4ILIA

Crystal structure of an aar2p s253e phosphomimetic mutant protein
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
304
structure length
290
Chain Sequence
NTVPFTSAPIEVTIGIDQYSFNVKENQPFHGIKDIPIGHVHVIHFQHADNSSMRYGYWFDCRMGNFYIQYDPKDGLYKMMEERDGAKFENIVHNFKERQMMVSYPKIDEDDTWYNLTEFVQMDKIRKIVRKDENQFSYVDSSMTTVQENELSSSSSDPAHSLNYTVINFKSDKSYYLNTVMLQGIFKNSSNYFGELQFAFLNAMFFGNYGSSLQWHAMIELICSEATVPKHMLDKLDEILYYQIKTLPEQYSDILLNERVWNICLYSSFQKNSLHNTEKIMENKYPELLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A1 cistron-splicing factor AAR2
publication title Structural basis for dual roles of Aar2p in U5 snRNP assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Splicing
total genus 75
structure length 290
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.550 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4iliA02
2.60.34.20 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4iliA01
3SBTB 4ILHB 3ZEFA 3SBSA 4ILGA 4I43A 4ILIA
chains in the Genus database with same CATH superfamily
2YHCA 3PZ1A 4BFRA 5EIDA 1E90A 3OTNA 5JJ6A 3GYZA 1E8XA 5G05J 4MRUA 4E6HA 2J4BA 1QNFA 3RU0A 3E37A 2DYSE 2PNNA 2L6BA 3IHYA 1FT2A 4EZQA 4XZ4A 1QZ2A 2R17C 4MS6A 4DX7D 3L82A 3ONKA 3HXBA 3E33A 2HO1A 3EHRA 5ANLA 3RSEG 1XGWA 4LG6A 5CRVA 5AYWD 2WB2A 4G26A 3SI5A 2XGSA 4EHMA 2E0IA 5EKQD 4UI9J 4EPZA 3QWVA 5FTPA 4ZFHA 4ZHBA 4GTRA 5FWQA 2DCPA 4IYPA 3ASDA 1PC2A 2LNIA 1SQMA 3PUKA 3DSSA 3ENEA 1IHBA 1MQSA 3UTMA 1HXIA 4BEPA 4EZVA 3C72A 1O1TA 5AQAA 4DLOA 4XKBA 2X6FA 1SZAA 1UW4B 3AU4A 3Q5MA 1K3ZD 4ABNA 4WV7A 5ENQD 4BT9A 1OCRE 4FLBA 2OOEA 5KJLA 4H7YA 1OWPA 3Q47B 1JCQA 3SF4A 4JW1A 4LRZA 4DPRA 4G11A 1N0RA 4UQXA 3RJVA 1SVXA 4WV5A 2F0YA 3TG4A 4WWPA 3RK6A 2EIME 1OWLA 4CDMA 3AJIA 