA 4RLYA 3UUXA 2JEKA 4FLBA 4MQDA 2AWIA 4YVQC 1KPSB 4KZCA 1TEZA 1N52A 2R03A 3DPPA 4GMRA 4HNAD 1O1RA 3ZXSA 1Y8MA 3SD5A 5CMWA 3V30A 3V79K 3CVYA 3QOUA 4GTOA 2YNQA 4Z68A 3FH8A 5LP0A 3EU5A 2XRYA 3EIQC 4HRMB 2V8SE 4I2WA 4BEPA 3JYSA 4U04A 3FUKA 4B8AA 3QK0A 4K5CA 2MOWA 1PC2A 3FH5A 5ANRA 4H7XA 2XS1A 4I2ZA 5FZQA 1HU3A 3ZEFA 5H7PA 5M72A 3FUIA 3ZHEB 3BUAA 1MZCA 3ZPJA 2BUGA 2ZIRA 1EYHA 3P2BA 3ML9A 4DX2A 4HRLA 2LXLA 2P9IG 2LO6A 2XCCA 1A5EA 1HZ4A 1INZA 3EIJA 1IQUA 3FULA 3Q9NC 3ISMC 3QJZA 3ZGQA 4K03A 3VLFA 3I4GA 1N54A 3CHMA 2VSNA 2J9QA 3HXDA 5FINA 3OTNA 2L9BA 3ONKA 3CVVA 2BPRA 5JJ6A 4R7LA 5FQ6A 2AW6A 2RD0A 4HI9A 3UQ3A 3ASFA 3LY8A 4BX9A 3DSTA 1V55E 1G3NB 3PNLB 3T8KA 3D9LA 1SW6A 4TRQA 4W9RA 5T3RA 4GYWA 1E8YA 4EBAG 4L2LA 1UOHA 1OWLA 4K0RA 3UPVA 5FQ7A 1D8DA 1EPUA 1DKYA 2GROB 3HIZA 4YDWA 5CMYA 4JZYA 1FPPA 4I43A 3ZYLA 2OVBA 3HVEB 3FEYA 4EZZA 2VYIA 3C5RA 2X6IA 3RRMB 3GZSA 4R5KA 3CVLA 3ABKE 3O48A 3Q49B 3S2AA 2ZXWE 4MLPA 3DBSA 4CEMA 2OOEA 2PQNA 3D9MA 4O6FA 4RVBA 3DPYA 5JJ7A 4LRZA 1TN6A 1DCEA 4G26A 4UQZA 4HB5A 1FT1A 2VTBA 3L82A 3OAWA 5T8IA 3LXUX 3FU0A 3L08A 3Q7AA 1YUWA 3CV0A 4CGVA 3TWUA 5IY5E 4ANUA 2EIJE 5ARFA 4LG6A 1WY6A 3FEXA 5FZSA 1OT8A 4WNDA 3ESLA 3PUJA 1H6PA 4HLEA 3PREA 4I9CA 2WXFA 1N4RA 2JABA 3HYMB 4LNGA 4YNDA 3FH7A 3SO8A 3MGBA 1H19A 1FT2A 1JCQA 1UG3A 3FUHA 3IEGA 3L17A 3DXMG 3ZW3A 1RZ4A 3RJVA 4ABNA 2IU1A 5D2MC 4JHJA 3G2SA 4AXHA 4L2YA 2FO1E 4UWKA 2YQ8A 1E96B 1KLXA 3SGHA 4XKCA 2DZNA 3CK9A 2OEWA 3FWVA 3GW4A 4GA2A 3Q47B 2AXVA 4EZNA 3Q9UC 2FI7A 2LNIA 3JQ0A 1UN8A 3FUFA 1KT1A 2F8YA 5CCLA 3CEQA 4WAFA 3WG7E 4EZSA 3S7FA 4ACKA 2QZAA 1O1TA 2AXZA 4LERA 3L6AA 3TWWA 3QAQA 1HF8A 4EQFA 1OWNA 3EJNA 1SA4A 3PZ2A 2CFZA 5JJTA 2CFUA 4GAAA 2HR2A 4U0ZA 4QQIA 4EZYA 1HG5A 2XS8A 4CGWA 4URKA 2RKKA 4F6RD 2EILE 3N8EA 2ETBA 4JW1A 2I1KA 3C7NA 5AARA 4RG9A 3MKQB 3E37A 4GTQA 2L0IA 2X6HA 4BX8A 4Q94A 3EHRA 2XGSA 3LVQE 5LX8A 3QNKA 3DEOA 5BPPA 4RSYA 2QC9A 3BEEA 2H6HA 2HO1A 4XE0A 5C1DA 3UM1A 1AWCB 4M3OA 3CSTA 4HS2A 5EIBE 4OAUC 3R9MA 3ONLA 1DG4A 5HRYA 4JVSA 3EU9A 2R02A 2Y3AA 4J8YA 4WUYA 4U7EB 2X6KA 4AIFA 1LF8A 5BXOA 3ZYMA 4UWLA 3NB2A 1MX2A 2BKGA 4EHMA 4U8YD 4UI9K 2FBNA 4PS8A 4GA0A 3RAUA 4N5QA 3RO2A 1TNBA 1TYQG 3FY4A 5ENTD 1BI7B 2C0LA 5KJLA 1NI1A 3IBEA 4ATGA 3PE3A 3UT4A 3L9TA 4UI9C 2KXPC 3NOGD 3D9PA 5A7DB 4PH4B 1GW6A 1HX8A 3T5VA 3CK7A 4ATZD 4EZUA 5EYPF 3NOCD 3CIAA 2RFAA 4TV3A 3PH0C 2R59A 1JCRA 4ANVA 3ZFWA 2BKKB 4IYPA 3CHQA 4F1SA 1V54E 4E81A 4HOUA 2M63A 2MYOA 1SZ9A 4OVUA 5ARGA 4I9EA 1IHBA 1D8EA 4TXQA 4CRWA 3HXEA 1NL4A 4AM9A 1TNZA 1YCSB 4UWHA 2VSOE 2B6CA 4F01A 4C0EA 5EILA 2XZTG 1H6OA 2KBXA 4GZCA 3AAAC 3AG3E 3J5PA 4B93B 4EZRA 3ABME 1Z5SC 2MRIA 3ZYKA 3EHNA 2WXGA 1TN7A 2VJ8A 4HFGA 1UN9A 4QFVA 3Q73A 2J07A 3ZYQA 1H0AA 1WDYA 4A3VA 3MV3B 3S7JA 2JLBA 4HVBA 4JEUA 2P9LG 4EZWA 1N94A 3P1UA 4GCNA 3DSVA 3JXIA 4BTAA 3GZ1A 3D9OA 1KT0A 4ANXA 5AN8A 5EKQD 5T4YA 4EZVA 3PNTB 4JB8P 2ETCA 5E76A 4MRUA 3KS2A 4V3IA 3ASHA 1JWGA 2FO7A 3PUKA 2ZISA 2J8SD 4HYBA 4RG6A 3NQPA 1D9SA 2F8XK 1MX6A 5FIOA 3D9IA 4DK5A 4G8KA 4L1BA 3UI2A 3D9NA 3MEKA 4J8SA 5KJKA 4XZ4A 2NYJA 3O4ZA 4PDXA 3FP3A 1KZPA 1DKZA 3WXXA 5D66A 4WV7A 1ELWA 3ULYA 5FWQA 4KBQA 4XI9A 3ZXPA 2HM8A 1X81A 4FHJA 4AJWA 4J8DA 4MBGA 5CERB 4LEUA 4DLQA 3QWVA 4B9QA 3EHQA 2P2CP 2YHCA 4N3BA 4I6EA 1EF1C 4EZQA 1OXJA 2ETAA 1N0RA 2BEDA 3AU5A 5ENOD 4BWRA 2J49A 4PUCA 1E8ZA 2DCPA 3IXEA 5EX0A 4WWPA 3G2UA 1SQMA 2DVWA 3UKRG 2R5SA 3NAWA 4FLHA 2FULA 1BU9A 3SBSA 1MJ0A 2X38A 5FTPA 3AG4E 3FUMA 3PZ3A 2CHWA 2XGMA 4WWNA 3U9WA 5AAOA 2VSYA 3TXMA 4BT8A 3ZKJA 5G05J 3LJ3A 3L54A 3URZA 3BU8A 4JA7A 4HY9A 1QQEA 3Q78A 4Y6CA 5ITZF 5CHEE 4FU3A 4DI4A 4I6GA 3KSQA 5B1BE 1P5QA 3CVUA 2GRMA 4BY6A 2WMOA 4CZ2D 4B8CB 3UKUG 5KJMA 3D9JA 3W9FA 1SA5A 4EBAA 1CKRA 3MKRA 3BG0B 3IHVA 2IFUA 1H6KA 3E32A 3AS4A 3FHEA 3DPDA 3TWQA 2RFMA 4Y6WA 4GPMA 4G11A 3R7QA 2P9KG 2E0IA 3AU4A 3EUVA 4AY6A 2KZTA 3DSUA 4N3CA 5B1AE 3Q75A 4FA6A 4IULA 3UT7A 4O1PA 3ML8A 1IYGA 4EZXA 2EIME 3TWVA 1TJCA 1H2VC 2WXIA 1K8KG 5G55A 1HXIA 4I1MA 2Y0BG 2WXRA 5AQ7A 2XPYA 1HS6A 1IKND 3RSEG 4BTBA 1BPRA 2WXPA 2R05A 3U64A 2LXMA 4AV7A 3NZSA 2P9NG 3RK6A 2WVIA 2DZOA 3MV2B 1NA3A 4K5AB 2WXJA 3Q4AB 3RRNB 4DRXE 2P9UG 3U3WA 3JUIA 4KT6B 4AY5A 1O5MA 4BESA 4HOTA 1LTXA 3PE4A 1KZOA 2VTBB 4L9PA 3ZVVA 3QDNA 4FJYA 4APFA 1PAQA 2L6JA 4FL9A 4GPKA 2J08A 3NBNB 3CQCB 4GB9A 4U0UA 1LD7A 2EINE 1VDYA 3ZIMA 2OP6A 1E7UA 4UUCA 1OWPA 3MCXA 3LCAA 5JA4D 4WV5A 