2ONDA 1FVFA 3B7RL 4B94A 1B89A 2DBAA 4O6FA 4LUNU 2V4LA 1H2UA 1KLXA 4R7LA 2PZIA 3GZ2A 3WXXA 3D9HA 4GPMA 3O48A 2PM7A 3FH5A 1JPLA 5M72A 2CHXA 5C2YA 1E96B 5ENNA 1WY6A 1DKXA 2XZDG 1NZNA 2AXUA 3UI2A 3CVQA 1MJ0A 1UN9A 3LVQE 1WAO1 3FY4A 1NFIE 4CGVA 3ASNE 3CHSA 2XCCA 4JZYA 4NRHB 2R05A 3CIAA 3PEUB 3DSWA 3LY9A 2IO2C 4YDOA 5FZRA 3G2VA 2XZTG 2NYJA 3PUJA 1EYHA 3TWRA 4NACA 4YDEA 4KZCA 2QXLA 4JC8A 4K03A 1FVHA 3P2BA 3SZ7A 3CV0A 3QNKA 3CVVA 5HS0A 3OXFA 3B13A 2I2OA 3VLDA 4JPSA 1TN8A 3GZ1A 1N11A 2VJ8A 3NZSA 3CLJA 3ML8A 3D9PA 4IN3B 3E32A 5H7PA 4U8YD 2WXFA 5CECB 3QOUA 3HXFA 3UUXA 4N39A 4A1GA 1U3CA 1MYOA 3D9NA 3UMVA 1WG0A 4UUCA 3C7NB 3Q75A 1IKND 2X6JA 3LS8A 3MCXA 1OCZE 3TG5A 3PE4A 2AWIA 4CCAA 2WQ6A 3R9AB 5JJTA 1LF8A 4B89A 2FULA 5A6CA 4GAAA 3TAXA 1Q2ZA 2J9QA 4XI0A 5D0QD 5FZSA 2UWJG 5BXUA 1PAQA 4YDWA 2RKKA 3DPOA 1Y8MA 4FADA 5ITZF 3RRMB 4GMLA 4HOTA 1RZ4A 2GRRB 4F6RD 1UJKA 1Z5SC 4ATGA 4M7CA 5G04C 3JQ0A 2XPYA 3LY8A 2QC9A 4OVVA 2VTBB 4HI9A 4I1OB 3SBTB 2V7YA 1IQUA 3L22A 4LNBA 4C48B 3FTVA 2BUGA 4H7XA 3DXMG 2XEVA 3KSLA 5AN8A 3LKUA 3ESKA 2WXLA 3ONLA 2X38A 4FULA 2WXPA 4FJYA 3QWPA 5CCMA 5JHAA 4LSZE 3DSXA 4HLEA 2V5FA 2Y4UA 3HVEB 4AY6A 1TEZA 3DOBA 4GTQA 4XIFA 2C2LA 4AEZC 1P5QA 2WMNA 4HYBA 3JUIA 2BEDA 4JB8P 3FH7A 5BV1A 4U95D 1TNOA 4EZPA 3FUIA 4J7WA 4DJAA 4U0SA 2KZTB 2ZISA 1O1SA 1TJCA 3UT8A 3MZLB 4BSXA 1TN7A 3FTZA 3CK7A 4GMJA 3ZPJA 3HXEA 3PZDA 4GZDA 2HE0A 2DYRE 3S7BA 2BKGA 3HHMA 4PUCA 5B3SE 2LXMA 3CVYA 5HKPA 3ZU7B 1E8YA 3F6QA 3TWSA 1RW2A 3CHOA 4UWGA 5ARGA 3SBSA 3G2TA 3P1UA 4EBAA 1HG2A 4HOQA 4TUUA 5G2NA 4G23A 1X5BA 3S7JA 3IKOB 4A3VA 3N8EA 3S7DA 3I5PA 2AXVA 4APOA 4DI3A 2YNQA 4OYSA 2H6HA 2CHWA 3MA5A 1FPPA 4GMRA 2WPVA 4JNEA 4GA0A 3UM3A 4EZWA 2LXLA 4PS3A 4UQYA 2JEKA 4EZOA 2WXGA 4WNEA 