3E4BA 3FTVA 5AENA 2LAHA 3AG2E 3LJNA 3KAEA 5BT1A 2Y4UA 2Y1LE 3PZ4A 2QYJA 2ZU6B 3DPOA 2EIKE 4B89A 4LUNU 1N4PA 1U3DA 3HRAA 4DUIA 2Q7FA 3AG1E 3VLEA 3F6QA 1S0PA 1DVPA 3QWPA 1QBQA 3V2XA 5HKPA 3HXFA 3MYVA 2IQCA 1K3ZD 3DSSA 3CVXA 3UX4A 4NACA 3CVQA 2PZIA 4O60A 4LNBA 3DXKG 3ULQA 4J7WA 3PDNA 4X8QA 4DX5D 4R5LA 1QYMA 2XEVA 5FT9A 3D9KA 3RO3A 1N95A 5ENQD 4HORA 5E84A 4LCTA 4ILHB 4XKBA 4UQXA 2GRQB 3KSLA 4R5GA 4G23A 2WXQA 5DIZA 3QNJA 3SZ7A 4JNFA 4HOSA 2CG2A 3FUDA 2R2LA 3B7RL 4KVOA 4OYSA 3FTXA 2YINA 2WXOA 3TWXA 1TNUA 3E30A 3U66A 5D0OD 3SBTB 4M7CA 3RRUA 3SF4A 4CT0A 3ABLE 4A3TA 3TL5A 2ZGDA 3FU5A 3T5XA 2IO3C 2IO2C 3LYAA 3UT8A 3V2OA 3W9GA 4UI9J 2WB2A 2KCVA 3X2QE 3AJIA 4DX7D 1RW2A 5LCWC 3IV0A 5CCMA 2UY1B 3B7TA 3CHOA
chains in the Genus database with same CATH topology
3ZPJA 2BUGA 1WM5A 2R17C 2AVPA 1EYHA 2YHEA 3P2BA 2C0MA 3PZDA 4B0ZA 2X6FA 2GRLA 4JXTA 2ONDA 2CHZA 5J90A 3ML9A 2XRZA 2WXGA 3FUNA 2VJ8A 4HFGA 4CDNA 2FEZA 1UN9A 2LO6A 4QFVA 4GMJA 2XCCA 2J07A 3B7UX 3ZYQA 1HZ4A 1H0AA 3CVWA 4UWGA 5D0QD 4U0SA 2NC9A 4NURA 3MV3B 4A3VA 3S7JA 1INZA 2JLBA 4HXIA 4HVBA 4JEUA 4EZWA 3EIJA 3PS6A 1IQUA 1HE8A 3FFLA 3P1UA 3FULA 4GCNA 4KVMA 4N39A 4JWCA 3G2WA 2WXKA 3QJZA 4BTAA 3GZ1A 3D9OA 3TG4A 1KT0A 3LEWA 4K03A 3ZGQA 4ANXA 4FHKA 4PS3A 3VLFA 3I4GA 5EKQD 5T4YA 4EZVA 1N54A 1MQSA 3PNTB 5BV1A 4J0UA 3TGOA 5BV0A 3CHMA 3G2TA 5E76A 3FTZA 1OWMA 2VSNA 2XHEA 2J9QA 4MRUA 3KS2A 5G2NA 3C98A 4V3IA 2CG3A 4J6IA 3ASHA 4CT4A 2KHOA 2IONA 1JWGA 2FO7A 3OTNA 3PUKA 1DNPA 2Y4TA 2L9BA 4ILGA 4F3VA 4HYBA 3KD7A 1UJJA 2UWJG 3NQPA 2XCBA 2P58C 3ONKA 4RG6A 3SI5A 4ACLA 4D10C 2L0TB 4FJZA 3CVVA 2BPRA 4N5CA 5JJ6A 3Q5MA 3N71A 4J8FA 4R7LA 5FQ6A 2LSUA 3D9IA 4DK5A 4L1BA 2VQ2A 2AW6A 2RD0A 3D9NA 1QZ2A 3UQ3A 3ASFA 3MEKA 3LY8A 2LAIA 2XQ0A 2I2OA 2OVFA 3GZ2A 4BX9A 4J8SA 4UQYA 5KJKA 4H7YA 3QC1A 3K9IA 2DIWA 3AS8A 4XZ4A 3PNLB 5A6CA 3D9LA 3O4ZA 4PDXA 4TRQA 3CVNA 3L13A 4W9RA 4UWFA 2IJGX 2WQHA 5T3RA 4GYWA 1E8YA 3TJPA 3FP3A 3D2EA 2LSVA 1DKZA 4EBAG 5LOZA 4L2LA 5FQ8A 3WXXA 2WQ6A 4WWOA 1OWLA 2GW1A 3LS8A 4K0RA 3UPVA 4EZLA 5FQ7A 4WV7A 1ELWA 1EPUA 1U00A 3RU0A 5FWQA 4KBQA 4FP7A 4XI9A 1DKYA 2I1JA 2HM8A 2DBAA 4KZ0A 1Z3YA 3HIZA 4FHJA 3L16A 4AJWA 1H2TC 4JZYA 5CMYA 4C9BB 4DJAA 4J8DA 3EHMA 5BUZA 4I43A 4JL0A 3FTYA 4N3AA 3DOBA 4LEUA 4U8HA 4DLQA 3QWVA 4B9QA 4TUUA 2MHKA 5KJNA 2YHCA 4N3BA 4I6EA 1EF1C 3ZYLA 3QARA 4EZQA 2OVBA 3HVEB 5BNWA 1Y6IA 2WMNA 3FEYA 4KMOA 4JWDA 4EZZA 5FJYA 2VYIA 4YVOA 5AIJA 2X6IA 3LDZA 3AU5A 1IQRA 3FUEA 4JEHA 4BWRA 4E6HA 3JCKC 5C2YA 3RRMB 3LY9A 3GZSA 4R5KA 2J49A 4G25A 3CVLA 4PUCA 3O48A 4R5JA 1E8WA 3Q49B 1E8ZA 2C2LA 2VSXE 3S2AA 2DCPA 4MLPA 1FCHA 4GZ3A 2QY7A 3DBSA 5EX0A 4CDMA 4J8EA 2A4ZA 2NXPA 3PEUB 4CEMA 4WWPA 4MS6A 4AOFA 3CLJA 3G2UA 2A5UA 2OOEA 4JHKA 2PQNA 3CHRA 5LFAA 3ZN3A 1SQMA 1HH8A 3D9MA 4O6FA 4RVBA 5A23A 5JJ7A 2R5SA 4LRZA 3PEVB 4FLHA 4JN4A 2FULA 3I5PA 1ELKA 4G26A 4UQZA 5FQ4A 4WNFA 3SBSA 3OXLA 3NZUA 4GU5A 4KYOB 3H0XA 1L5JA 1Q5LA 1HFAA 2X38A 5FTPA 5G05C 1UJKA 3CR3A 3ENEA 3LY7A 2VTBA 3OAWA 4EZPA 4WNGA 5ENNA 4N2SA 5T8IA 3FUMA 3LXUX 2KCLA 2PL2A 3FU0A 2CHWA 2XGMA 4WWNA 3L08A 3U9WA 3B13A 2VSYA 1YUWA 3CV0A 3FDHA 5EX3A 4XX5A 3TXMA 4BT8A 4CGVA 5G05J 4ANUA 3LJ3A 3L54A 3URZA 5ARFA 4PO2A 4JA7A 4HY9A 2KZTB 1WY6A 1QQEA 4EQFA 4Y6CA 2PQRA 3FEXA 5FZSA 4PS7A 3D2FA 2FF4A 5CHEE 4WNDA 3ESLA 3PUJA 4HLEA 4IN3B 3PREA 4I9CA 2WXFA 2XPIA 2X6JA 4FU3A 4DI4A 1DKXA 4I6GA 3OXFA 1NP7A 1B89A 2E2EA 3HYMB 4JWIA 1P5QA 4L23A 4GZDA 3CVUA 4YNDA 3MA5A 4APOA 2CHXA 2GRMA 4BY6A 4BFRA 3FH7A 2QFCA 2WMOA 4B8CB 2QXLA 3HVEA 3MGBA 3TAXA 2WXMA 4EZOA 5KJMA 3D9JA 4NQ0A 1EDUA 4EBAA 1H19A 1CKRA 4JC8A 3MKRA 3BG0B 3IHVA 3SHFA 2IFUA 1UG3A 3FTUA 3FUHA 2J4DA 3IEGA 1OWOA 3L17A 4GMLA 1H6KA 3AS4A 3D3MA 3FHEA 2IOSA 3ZW3A 3DPDA 4F00A 4AP2A 1QNFA 3PRZA 4GZ5A 2PM6A 4Y6WA 5ANLA 1W3BA 3RJVA 4ABNA 4G11A 1XNFA 3R7QA 1Z6TA 2E0IA 2IU1A 2J09A 3AU4A 2VGYA 3ZHEA 4AY6A 4JHJA 3G2SA 3MKQA 2KZTA 2WXHA 4AXHA 5BW8C 4L2YA 4C0MA 4GCOA 1WAO1 1E90A 4N3CA 4UWKA 3CQGB 2YQ8A 1E96B 3FTSA 4MKTA 1KLXA 4DI3A 4FA6A 4IULA 3UT7A 4EZXA 3ML8A 3SGHA 1IYGA 4XKCA 1IHGA 4I17A 3CVPA 2V5FA 3CK9A 4Q96A 1TJCA 1H2VC 2WXIA 3FWVA 4FADA 3GW4A 4GA2A 3JQ1A 4GA1A 3Q47B 2AXVA 4EZNA 1SZAA 5G55A 2FI7A 2LNIA 3JQ0A 4JPSA 1HXIA 1UN8A 3FUFA 1NA0A 3ESKA 4I1MA 4XI0A 1KT1A 3CHSA 4EECA 5CCLA 3S7DA 3CEQA 4WAFA 1JUQA 2WXRA 4I6JA 4EZSA 3APCA 4L7TA 3S7FA 4ANWA 4ACKA 5TKYA 4B94A 2XPYA 2AXZA 1HS6A 5DBKA 4P29A 3S7BA 3FTWA 4LERA 4ME2A 3L6AA 2NSZA 3QAQA 1HF8A 4BTBA 1BPRA 4I1OB 3ASDA 2WXPA 5JHBA 3U64A 1OWNA 1A17A 3EJNA 3QB2A 4G1TA 5G04J 2I6HA 3RIBA 3MX3A 3T8MA 3VLDA 4AV7A 4N2QA 2CFZA 3NZSA 2KC7A 2CFUA 3RK6A 1MHQA 2WVIA 4GAAA 5JJTA 3DPQA 4FULA 1TJFA 2RG8A 3LVRE 3MV2B 3TG5A 1NA3A 2WXJA 2HR2A 4U0ZA 1HO8A 4EZYA 3Q4AB 1HG5A 3R7RA 3MJWA 3RRNB 2KCKA 4EZKA 2KM4A 1FVFA 4CCAA 4CGWA 4URKA 3U3WA 1JPLA 3JUIA 4DLOA 5KCMA 2XGOA 4KT6B 5EDSA 3OXGA 4IRUA 4AY5A 3R9AB 3ASGA 4F53A 3N8EA 4A1SA 5LCWJ 4HOTA 1YA0A 4JW1A 2PM7A 2I1KA 3PE4A 4ILIA 2VTBB 2WQ7A 3C7NA 3FU3A 1E7VA 4XIFA 4GYOA 3AS5A 3QDNA 3ZVVA 4JHRA 1U3CA 4FJYA 3RKVA 4U07A 4APFA 1PAQA 4RG9A 1XGWA 2L6JA 2V0PA 4FL9A 2WXLA 4GPKA 3MKQB 5AJLA 3KEZA 2J08A 3PVLA 3CQCB 2L0IA 4GB9A 2X6HA 4E85A 4U0UA 4BX8A 1Z3XA 2GGFA 1VDYA 3QKYA 3NF1A 4Q94A 4OVVA 3ZIMA 2OP6A 5FZRA 1E7UA 3APDA 2XGSA 3LVQE 5LX8A 3QNKA 3LPZA 3VTXA 1OWPA 5BPPA 3DQGA 3MCXA 3LCAA 4RSYA 3VTYA 2KATA 4U63A 3BEEA 4GYYA 5HI7A 2V7YA 3E4BA 3FTVA 4HOQA 5AENA 2IOLA 4WV5A 2LAHA 2HO1A 4XE0A 5C1DA 1UW4B 3KAEA 1BPOA 5BT1A 4WNEA 1OUVA 2Y4UA 2ILRA 3HHMA 3L22A 3TXNA 3IKOB 4M3OA 1ELRA 4DPRA 2VGXB 3CSTA 4HS2A 4EZTA 3UMVA 3BG1B 3SFZA 2ZU6B 3DPOA 3Q15A 2WXNA 4B89A 4LUNU 3ONLA 2BF0X 2I9CA 1U3DA 1DG4A 5J08A 2Q7FA 1ZBPA 4JVSA 4JWEA 2X3MA 3VLEA 3LKUA 3GYZA 1H2UA 2Y3AA 1S0PA 4WUYA 2X6KA 1DVPA 3CKBA 4AIFA 2WPVA 3CGHA 1LF8A 4F7AA 2OV8A 3ZYMA 2J4BA 3IHYA 4UWLA 3QWPA 1ZU2A 3U4TA 2IF4A 4G2VA 4UI9K 2FBNA 4A1GA 4PS8A 4GA0A 3MYVA 4R5IA 1E8XA 2IQCA 4I1AA 2WM9A 3CVXA 4BT9A 4JNEA 3UX4A 1HG2A 4NACA 3RO2A 4CDRA 7HSCA 3FY4A 3CVQA 4JA9A 2PZIA 3UUXA 2C0LA 2JEKA 3I4RB 5KJLA 3CKCA 4FLBA 4MQDA 2AWIA 3IBEA 4FC8A 3PE3A 4YVQC 5AYWD 3UT4A 3ULQA 4ATGA 5HQ8A 3PDNA 4UI9C 4KZCA 3D9PA 5A7DB 4BSXA 1TEZA 4R5LA 2XEVA 5FT9A 3D9KA 1N52A 3RO3A 4HORA 3QWWA 3CSFA 3DPPA 5E84A 4LCTA 3ZXSA 4PH4B 4KXKB 1GW6A 1NZNA 1Y8MA 1HX8A 2AXUA 4ILHB 4XKBA 3T5VA 3CK7A 4UQXA 3SD5A 5CMWA 4EZUA 3CK8A 4G23A 4GZ6A 4R5GA 2V4LA 4NRHB 5AJDA 2WXQA 5DIZA 3CIAA 3QNJA 3SZ7A 4JNFA 3CVYA 4HOSA 3QOUA 3MZLB 5JHAA 2CG2A 2YNQA 4TV3A 4EZJA 3FH8A 5LP0A 3PH0C 2R59A 3FUDA 2EQXA 3B7RL 3APFA 4KVOA 4ANVA 4Q69A 2BTDA 3B7SA 4OYSA 3ZFWA 2XRYA 3EIQC 3FTXA 3FUJA 2YINA 4EPZA 2WXOA 4IYPA 3CHQA 4F1SA 2V8SE 4E81A 4HOUA 4I2WA 2UY1A 2M63A 5G04C 2HYZA 3U66A 1FVHA 1PY1A 3JYSA 5D0OD 1SZ9A 3SBTB 4OVUA 3RRUA 4U04A 5ARGA 4I9EA 3SF4A 3G2VA 4CT0A 4CRWA 3FUKA 4A3TA 4G24A 5E75A 3QK0A 4B8AA 4AM9A 4AVXA 2MOWA 4UWHA 1PC2A 3FH5A 3TL5A 2VSOE 1X5BA 4H7XA 5ANRA 4F01A 4A55A 3FU5A 3SNXA 3HDXA 3T5XA 4I2ZA 4C0EA 5FZQA 3LYAA 2VGXA 1HU3A 4GZCA 3UT8A 3ZEFA 4AEZC 4UI9J 3C7NB 5M72A 2WB2A 2KCVA 3EDTB 3FUIA 1JWFA 4EZRA 5LCWC 3FU6A 3CHPA 3IV0A 3I3NA 3ZHEB 3ZRHA 5CCMA 2UY1B 2XPZA 2MRIA 3B7TA 3ZYKA 3EHNA 3CHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZEF A;  4I43 A;  4ILI A;  3SBT B;  4ILH B;  3SBS A;  4ILG A; 
#chains in the Genus database with same CATH topology
 2HE0 A;  2AVP A;  2X6F A;  2CHZ A;  2L6B A;  4CDN A;  2FEZ A;  1OCO E;  4GMJ A;  4A63 B;  2H6I A;  5D0Q D;  4HXI A;  3PS6 A;  4JWC A;  1HE8 A;  4KVM A;  3UIN C;  4PS3 A;  1TNO A;  1MQS A;  3TGO A;  4J0U A;  1OWM A;  2XHE A;  5G2N A;  3C98 A;  2CG3 A;  5EID A;  2ION A;  1DNP A;  4ILG A;  4F3V A;  3KD7 A;  3ASN E;  4D10 C;  2L0T B;  4FJZ A;  4N5C A;  2LSU A;  2F0Y A;  5ENP D;  2VQ2 A;  5CRU A;  3ASO E;  1QZ2 A;  3GZ2 A;  2XQ0 A;  2OVF A;  4UQY A;  4H7Y A;  2DIW A;  4UWF A;  3CVN A;  1TR4 A;  2IJG X;  2LSV A;  5LOZ A;  2WQ6 A;  2GW1 A;  3LS8 A;  4EZL A;  5AQA A;  5ENR D;  1U00 A;  3RU0 A;  4TUM A;  4FP7 A;  2I1J A;  4F1P A;  1U2V G;  4KZ0 A;  1Z3Y A;  1H2T C;  4DJA A;  3FTY A;  1WG0 A;  3DOB A;  4BET A;  5AQB A;  2OCC E;  4TUU A;  2LUH A;  5KJN A;  5BNW A;  1Y6I A;  5FJY A;  5AIJ A;  3LDZ A;  1IQR A;  3FUE A;  3SY2 A;  3SFY A;  4R5J A;  2C2L A;  2VSX E;  3Q7F A;  2XEN A;  1FCH A;  4GZ3 A;  2QY7 A;  1N11 A;  4J8E A;  4MS6 A;  5B3S E;  2GRN B;  3CLJ A;  2A5U A;  4JHK A;  3CHR A;  5LFA A;  3ZN3 A;  3PEV B;  3I5P A;  4WNF A;  4KYO B;  3H0X A;  1UJK A;  3ENE A;  1OCZ E;  5ENN A;  4N2S A;  2PL2 A;  3B13 A;  3UIP C;  3DSW A;  3FDH A;  4PO2 A;  2DWZ A;  2FF4 A;  4NIK A;  1NP7 A;  1JCS A;  1B89 A;  2V4H C;  4JWI A;  4YDO A;  4L23 A;  4GZD A;  3MA5 A;  2CHX A;  4BFR A;  2QFC A;  2WXM A;  3UTM A;  1EDU A;  3HXB A;  4JC8 A;  3SHF A;  2J4D A;  1OWO A;  4YDE A;  2IOS A;  4GTR A;  4AP2 A;  1QNF