4QQIA 5G05C 4ACLA 4C9BB 1H2TC 3IHVA 3DWLG 2VYIA 2L6JA 4AM9A 4JNFA 3PE3A 2IONA 5CEAA 5LP0A 4OAVB 4JHKA 5CCLA 3SNXA 3SFYA 4I17A 1L5JA 5CHEE 3O4ZA 3ZYQA 3LJNA 5BPPA 2J08A 4RSYA 3KAEA 1SA5A 3U9WA 1HZ4A 1K8KG 2CFUA 4GTSA 1D9SA 3T9KA 2MHKA 2IU1A 4UI9C 2KCKA 3UIOC 1HS6A 1YMPA 2WXMA 2M63A 1E8ZA 4NURA 4FHKA 3C5RA 3C7NA 3NB2A 4WNFA 1ELKA 3L17A 4L7TA 4AIFA 2QFCA 4FP7A 2GW1A 3PDNA 3URZA 3G2WA 4EQFA 1OWOA 4G2VA 3UIPC 2WQHA 5CBOA 4EZJA 2FO1E 2PQNA 3FUJA 1MZCA 1D8EA 3L54A 1TN6A 2H6IA 4HRLA 2VSNA 2VTBA 2VGXB 3ZNGA 5AIJA 3X2QE 1H6PA 4CEMA 4BX8A 3PZ4A 5FQ6A 1N52A 1DKZA 3T8MA 1OXJA 1JWGA 1TYQG 2LUHA 4DK5A 4GPKA 2GRLA 2V8SE 4M3OA 3EHNA 1E7UA 2J07A 4KT6B 1NA0A 4KYOB 5G55A 4HFGA 1N94A 3HVEA 5FQ4A 3FUNA 1ZBPA 2A5EA 3MKQB 5KNGA 4WWOA 5LFAA 3QWWA 3J5PA 2KZTA 4BWRA 5LX8A 4R5GA 3ZYLA 4E85A 4LCTA 1JUQA 4Y6CA 3V31A 4FHJA 1SW6A 7HSCA 4ILGA 2L0TB 1BLXB 2EINE 3UT7A 3FU0A 3HXCA 4J8FA 3V2XA 3Q9UC 3CHMA 4YNDA 2I6HA 5FJYA 3HG0D 4GB9A 2Y0BG 3CHRA 1FT1A 1ZU2A 1EDUA 5EDSA 4EZLA 1KZPA 1BPRA 5EYLA 3TGOA 2R2LA 4F7AA 3FEYA 2JLBA 2Q7FA 4W9RA 1K1AA 4A55A 4K5AB 4MKTA 3ISMC 5D0OD 2Y4TA 2GRQB 2OEWA 3LDZA 2PM6A 2XRYA 5C1DA 5ENRD 4HY9A 5ENTD 1HX8A 4N5CA 4JWCA 2QYJA 4XEIG 1PY1A 4I6JA 2QY7A 3QC1A 3DEPA 5EX3A 4BERA 4GZCA 1JCRA 4HOSA 2B6CA 2DWZA 4UWHA 4G8LA 3FEXA 1GW6A 2IOSA 2KXPC 3AU5A 1TR4A 3D9MA 3ZYMA 2UY1B 4GTVA 3R9MA 1HH8A 5EIBE 2WXKA 4R5LA 3C3OA 5BUZA 2DZNA 1QYMA 2WXQA 4O1PA 2Y3AA 3K9IA 5BNWA 2YQ8A 3FUHA 3EU9A 4JL0A 2KM4A 4XX5A 5HI7A 3D2FA 1YCSB 2ETCA 3AG1E 2YINA 4ME2A 5AJDA 3SGHA 3EHQA 2XEEA 3ASFA 1SA4A 4HI8A 2QYUA 2WMOA 3CR3A 3QKYA 4BX9A 2ZXWE 2JABA 1E7VA 4JHJA 5CMYA 4EZRA 3QAQA 4O60A 3FULA 4OVUA 1DC2A 1E8WA 3PVLA 4B9QA 3Q49B 3HIZA 1EF1C 1ZB1A 4IRUA 4BTBA 3IEGA 2MRIA 2ETBA 3VLEA 