A;  3PRZ A;  4GZ5 A;  2PM6 A;  1W3B A;  1XNF A;  4OAV B;  1OCC E;  3ZHE A;  4BSZ B;  2WXH A;  5CEA A;  5BW8 C;  2GRR B;  3TWR A;  4GCO A;  1WAO 1;  1E90 A;  3CQG B;  3FTS A;  5KBA A;  2XEH A;  1IHG A;  3CVP A;  4Q96 A;  3T9K A;  4FAD A;  1MYO A;  1SZA A;  4JPS A;  1NA0 A;  1JUQ A;  4I6J A;  5ENS D;  3APC A;  4L7T A;  5TKY A;  1TN8 A;  3FTW A;  4ME2 A;  1N4Q A;  3VLD A;  3RIB A;  4LNU D;  3MX3 A;  4N2Q A;  2KC7 A;  1MHQ A;  3HG0 D;  2IEJ A;  1TJF A;  2B0O E;  2RG8 A;  4K5B A;  3TG5 A;  3B7B A;  3R7R A;  3MJW A;  4EZK A;  2KM4 A;  1JPL A;  4DLO A;  5KCM A;  5EDS A;  3OXG A;  3ASG A;  4F53 A;  5LCW J;  4A1S A;  4C48 B;  2PM7 A;  4ILI A;  2WQ7 A;  4XIF A;  2XEE A;  3AS5 A;  1K1B A;  1U3C A;  3RKV A;  1BLX B;  2WXL A;  3DEP A;  3PVL A;  2XZD G;  2GGF A;  3NF1 A;  3DRA A;  1MX4 A;  5EYL A;  3LPZ A;  3VTX A;  3DQG A;  1Q2Z A;  2KAT A;  5HI7 A;  4GYY A;  2IOL A;  1BPO A;  1IXV A;  3UIO C;  2V5Q C;  4DPR A;  2VGX B;  4EZT A;  3UMV A;  3BG1 B;  3Q15 A;  2BF0 X;  2I9C A;  3TWT A;  5J08 A;  4U96 D;  2DYS E;  3ULE G;  2DYR E;  4JWE A;  2X3M A;  3LKU A;  3GYZ A;  3C72 A;  4O1O A;  3CKB A;  2WPV A;  4F7A A;  5HS0 A;  1ZU2 A;  3E34 A;  4G2V A;  1N4S A;  4R5I A;  1E8X A;  4I1A A;  3BQO A;  1HG2 A;  4GTP A;  4JA9 A;  3I4R B;  3CKC A;  3UM3 A;  4FC8 A;  5AYW D;  5HQ8 A;  1DCQ A;  4BSX A;  4RQI A;  3QWW A;  3CSF A;  4KXK B;  2AXU A;  1NZN A;  3CK8 A;  5KNG A;  4GZ6 A;  2V4L A;  4NRH B;  4GTS A;  5AJD A;  4HLL A;  5EN5 D;  1BI8 B;  3MZL B;  5JHA A;  4HRN A;  4EZJ A;  2EQX A;  3APF A;  4Q69 A;  2BTD A;  3B7S A;  3FUJ A;  4EPZ A;  3D9H A;  1S63 A;  2UY1 A;  1NFI E;  2HYZ A;  5G04 C;  1FVH A;  1PY1 A;  4DX6 D;  1O1S A;  3G2V A;  5BXU A;  4G24 A;  5E75 A;  4AVX A;  2P9P G;  1X5B A;  1N0Q A;  4A55 A;  3SNX A;  3HDX A;  3Q79 A;  2VGX A;  4AEZ C;  3C7N B;  3EDT B;  1ZB1 A;  4U95 D;  1JWF A;  3FU6 A;  3CHP A;  3I3N A;  3PZ1 A;  3ZRH A;  2XPZ A;  3B7U X;  1SVX A;  1WM5 A;  2R17 C;  4B0Z A;  2YHE A;  2C0M A;  3PZD A;  1YYH A;  5KWD A;  2GRL A;  4JXT A;  2OND A;  5J90 A;  2XRZ A;  3FUN A;  5CBN A;  4GTT A;  3CVW A;  4UWG A;  4U0S A;  2NC9 A;  4NUR A;  3FFL A;  4N39 A;  3G2W A;  2WXK A;  3TG4 A;  3LEW A;  4FHK A;  3UM0 A;  5BV1 A;  5BV0 A;  1S70 B;  3G2T A;  3FTZ A;  4J6I A;  4CT4 A;  2KHO A;  2Y4T A;  1UJJ A;  2UWJ G;  3SI5 A;  2XCB A;  2P58 C;  4ACL A;  3Q5M A;  3N71 A;  4J8F A;  2VGE A;  2LAI A;  2I2O A;  3QC1 A;  3K9I A;  3AS8 A;  4HBD A;  5A6C A;  3L13 A;  2WQH A;  3TJP A;  4TXR A;  3D2E A;  5FQ8 A;  4WWO A;  3C3R A;  4G8L A;  4TXP A;  1S64 A;  2DBA A;  4HI8 A;  3V31 A;  3L16 A;  4C9B B;  5BUZ A;  3EHM A;  5AQ9 A;  1BD8 A;  4JL0 A;  4N3A A;  4U8H A;  4YDY A;  2MHK A;  3SQV A;  3QAR A;  2WMN A;  4KMO A;  4JWD A;  4YVO A;  4E6H A;  4JEH A;  3JCK C;  5C2Y A;  3LY9 A;  4G25 A;  1E8W A;  4XEI G;  4CDM A;  2H6F A;  2A4Z A;  2NXP A;  3PEU B;  4AOF A;  3DWL G;  5A23 A;  1HH8 A;  3ZUV B;  4JN4 A;  1ELK A;  5FQ4 A;  3OXL A;  3NZU A;  4GU5 A;  1L5J A;  1Q5L A;  1HFA A;  5G05 C;  3CR3 A;  3C3O A;  3LY7 A;  4EZP A;  4WNG A;  3JUE A;  2KCL A;  2QYU A;  4HQD A;  4JD2 G;  5EX3 A;  4GTM A;  4XX5 A;  2KZT B;  2Y69 E;  2PQR A;  3D2F A;  4PS7 A;  1TNY A;  4IN3 B;  2OEV A;  2XPI A;  4DX1 A;  2X6J A;  1DKX A;  3OXF A;  2E2E A;  3KEA A;  3SFX A;  4APO A;  1K1A A;  2F37 A;  1AP7 A;  2QXL A;  3HVE A;  3TAX A;  4EZO A;  4NQ0 A;  5CRV A;  3FTU A;  4GML A;  2GRP B;  3D3M A;  3E33 A;  4F00 A;  5ANL A;  5KNH D;  1Z6T A;  2J09 A;  2VGY A;  3UM2 A;  3MKQ A;  4C0M A;  3JXJ A;  4MKT A;  4DI3 A;  2P9S G;  4I17 A;  2V5F A;  3B95 A;  3JQ1 A;  4GA1 A;  4ZHB A;  2PNN A;  3ESK A;  4XI0 A;  3CHS A;  4EEC A;  3HXC A;  3S7D A;  3ZNG A;  2ZGG A;  4ANW A;  4B94 A;  5DBK A;  4P29 A;  5JMN D;  3S7B A;  2NSZ A;  4I1O B;  3ASD A;  5JHB A;  1A17 A;  3QB2 A;  4G1T A;  5G04 J;  2I6H A;  3T8M A;  4ZFH A;  1OY3 D;  3DPQ A;  4FUL A;  3LVR E;  1HO8 A;  2KCK A;  2AJA A;  1FVF A;  4CCA A;  3DSX A;  3C3Q A;  2XGO A;  4IRU A;  3R9A B;  1YA0 A;  1OCR E;  3ZU7 B;  5CBO A;  3FU3 A;  1E7V A;  4GYO A;  4JHR A;  4U07 A;  1XGW A;  2V0P A;  5AJL A;  5CEC B;  1DC2 A;  3KEZ A;  4E85 A;  1Z3X A;  4OVV A;  3QKY A;  5FZR A;  3APD A;  5CED B;  3VTY A;  3TWS A;  4U63 A;  2V7Y A;  4HOQ A;  1UW4 B;  4WNE A;  1OUV A;  2ILR A;  3HHM A;  3L22 A;  3TXN A;  3IKO B;  4U8V D;  1ELR A;  1N9A A;  4BER A;  3SFZ A;  2WXN A;  4LSZ E;  4CYM D;  1ZBP A;  3J5Q B;  2IY0 C;  4GTV A;  1H2U A;  2A5E A;  1LD8 A;  3CGH A;  3UXG A;  2OV8 A;  2J4B A;  3IHY A;  2H6G A;  3U4T A;  2IF4 A;  4A1G A;  2WM9 A;  4BT9 A;  4JNE A;  4CDR A;  7HSC A;  1YMP A;  4RLY A;  3UUX A;  2JEK A;  4FLB A;  4MQD A;  2AWI A;  4YVQ C;  1KPS B;  4KZC A;  1TEZ A;  1N52 A;  2R03 A;  3DPP A;  4GMR A;  4HNA D;  1O1R A;  3ZXS A;  1Y8M A;  3SD5 A;  5CMW A;  3V30 A;  3V79 K;  3CVY A;  3QOU A;  4GTO A;  2YNQ A;  4Z68 A;  3FH8 A;  5LP0 A;  3EU5 A;  2XRY A;  3EIQ C;  4HRM B;  2V8S E;  4I2W A;  4BEP A;  3JYS A;  4U04 A;  3FUK A;  4B8A A;  3QK0 A;  4K5C A;  2MOW A;  1PC2 A;  3FH5 A;  5ANR A;  4H7X A;  2XS1 A;  4I2Z A;  5FZQ A;  1HU3 A;  3ZEF A;  5H7P A;  5M72 A;  3FUI A;  3ZHE B;  3BUA A;  1MZC A;  3ZPJ A;  2BUG A;  2ZIR A;  1EYH A;  3P2B A;  3ML9 A;  4DX2 A;  4HRL A;  2LXL A;  2P9I G;  2LO6 A;  2XCC A;  1A5E A;  1HZ4 A;  1INZ A;  3EIJ A;  1IQU A;  3FUL A;  3Q9N C;  3ISM C;  3QJZ A;  3ZGQ A;  4K03 A;  3VLF A;  3I4G A;  1N54 A;  3CHM A;  2VSN A;  2J9Q A;  3HXD A;  5FIN A;  3OTN A;  2L9B A;  3ONK A;  3CVV A;  2BPR A;  5JJ6 A;  4R7L A;  5FQ6 A;  2AW6 A;  2RD0 A;  4HI9 A;  3UQ3 A;  3ASF A;  3LY8 A;  4BX9 A;  3DST A;  1V55 E;  1G3N B;  3PNL B;  3T8K A;  3D9L A;  1SW6 A;  4TRQ A;  4W9R A;  5T3R A;  4GYW A;  1E8Y A;  4EBA G;  4L2L A;  1UOH A;  1OWL A;  4K0R A;  3UPV A;  5FQ7 A;  1D8D A;  1EPU A;  1DKY A;  2GRO B;  3HIZ A;  4YDW A;  5CMY A;  4JZY A;  1FPP A;  4I43 A;  3ZYL A;  2OVB A;  3HVE B;  3FEY A;  4EZZ A;  2VYI A;  3C5R A;  2X6I A;  3RRM B;  3GZS A;  4R5K A;  3CVL A;  3ABK E;  3O48 A;  3Q49 B;  3S2A A;  2ZXW E;  4MLP A;  3DBS A;  4CEM A;  2OOE A;  2PQN A;  3D9M A;  4O6F A;  4RVB A;  3DPY A;  5JJ7 A;  4LRZ A;  1TN6 A;  1DCE A;  4G26 A;  4UQZ A;  4HB5 A;  1FT1 A;  2VTB A;  3L82 A;  3OAW A;  5T8I A;  3LXU X;  3FU0 A;  3L08 A;  3Q7A A;  1YUW A;  3CV0 A;  4CGV A;  3TWU A;  5IY5 E;  4ANU A;  2EIJ E;  5ARF A;  4LG6 A;  1WY6 A;  3FEX A;  5FZS A;  1OT8 A;  4WND A;  3ESL A;  3PUJ A;  1H6P A;  4HLE A;  3PRE A;  4I9C A;  2WXF A;  1N4R A;  2JAB A;  3HYM B;  4LNG A;  4YND A;  3FH7 A;  3SO8 A;  3MGB A;  1H19 A;  1FT2 A;  1JCQ A;  1UG3 A;  3FUH A;  3IEG A;  3L17 A;  3DXM G;  3ZW3 A;  1RZ4 A;  3RJV A;  4ABN A;  2IU1 A;  5D2M C;  4JHJ A;  3G2S A;  4AXH A;  4L2Y A;  2FO1 E;  4UWK A;  2YQ8 A;  1E96 B;  1KLX A;  3SGH A;  4XKC A;  2DZN A;  3CK9 A;  2OEW A;  3FWV A;  3GW4 A;  4GA2 A;  3Q47 B;  2AXV A;  4EZN A;  3Q9U C;  2FI7 A;  2LNI A;  3JQ0 A;  1UN8 A;  3FUF A;  1KT1 A;  2F8Y A;  5CCL A;  3CEQ A;  4WAF A;  3WG7 E;  4EZS A;  3S7F A;  4ACK A;  2QZA A;  1O1T A;  2AXZ A;  4LER A;  3L6A A;  3TWW A;  3QAQ A;  1HF8 A;  4EQF A;  1OWN A;  3EJN A;  1SA4 A;  3PZ2 A;  2CFZ A;  5JJT A;  2CFU A;  4GAA A;  2HR2 A;  4U0Z A;  4QQI A;  4EZY A;  1HG5 A;  2XS8 A;  4CGW A;  4URK A;  2RKK A;  4F6R D;  2EIL E;  3N8E A;  2ETB A;  4JW1 A;  2I1K A;  3C7N A;  5AAR A;  4RG9 A;  3MKQ B;  3E37 A;  4GTQ A;  2L0I A;  2X6H A;  4BX8 A;  4Q94 A;  3EHR A;  2XGS A;  3LVQ E;  5LX8 A;  3QNK A;  3DEO A;  5BPP A;  4RSY A;  2QC9 A;  3BEE A;  2H6H A;  2HO1 A;  4XE0 A;  5C1D A;  3UM1 A;  1AWC B;  4M3O A;  3CST A;  4HS2 A;  5EIB E;  4OAU C;  3R9M A;  3ONL A;  1DG4 A;  5HRY A;  4JVS A;  3EU9 A;  2R02 A;  2Y3A A;  4J8Y A;  4WUY A;  4U7E B;  2X6K A;  4AIF A;  1LF8 A;  5BXO A;  3ZYM A;  4UWL A;  3NB2 A;  1MX2 A;  2BKG A;  4EHM A;  4U8Y D;  4UI9 K;  2FBN A;  4PS8 A;  4GA0 A;  3RAU A;  4N5Q A;  3RO2 A;  1TNB A;  1TYQ G;  3FY4 A;  5ENT D;  1BI7 B;  2C0L A;  5KJL A;  1NI1 A;  3IBE A;  4ATG A;  3PE3 A;  3UT4 A;  3L9T A;  4UI9 C;  2KXP C;  3NOG D;  3D9P A;  5A7D B;  4PH4 B;  1GW6 A;  1HX8 A;  3T5V A;  3CK7 A;  4ATZ D;  4EZU A;  5EYP F;  3NOC D;  3CIA A;  2RFA A;  4TV3 A;  3PH0 C;  2R59 A;  1JCR A;  4ANV A;  3ZFW A;  2BKK B;  4IYP A;  3CHQ A;  4F1S A;  1V54 E;  4E81 A;  4HOU A;  2M63 A;  2MYO A;  1SZ9 A;  4OVU A;  5ARG A;  4I9E A;  1IHB A;  1D8E A;  4TXQ A;  4CRW A;  3HXE A;  1NL4 A;  4AM9 A;  1TNZ A;  1YCS B;  4UWH A;  2VSO E;  2B6C A;  4F01 A;  4C0E A;  5EIL A;  2XZT G;  1H6O A;  2KBX A;  4GZC A;  3AAA C;  3AG3 E;  3J5P A;  4B93 B;  4EZR A;  3ABM E;  1Z5S C;  2MRI A;  3ZYK A;  3EHN A;  2WXG A;  1TN7 A;  2VJ8 A;  4HFG A;  1UN9 A;  4QFV A;  3Q73 A;  2J07 A;  3ZYQ A;  1H0A A;  1WDY A;  4A3V A;  3MV3 B;  