2X6IA 4BETA 1DCEA 2IEJA 2VGXA 2WXRA 3FUEA 4KXKB 1TNZA 1INZA 4ANXA 4AJWA 3HRAA 3QARA 3C3QA 3ZGQA 3VTXA 5HQ8A 2C0LA 3RAUA 5ENSD 5AQ9A 4KVMA 4HQDA 2WXIA 1EPUA 3Q4AB 3ASGA 3PREA 3AG4E 2XS8A 3J5QB 3AS4A 2VSYA 4ANVA 3TL5A 1DG4A 4U96D 3L6AA 2MYOA 3MKQA 4I43A 1ELWA 4HVBA 4XI9A 4HOUA 4ATZD 1HFAA 3DSUA 2DVWA 3FTSA 1TNBA 2VSOE 5JHBA 3MX3A 4BSZB 2KCLA 4DLQA 5IY5E 3IXEA 4GA2A 2X6KA 3JQ1A 2E2EA 3CVWA 4APFA 5BT1A 3R7RA 4V3IA 4G24A 1XNFA 3MKRA 2IJGX 3NBNB 2FEZA 2P9KG 1MX2A 3SFXA 3CVLA 3KD7A 5T8IA 1Y6IA 2KC7A 4K5CA 3PRZA 3CK8A 3ASHA 3HXDA 1IQRA 4FU3A 3TXMA 3OXLA 5J90A 3QJZA 5KJNA 3TWXA 3FHEA 1N95A 3ZIMA 4LNGA 4J8SA 1DCQA 2RG8A 1CKRA 4FA6A 1DVPA 2VGYA 4F00A 1HF8A 2EQXA 3NF1A 2ZGGA 1KT1A 3RO3A 2GRPB 3CK9A 3EIQC 5AJLA 2IY0C 2XPZA 2J09A 1BD8A 4FJZA 4U0ZA 1QQEA 1U2VG 3I4GA 2H6FA 4G25A 3MJWA 3ESLA 2IO3C 4GZ6A 3DQGA 4J8EA 3ZW3A 3CHQA 3AS8A 3EJNA 4WUYA 3NOCD 3OXGA 2GRNB 3VLFA 2RD0A 4GYYA 2UY1A 1LD7A 1YA0A 4N3BA 3EHMA 1IYGA 3LY7A 4I9CA 3V79K 1HG5A 1BI7B 2GROB 5FINA 3B7UX 4ANUA 3JCKC 5LCWJ 4C0EA 3N71A 4EBAG 3ZN3A 4J8DA 4B8AA 1FCHA 2OEVA 4GTPA 3ABME 3CHPA 2ETAA 3T5VA 3ZXPA 3ZYKA 3RRUA 2AXZA 4F01A 4FC8A 3I3NA 2P9NG 4I6GA 3SD5A 4JVSA 3APCA 2ILRA 4A1SA 2X6HA 3TWVA 3JUEA 5T3RA 5EN5D 1H19A 3C98A 4FL9A 4DRXE 1OY3D 2H6GA 2FF4A 2XEHA 4KMOA 1OUVA 2IF4A 2F8YA 3U4TA 4TV3A 1MHQA 4K0RA 4NQ0A 3PZ3A 4EZXA 1A17A 4L2YA 5TKYA 1KPSB 3UM0A 2I1KA 3CVPA 1DNPA 4GTMA 4B93B 1OWNA 5ANRA 3KS2A 5AQBA 3FU6A 3Q9NC 2XGOA 3FFLA 3FDHA 2R59A 4GTTA 3C3RA 3IV0A 4F1SA 4TXRA 1BU9A 3LPZA 3RRNB 4JWDA 1Q5LA 2XCBA 2IQCA 3FUMA 3TWWA 4DUIA 1DKYA 2I9CA 1UN8A 1D8DA 3ABLE 1SZ9A 1H6KA 3U3WA 4Q94A 1AP7A 4XE0A 3T5XA 4EZTA 1H6OA 4U07A 2ZIRA 4LEUA 5J08A 1H2VC 3KSQA 1O1RA 3LJ3A 4YVQC 2YHEA 4QFVA 3DPDA 3UM1A 4RQIA 4GU5A 3FTUA 2V0PA 1UJJA 3MEKA 3U66A 3L13A 3DPPA 4CYMD 1KZOA 2KCVA 5CERB 1WM5A 3CVXA 4BESA 2XPIA 2BTDA 5T4YA 3AAAC 3DRAA 1N54A 1HU3A 5KCMA 3DPYA 1BPOA 2WM9A 4K5BA 3EIJA 5EX0A 1O5MA 3FU3A 3FTYA 2MOWA 4Z68A 3Q15A 2NXPA 4TRQA 1MX4A 1NP7A 3CGHA 4Q96A 4BT8A 3Q73A 2B0OE 3HYMB 3LCAA 2CFZA 3GZSA 3EDTB 2J8SD 4F1PA 1TJFA 3CQCB 1YYHA 4U63A 4UWKA 3FWVA 4AP2A 4JA9A 1VDYA 3CVUA 3APDA 3G2UA 3LVRE 3CEQA 3FP3A 3ZUVB 4R5JA 2WXOA 4R5IA 3B7SA 3LEWA 1OCOE 4N3AA 2AJAA 3ZKJA 3FUFA 1N4PA 4JWEA 4BY6A 4GYWA 4UWLA 3D9LA 2VSXE 1K1BA 4PS8A 1H0AA 2WQ7A 3FH8A 2EIJE 4EZKA 3EU5A 4ILIA 3HDXA 3TWUA 5EILA 4ILHB 3NQPA 5KBAA 5CMWA 1UOHA 4RVBA 5KWDA 2J49A 3ULEG 4U04A 2RFMA 5DBKA 3FUDA 5A7DB 4KZ0A 3Q78A 4E81A 3BUAA 3E4BA 2QZAA 3BG1B 2KHOA 3BEEA 2RFAA 1IXVA 3B95A 4EZNA 1Z6TA 3IBEA 4PH4B 3CKBA 4N5QA 4HRNA 4CRWA 3LYAA 2WXJA 4JEHA 4LERA 3BU8A 1G3NB 3DSVA 3Q7FA 4GCOA 2BKKB 4CT4A 4PDXA 4G8KA 5DIZA 4L2LA 5LOZA 4GZ5A 5BXOA 2VGEA 3KEZA 1X81A 3ML9A 4MLPA 3UKRG 2PL2A 5AAOA 4EZUA 4RG9A 4JHRA 2GGFA 4AVXA 2LSUA 3UINC 2KBXA 5BV0A 4R5KA 1HE8A 3U64A 1ELRA 4EZYA 5ARFA 4AV7A 3T8KA 3UQ3A 2XQ0A 3ABKE 4MBGA 4ACKA 4CDNA 1S64A 2P9PG 2IFUA 1LTXA 5CRUA 5KNHD 1AWCB 3RKVA 2P2CP 2AVPA 2OV8A 2WVIA 4WNDA 3CSFA 5B1AE 1MX6A 4HB5A 3DEOA 3E34A 5JJ7A 4FLHA 4EZSA 3L9TA 2ZGDA 3MV3B 3B7BA 5EYPF 2LAHA 2XENA 5AARA 3NZUA 3S2AA 1N4QA 3CKCA 4UI9K 2BF0X 2WXHA 3ZHEB 4GZ3A 1N4RA 3JXIA 3D2EA 3UPVA 1BI8B 4JA7A 2BPRA 4U8HA 4U0UA 3QK0A 2R02A 1V55E 3SHFA 4UWFA 5D2MC 2LAIA 3L16A 4TXPA 4YVOA 4KBQA 2R5SA 4AY5A 5FQ8A 3KEAA 2V5QC 2F37A 2WXNA 4L9PA 5KJMA 5LCWC 4TUMA 1Z3XA 3ZXSA 2VQ2A 5B1BE 3DBSA 4A3TA 4JWIA 3UM2A 2GRMA 3W9FA 4CZ2D 2HR2A 2LSVA 4AXHA 4I1AA 4I9EA 2NC9A 3AS5A 1IHGA 1TNUA 3L08A 4I2WA 2A4ZA 3Q79A 3TWTA 1JCSA 4OAUC 4IULA 2CG2A 