3S7J A;  2JLB A;  4HVB A;  4JEU A;  2P9L G;  4EZW A;  1N94 A;  3P1U A;  4GCN A;  3DSV A;  3JXI A;  4BTA A;  3GZ1 A;  3D9O A;  1KT0 A;  4ANX A;  5AN8 A;  5EKQ D;  5T4Y A;  4EZV A;  3PNT B;  4JB8 P;  2ETC A;  5E76 A;  4MRU A;  3KS2 A;  4V3I A;  3ASH A;  1JWG A;  2FO7 A;  3PUK A;  2ZIS A;  2J8S D;  4HYB A;  4RG6 A;  3NQP A;  1D9S A;  2F8X K;  1MX6 A;  5FIO A;  3D9I A;  4DK5 A;  4G8K A;  4L1B A;  3UI2 A;  3D9N A;  3MEK A;  4J8S A;  5KJK A;  4XZ4 A;  2NYJ A;  3O4Z A;  4PDX A;  3FP3 A;  1KZP A;  1DKZ A;  3WXX A;  5D66 A;  4WV7 A;  1ELW A;  3ULY A;  5FWQ A;  4KBQ A;  4XI9 A;  3ZXP A;  2HM8 A;  1X81 A;  4FHJ A;  4AJW A;  4J8D A;  4MBG A;  5CER B;  4LEU A;  4DLQ A;  3QWV A;  4B9Q A;  3EHQ A;  2P2C P;  2YHC A;  4N3B A;  4I6E A;  1EF1 C;  4EZQ A;  1OXJ A;  2ETA A;  1N0R A;  2BED A;  3AU5 A;  5ENO D;  4BWR A;  2J49 A;  4PUC A;  1E8Z A;  2DCP A;  3IXE A;  5EX0 A;  4WWP A;  3G2U A;  1SQM A;  2DVW A;  3UKR G;  2R5S A;  3NAW A;  4FLH A;  2FUL A;  1BU9 A;  3SBS A;  1MJ0 A;  2X38 A;  5FTP A;  3AG4 E;  3FUM A;  3PZ3 A;  2CHW A;  2XGM A;  4WWN A;  3U9W A;  5AAO A;  2VSY A;  3TXM A;  4BT8 A;  3ZKJ A;  5G05 J;  3LJ3 A;  3L54 A;  3URZ A;  3BU8 A;  4JA7 A;  4HY9 A;  1QQE A;  3Q78 A;  4Y6C A;  5ITZ F;  5CHE E;  4FU3 A;  4DI4 A;  4I6G A;  3KSQ A;  5B1B E;  1P5Q A;  3CVU A;  2GRM A;  4BY6 A;  2WMO A;  4CZ2 D;  4B8C B;  3UKU G;  5KJM A;  3D9J A;  3W9F A;  1SA5 A;  4EBA A;  1CKR A;  3MKR A;  3BG0 B;  3IHV A;  2IFU A;  1H6K A;  3E32 A;  3AS4 A;  3FHE A;  3DPD A;  3TWQ A;  2RFM A;  4Y6W A;  4GPM A;  4G11 A;  3R7Q A;  2P9K G;  2E0I A;  3AU4 A;  3EUV A;  4AY6 A;  2KZT A;  3DSU A;  4N3C A;  5B1A E;  3Q75 A;  4FA6 A;  4IUL A;  3UT7 A;  4O1P A;  3ML8 A;  1IYG A;  4EZX A;  2EIM E;  3TWV A;  1TJC A;  1H2V C;  2WXI A;  1K8K G;  5G55 A;  1HXI A;  4I1M A;  2Y0B G;  2WXR A;  5AQ7 A;  2XPY A;  1HS6 A;  1IKN D;  3RSE G;  4BTB A;  1BPR A;  2WXP A;  2R05 A;  3U64 A;  2LXM A;  4AV7 A;  3NZS A;  2P9N G;  3RK6 A;  2WVI A;  2DZO A;  3MV2 B;  1NA3 A;  4K5A B;  2WXJ A;  3Q4A B;  3RRN B;  4DRX E;  2P9U G;  3U3W A;  3JUI A;  4KT6 B;  4AY5 A;  1O5M A;  4BES A;  4HOT A;  1LTX A;  3PE4 A;  1KZO A;  2VTB B;  4L9P A;  3ZVV A;  3QDN A;  4FJY A;  4APF A;  1PAQ A;  2L6J A;  4FL9 A;  4GPK A;  2J08 A;  3NBN B;  3CQC B;  4GB9 A;  4U0U A;  1LD7 A;  2EIN E;  1VDY A;  3ZIM A;  2OP6 A;  1E7U A;  4UUC A;  1OWP A;  3MCX A;  3LCA A;  5JA4 D;  4WV5 A;  3E4B A;  3FTV A;  5AEN A;  2LAH A;  3AG2 E;  3LJN A;  3KAE A;  5BT1 A;  2Y4U A;  2Y1L E;  3PZ4 A;  2QYJ A;  2ZU6 B;  3DPO A;  2EIK E;  4B89 A;  4LUN U;  1N4P A;  1U3D A;  3HRA A;  4DUI A;  2Q7F A;  3AG1 E;  3VLE A;  3F6Q A;  1S0P A;  1DVP A;  3QWP A;  1QBQ A;  3V2X A;  5HKP A;  3HXF A;  3MYV A;  2IQC A;  1K3Z D;  3DSS A;  3CVX A;  3UX4 A;  4NAC A;  3CVQ A;  2PZI A;  4O60 A;  4LNB A;  3DXK G;  3ULQ A;  4J7W A;  3PDN A;  4X8Q A;  4DX5 D;  4R5L A;  1QYM A;  2XEV A;  5FT9 A;  3D9K A;  3RO3 A;  1N95 A;  5ENQ D;  4HOR A;  5E84 A;  4LCT A;  4ILH B;  4XKB A;  4UQX A;  2GRQ B;  3KSL A;  4R5G A;  4G23 A;  2WXQ A;  5DIZ A;  3QNJ A;  3SZ7 A;  4JNF A;  4HOS A;  2CG2 A;  3FUD A;  2R2L A;  3B7R L;  4KVO A;  4OYS A;  3FTX A;  2YIN A;  2WXO A;  3TWX A;  1TNU A;  3E30 A;  3U66 A;  5D0O D;  3SBT B;  4M7C A;  3RRU A;  3SF4 A;  4CT0 A;  3ABL E;  4A3T A;  3TL5 A;  2ZGD A;  3FU5 A;  3T5X A;  2IO3 C;  2IO2 C;  3LYA A;  3UT8 A;  3V2O A;  3W9G A;  4UI9 J;  2WB2 A;  2KCV A;  3X2Q E;  3AJI A;  4DX7 D;  1RW2 A;  5LCW C;  3IV0 A;  5CCM A;  2UY1 B;  3B7T A;  3CHO A; 
#chains in the Genus database with same CATH homology
 3ZPJ A;  2BUG A;  1WM5 A;  2R17 C;  2AVP A;  1EYH A;  2YHE A;  3P2B A;  2C0M A;  3PZD A;  4B0Z A;  2X6F A;  2GRL A;  4JXT A;  2OND A;  2CHZ A;  5J90 A;  3ML9 A;  2XRZ A;  2WXG A;  3FUN A;  2VJ8 A;  4HFG A;  4CDN A;  2FEZ A;  1UN9 A;  2LO6 A;  4QFV A;  4GMJ A;  2XCC A;  2J07 A;  3B7U X;  3ZYQ A;  1HZ4 A;  1H0A A;  3CVW A;  4UWG A;  5D0Q D;  4U0S A;  2NC9 A;  4NUR A;  3MV3 B;  4A3V A;  3S7J A;  1INZ A;  2JLB A;  4HXI A;  4HVB A;  4JEU A;  4EZW A;  3EIJ A;  3PS6 A;  1IQU A;  1HE8 A;  3FFL A;  3P1U A;  3FUL A;  4GCN A;  4KVM A;  4N39 A;  4JWC A;  3G2W A;  2WXK A;  3QJZ A;  4BTA A;  3GZ1 A;  3D9O A;  3TG4 A;  1KT0 A;  3LEW A;  4K03 A;  3ZGQ A;  4ANX A;  4FHK A;  4PS3 A;  3VLF A;  3I4G A;  5EKQ D;  5T4Y A;  4EZV A;  1N54 A;  1MQS A;  3PNT B;  5BV1 A;  4J0U A;  3TGO A;  5BV0 A;  3CHM A;  3G2T A;  5E76 A;  3FTZ A;  1OWM A;  2VSN A;  2XHE A;  2J9Q A;  4MRU A;  3KS2 A;  5G2N A;  3C98 A;  4V3I A;  2CG3 A;  4J6I A;  3ASH A;  4CT4 A;  2KHO A;  2ION A;  1JWG A;  2FO7 A;  3OTN A;  3PUK A;  1DNP A;  2Y4T A;  2L9B A;  4ILG A;  4F3V A;  4HYB A;  3KD7 A;  1UJJ A;  2UWJ G;  3NQP A;  2XCB A;  2P58 C;  3ONK A;  4RG6 A;  3SI5 A;  4ACL A;  4D10 C;  2L0T B;  4FJZ A;  3CVV A;  2BPR A;  4N5C A;  5JJ6 A;  3Q5M A;  3N71 A;  4J8F A;  4R7L A;  5FQ6 A;  2LSU A;  3D9I A;  4DK5 A;  4L1B A;  2VQ2 A;  2AW6 A;  2RD0 A;  3D9N A;  1QZ2 A;  3UQ3 A;  3ASF A;  3MEK A;  3LY8 A;  2LAI A;  2XQ0 A;  2I2O A;  2OVF A;  3GZ2 A;  4BX9 A;  4J8S A;  4UQY A;  5KJK A;  4H7Y A;  3QC1 A;  3K9I A;  2DIW A;  3AS8 A;  4XZ4 A;  3PNL B;  5A6C A;  3D9L A;  3O4Z A;  4PDX A;  4TRQ A;  3CVN A;  3L13 A;  4W9R A;  4UWF A;  2IJG X;  2WQH A;  5T3R A;  4GYW A;  1E8Y A;  3TJP A;  3FP3 A;  3D2E A;  2LSV A;  1DKZ A;  4EBA G;  5LOZ A;  4L2L A;  5FQ8 A;  3WXX A;  2WQ6 A;  4WWO A;  1OWL A;  2GW1 A;  3LS8 A;  4K0R A;  3UPV A;  4EZL A;  5FQ7 A;  4WV7 A;  1ELW A;  1EPU A;  1U00 A;  3RU0 A;  5FWQ A;  4KBQ A;  4FP7 A;  4XI9 A;  1DKY A;  2I1J A;  2HM8 A;  2DBA A;  4KZ0 A;  1Z3Y A;  3HIZ A;  4FHJ A;  3L16 A;  4AJW A;  1H2T C;  4JZY A;  5CMY A;  4C9B B;  4DJA A;  4J8D A;  3EHM A;  5BUZ A;  4I43 A;  4JL0 A;  3FTY A;  4N3A A;  3DOB A;  4LEU A;  4U8H A;  4DLQ A;  3QWV A;  4B9Q A;  4TUU A;  2MHK A;  5KJN A;  2YHC A;  4N3B A;  4I6E A;  1EF1 C;  3ZYL A;  3QAR A;  4EZQ A;  2OVB A;  3HVE B;  5BNW A;  1Y6I A;  2WMN A;  3FEY A;  4KMO A;  4JWD A;  4EZZ A;  5FJY A;  2VYI A;  4YVO A;  5AIJ A;  2X6I A;  3LDZ A;  3AU5 A;  1IQR A;  3FUE A;  4JEH A;  4BWR A;  4E6H A;  3JCK C;  5C2Y A;  3RRM B;  3LY9 A;  3GZS A;  4R5K A;  2J49 A;  4G25 A;  3CVL A;  4PUC A;  3O48 A;  4R5J A;  1E8W A;  3Q49 B;  1E8Z A;  2C2L A;  2VSX E;  3S2A A;  2DCP A;  4MLP A;  1FCH A;  4GZ3 A;  2QY7 A;  3DBS A;  5EX0 A;  4CDM A;  4J8E A;  2A4Z A;  2NXP A;  3PEU B;  4CEM A;  4WWP A;  4MS6 A;  4AOF A;  3CLJ A;  3G2U A;  2A5U A;  2OOE A;  4JHK A;  2PQN A;  3CHR A;  5LFA A;  3ZN3 A;  1SQM A;  1HH8 A;  3D9M A;  4O6F A;  4RVB A;  5A23 A;  5JJ7 A;  2R5S A;  4LRZ A;  3PEV B;  4FLH A;  4JN4 A;  2FUL A;  3I5P A;  1ELK A;  4G26 A;  4UQZ A;  5FQ4 A;  4WNF A;  3SBS A;  3OXL A;  3NZU A;  4GU5 A;  4KYO B;  3H0X A;  1L5J A;  1Q5L A;  1HFA A;  2X38 A;  5FTP A;  5G05 C;  1UJK A;  3CR3 A;  3ENE A;  3LY7 A;  2VTB A;  3OAW A;  4EZP A;  4WNG A;  5ENN A;  4N2S A;  5T8I A;  3FUM A;  3LXU X;  2KCL A;  2PL2 A;  3FU0 A;  2CHW A;  2XGM A;  4WWN A;  3L08 A;  3U9W A;  3B13 A;  2VSY A;  1YUW A;  3CV0 A;  3FDH A;  5EX3 A;  4XX5 A;  3TXM A;  4BT8 A;  4CGV A;  5G05 J;  4ANU A;  3LJ3 A;  3L54 A;  3URZ A;  5ARF A;  4PO2 A;  4JA7 A;  4HY9 A;  2KZT B;  1WY6 A;  1QQE A;  4EQF A;  4Y6C A;  2PQR A;  3FEX A;  5FZS A;  4PS7 A;  3D2F A;  2FF4 A;  5CHE E;  4WND A;  3ESL A;  3PUJ A;  4HLE A;  4IN3 B;  3PRE A;  4I9C A;  2WXF A;  2XPI A;  2X6J A;  4FU3 A;  4DI4 A;  1DKX A;  4I6G A;  3OXF A;  1NP7 A;  1B89 A;  2E2E A;  3HYM B;  4JWI A;  1P5Q A;  4L23 A;  4GZD A;  3CVU A;  4YND A;  3MA5 A;  4APO A;  2CHX A;  2GRM A;  4BY6 A;  4BFR A;  3FH7 A;  2QFC A;  2WMO A;  4B8C B;  2QXL A;  3HVE A;  3MGB A;  3TAX A;  2WXM A;  4EZO A;  5KJM A;  3D9J A;  4NQ0 A;  1EDU A;  4EBA A;  1H19 A;  1CKR A;  4JC8 A;  3MKR A;  3BG0 B;  3IHV A;  3SHF A;  2IFU A;  1UG3 A;  3FTU A;  3FUH A;  2J4D A;  3IEG A;  1OWO A;  3L17 A;  4GML A;  1H6K A;  3AS4 A;  3D3M A;  3FHE A;  2IOS A;  3ZW3 A;  3DPD A;  4F00 A;  4AP2 A;  1QNF A;  3PRZ A;  4GZ5 A;  2PM6 A;  4Y6W A;  5ANL A;  1W3B A;  3RJV A;  4ABN A;  4G11 A;  1XNF A;  3R7Q A;  1Z6T A;  2E0I A;  2IU1 A;  2J09 A;  3AU4 A;  2VGY A;  3ZHE A;  4AY6 A;  4JHJ A;  3G2S A;  3MKQ A;  2KZT A;  2WXH A;  4AXH A;  5BW8 C;  4L2Y A;  4C0M A;  4GCO A;  1WAO 1;  1E90 A;  4N3C A;  4UWK A;  3CQG B;  2YQ8 A;  1E96 B;  3FTS A;  4MKT A;  1KLX A;  4DI3 A;  4FA6 A;  4IUL A;  3UT7 A;  4EZX A;  3ML8 A;  3SGH A;  1IYG A;  4XKC A;  1IHG A;  4I17 A;  3CVP A;  2V5F A;  3CK9 A;  4Q96 A;  1TJC A;  1H2V C;  2WXI A;  3FWV A;  4FAD A;  3GW4 A;  4GA2 A;  3JQ1 A;  4GA1 A;  3Q47 B;  2AXV A;  4EZN A;  1SZA A;  5G55 A;  2FI7 A;  2LNI A;  3JQ0 A;  4JPS A;  1HXI A;  1UN8 A;  3FUF A;  1NA0 A;  3ESK A;  4I1M