1N9AA 4G1TA 4J6IA 1S70B 4DX1A 2R03A 3ZVVA 5FQ7A 3TWQA 4N3CA 4O1OA 5E75A 4LNUD 3PS6A 4PO2A 3UX4A 3GW4A 4YDYA 2I1JA 3SFZA 5FIOA 2OCCE 2PQRA 4J0UA 5ENPD 3AG3E 1QBQA 3W9GA 1N0QA 4HLLA 4EECA 4L1BA 5A23A 2AW6A 1YUWA 2Y1LE 3FU5A 4JXTA 3SY2A 2J4DA 2P9LG 1Z3YA 4B8CB 4C0MA 3ZRHA 4TXQA 2KATA 3WG7E 4DI4A 3R7QA 4GCNA 3FTWA 2ZU6B 3FUKA 4ANWA 3PNTB 2FI7A 2V4HC 5CBNA 4N2QA 3CSTA 1U00A 3DSTA 4P29A 5AQ7A 2XS1A 2CG3A 4RG6A 5E76A 5D66A 3B7TA 3ULYA 2DIWA 2P9SG 4BTAA 1A5EA 4WNGA 3CVNA 3D9KA 4GYOA 4UQZA 3V30A 4GA1A 3PNLB 4JD2G 1NA3A 4RLYA 3APFA 2C0MA 5AENA 3DXKG 3CQGB 2L9BA 4Q69A 5KJKA 4B0ZA 1HO8A 2XHEA 3SQVA 3LXUX 4Y6WA 2FBNA 3UT4A 2XGMA 4NIKA 5FZQA 3D9OA 5HRYA 2A5UA 3QNJA 4J8YA 3OAWA 4N2SA 4MQDA 4D10C 4I1MA 2OP6A 1JWFA 5CEDB 3MYVA 4JEUA 3S7FA 5JMND 2X3MA 1U3DA 2CHZA 1OWMA 3QDNA 1NL4A 3MV2B 4HRMB 1S63A 1KT0A 3G2SA 3ZHEA 1WDYA 4A63B 5G04J 4PS7A 3TXNA 3EUVA 4CT0A 4X8QA 2XRZA 2NSZA 5BW8C 3BQOA 3AG2E 3PEVB 4WWNA 3I4RB 1OCCE 1V54E 2OVFA 4HNAD 3D9IA 3RO2A 3ZFWA 4WAFA 1OT8A 3ASOE 3ZEFA 2P58C 2Y69E 3JXJA 4F3VA 4CGWA 4JN4A 1W3BA 4DX6D 4HS2A 1NI1A 3PZ2A 3PH0C 3D3MA 3Q7AA 4HBDA 4KVOA 3D9JA 4I6EA 4U7EB 4EZZA 3V2OA 4L23A 2LO6A 4GTOA 2EIKE 1TNYA 3VTYA 2F8XK 3UXGA 3UKUG 4DX5D 4XKCA 2OVBA 3RIBA 1S0PA 2HYZA 4F53A 2P9IG 1LD8A 3H0XA 3TJPA 3FTXA 3ULQA 1N4SA 5FT9A 4U8VD 5JA4D 4AOFA 3SO8A 3JYSA 4URKA 4DX2A 3QB2A 3DPQA 3NOGD 5E84A 4I2ZA 2IOLA 5ENOD 1UG3A 2FO7A 3E30A 3BG0B 2HM8A 3MGBA 4HORA 2L0IA 3NAWA 2P9UG 2DZOA 2EILE 4HXIA 4CDRA
chains in the Genus database with same CATH topology