A;  4XI0 A;  1KT1 A;  3CHS A;  4EEC A;  5CCL A;  3S7D A;  3CEQ A;  4WAF A;  1JUQ A;  2WXR A;  4I6J A;  4EZS A;  3APC A;  4L7T A;  3S7F A;  4ANW A;  4ACK A;  5TKY A;  4B94 A;  2XPY A;  2AXZ A;  1HS6 A;  5DBK A;  4P29 A;  3S7B A;  3FTW A;  4LER A;  4ME2 A;  3L6A A;  2NSZ A;  3QAQ A;  1HF8 A;  4BTB A;  1BPR A;  4I1O B;  3ASD A;  2WXP A;  5JHB A;  3U64 A;  1OWN A;  1A17 A;  3EJN A;  3QB2 A;  4G1T A;  5G04 J;  2I6H A;  3RIB A;  3MX3 A;  3T8M A;  3VLD A;  4AV7 A;  4N2Q A;  2CFZ A;  3NZS A;  2KC7 A;  2CFU A;  3RK6 A;  1MHQ A;  2WVI A;  4GAA A;  5JJT A;  3DPQ A;  4FUL A;  1TJF A;  2RG8 A;  3LVR E;  3MV2 B;  3TG5 A;  1NA3 A;  2WXJ A;  2HR2 A;  4U0Z A;  1HO8 A;  4EZY A;  3Q4A B;  1HG5 A;  3R7R A;  3MJW A;  3RRN B;  2KCK A;  4EZK A;  2KM4 A;  1FVF A;  4CCA A;  4CGW A;  4URK A;  3U3W A;  1JPL A;  3JUI A;  4DLO A;  5KCM A;  2XGO A;  4KT6 B;  5EDS A;  3OXG A;  4IRU A;  4AY5 A;  3R9A B;  3ASG A;  4F53 A;  3N8E A;  4A1S A;  5LCW J;  4HOT A;  1YA0 A;  4JW1 A;  2PM7 A;  2I1K A;  3PE4 A;  4ILI A;  2VTB B;  2WQ7 A;  3C7N A;  3FU3 A;  1E7V A;  4XIF A;  4GYO A;  3AS5 A;  3QDN A;  3ZVV A;  4JHR A;  1U3C A;  4FJY A;  3RKV A;  4U07 A;  4APF A;  1PAQ A;  4RG9 A;  1XGW A;  2L6J A;  2V0P A;  4FL9 A;  2WXL A;  4GPK A;  3MKQ B;  5AJL A;  3KEZ A;  2J08 A;  3PVL A;  3CQC B;  2L0I A;  4GB9 A;  2X6H A;  4E85 A;  4U0U A;  4BX8 A;  1Z3X A;  2GGF A;  1VDY A;  3QKY A;  3NF1 A;  4Q94 A;  4OVV A;  3ZIM A;  2OP6 A;  5FZR A;  1E7U A;  3APD A;  2XGS A;  3LVQ E;  5LX8 A;  3QNK A;  3LPZ A;  3VTX A;  1OWP A;  5BPP A;  3DQG A;  3MCX A;  3LCA A;  4RSY A;  3VTY A;  2KAT A;  4U63 A;  3BEE A;  4GYY A;  5HI7 A;  2V7Y A;  3E4B A;  3FTV A;  4HOQ A;  5AEN A;  2IOL A;  4WV5 A;  2LAH A;  2HO1 A;  4XE0 A;  5C1D A;  1UW4 B;  3KAE A;  1BPO A;  5BT1 A;  4WNE A;  1OUV A;  2Y4U A;  2ILR A;  3HHM A;  3L22 A;  3TXN A;  3IKO B;  4M3O A;  1ELR A;  4DPR A;  2VGX B;  3CST A;  4HS2 A;  4EZT A;  3UMV A;  3BG1 B;  3SFZ A;  2ZU6 B;  3DPO A;  3Q15 A;  2WXN A;  4B89 A;  4LUN U;  3ONL A;  2BF0 X;  2I9C A;  1U3D A;  1DG4 A;  5J08 A;  2Q7F A;  1ZBP A;  4JVS A;  4JWE A;  2X3M A;  3VLE A;  3LKU A;  3GYZ A;  1H2U A;  2Y3A A;  1S0P A;  4WUY A;  2X6K A;  1DVP A;  3CKB A;  4AIF A;  2WPV A;  3CGH A;  1LF8 A;  4F7A A;  2OV8 A;  3ZYM A;  2J4B A;  3IHY A;  4UWL A;  3QWP A;  1ZU2 A;  3U4T A;  2IF4 A;  4G2V A;  4UI9 K;  2FBN A;  4A1G A;  4PS8 A;  4GA0 A;  3MYV A;  4R5I A;  1E8X A;  2IQC A;  4I1A A;  2WM9 A;  3CVX A;  4BT9 A;  4JNE A;  3UX4 A;  1HG2 A;  4NAC A;  3RO2 A;  4CDR A;  7HSC A;  3FY4 A;  3CVQ A;  4JA9 A;  2PZI A;  3UUX A;  2C0L A;  2JEK A;  3I4R B;  5KJL A;  3CKC A;  4FLB A;  4MQD A;  2AWI A;  3IBE A;  4FC8 A;  3PE3 A;  4YVQ C;  5AYW D;  3UT4 A;  3ULQ A;  4ATG A;  5HQ8 A;  3PDN A;  4UI9 C;  4KZC A;  3D9P A;  5A7D B;  4BSX A;  1TEZ A;  4R5L A;  2XEV A;  5FT9 A;  3D9K A;  1N52 A;  3RO3 A;  4HOR A;  3QWW A;  3CSF A;  3DPP A;  5E84 A;  4LCT A;  3ZXS A;  4PH4 B;  4KXK B;  1GW6 A;  1NZN A;  1Y8M A;  1HX8 A;  2AXU A;  4ILH B;  4XKB A;  3T5V A;  3CK7 A;  4UQX A;  3SD5 A;  5CMW A;  4EZU A;  3CK8 A;  4G23 A;  4GZ6 A;  4R5G A;  2V4L A;  4NRH B;  5AJD A;  2WXQ A;  5DIZ A;  3CIA A;  3QNJ A;  3SZ7 A;  4JNF A;  3CVY A;  4HOS A;  3QOU A;  3MZL B;  5JHA A;  2CG2 A;  2YNQ A;  4TV3 A;  4EZJ A;  3FH8 A;  5LP0 A;  3PH0 C;  2R59 A;  3FUD A;  2EQX A;  3B7R L;  3APF A;  4KVO A;  4ANV A;  4Q69 A;  2BTD A;  3B7S A;  4OYS A;  3ZFW A;  2XRY A;  3EIQ C;  3FTX A;  3FUJ A;  2YIN A;  4EPZ A;  2WXO A;  4IYP A;  3CHQ A;  4F1S A;  2V8S E;  4E81 A;  4HOU A;  4I2W A;  2UY1 A;  2M63 A;  5G04 C;  2HYZ A;  3U66 A;  1FVH A;  1PY1 A;  3JYS A;  5D0O D;  1SZ9 A;  3SBT B;  4OVU A;  3RRU A;  4U04 A;  5ARG A;  4I9E A;  3SF4 A;  3G2V A;  4CT0 A;  4CRW A;  3FUK A;  4A3T A;  4G24 A;  5E75 A;  3QK0 A;  4B8A A;  4AM9 A;  4AVX A;  2MOW A;  4UWH A;  1PC2 A;  3FH5 A;  3TL5 A;  2VSO E;  1X5B A;  4H7X A;  5ANR A;  4F01 A;  4A55 A;  3FU5 A;  3SNX A;  3HDX A;  3T5X A;  4I2Z A;  4C0E A;  5FZQ A;  3LYA A;  2VGX A;  1HU3 A;  4GZC A;  3UT8 A;  3ZEF A;  4AEZ C;  4UI9 J;  3C7N B;  5M72 A;  2WB2 A;  2KCV A;  3EDT B;  3FUI A;  1JWF A;  4EZR A;  5LCW C;  3FU6 A;  3CHP A;  3IV0 A;  3I3N A;  3ZHE B;  3ZRH A;  5CCM A;  2UY1 B;  2XPZ A;  2MRI A;  3B7T A;  3ZYK A;  3EHN A;  3CHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...