2YHCA 4BFRA 2FEZA 3PE3A 2IFUA 1E90A 3OTNA 5JJ6A 3RKVA 3CVLA 2IONA 2AVPA 2OV8A 2WVIA 3GYZA 3KD7A 4WNDA 1E8XA 5G05J 3CSFA 5LP0A 4JHKA 4MRUA 4E6HA 5T8IA 5CCLA 2J4BA 3SNXA 1Y6IA 2KC7A 1QNFA 3PRZA 4I17A 3RU0A 5JJ7A 1L5JA 5CHEE 3IHYA 4FLHA 3O4ZA 3CK8A 3ZYQA 3ASHA 4EZSA 4EZQA 4XZ4A 3MV3B 1QZ2A 1IQRA 2R17C 4FU3A 3TXMA 5BPPA 2J08A 3OXLA 4RSYA 3KAEA 4MS6A 2LAHA 3U9WA 3QJZA 5KJNA 5J90A 3ONKA 1HZ4A 2CFUA 3FHEA 3NZUA 3S2AA 2MHKA 3ZIMA 2HO1A 2IU1A 3CKCA 4UI9C 4J8SA 4UI9K 2BF0X 2KCKA 2RG8A 2WXHA 4GZ3A 3ZHEB 4FA6A 1CKRA 1DVPA 2VGYA 4F00A 1HS6A 5ANLA 1HF8A 2EQXA 3NF1A 1KT1A 1XGWA 2WXMA 3CK9A 2M63A 1E8ZA 3EIQC 5AJLA 4NURA 3RO3A 3D2EA 5AYWD 4FHKA 2WB2A 2XPZA 3UPVA 2J09A 4G26A 3SI5A 2XGSA 3C7NA 4FJZA 4U0ZA 1QQEA 4JA7A 2E0IA 4WNFA 2BPRA 3I4GA 4UI9J 5EKQD 1ELKA 3L17A 4G25A 3MJWA 3ESLA 3QWVA 4L7TA 4U8HA 5FTPA 4EPZA 4U0UA 4GZ6A 4AIFA 3QK0A 2QFCA 4FP7A 2GW1A 3DQGA 3SHFA 4J8EA 3PDNA 4UWFA 5FWQA 2LAIA 3URZA 2DCPA 4IYPA 3ASDA 1PC2A 2LNIA 3G2WA 3L16A 4EQFA 3ZW3A 4YVOA 1SQMA 1OWOA 4G2VA 4KBQA 3CHQA 3PUKA 2R5SA 2WQHA 3AS8A 3ENEA 5FQ8A 4AY5A 3EJNA 4WUYA 1MQSA 2WXNA 5KJMA 3OXGA 4EZJA 5LCWC 1HXIA 3VLFA 1Z3XA 2PQNA 2RD0A 3ZXSA 4GYYA 2UY1A 4EZVA 3FUJA 2VQ2A 3DBSA 4A3TA 1YA0A 3L54A 3EHMA 4N3BA 4JWIA 1IYGA 3LY7A 4DLOA 4XKBA 4I9CA 2X6FA 1HG5A 2GRMA 1SZAA 1UW4B 2HR2A 2LSVA 2VSNA 3AU4A 4I1AA 3Q5MA 4AXHA 2VTBA 2VGXB 4I9EA 2NC9A 3B7UX 4ABNA 4ANUA 4WV7A 4B9QA 3AS5A 1IHGA 3JCKC 5LCWJ 5AIJA 4BT9A 4C0EA 3N71A 3L08A 4EBAG 3ZN3A 4FLBA 4J8DA 4B8AA 2OOEA 1FCHA 4I2WA 2A4ZA 4CEMA 5KJLA 4BX8A 4IULA 2CG2A 4H7YA 1OWPA 3Q47B 5FQ6A 4G1TA 1N52A 4JW1A 3SF4A 4J6IA 4LRZA 4DPRA 4G11A 1DKZA 4UQXA 3RJVA 3ZVVA 3CHPA 4WV5A 3T8MA 5FQ7A 1JWGA 4N3CA 3T5VA 3ZYKA 3TG4A 5E75A 3RRUA 4WWPA 2AXZA 3RK6A 4FC8A 4DK5A 4GPKA 3I3NA 4F01A 2GRLA 2V8SE 4I6GA 1OWLA 4M3OA 3SD5A 3PS6A 4CDMA 2ONDA 3EHNA 1FVFA 3B7RL 4JVSA 4B94A 1B89A 3APCA 2ILRA 3GW4A 3UX4A 1E7UA 4A1SA 2X6HA 2DBAA 2J07A 4O6FA 2I1JA 4KT6B 1NA0A 4KYOB 4LUNU 5G55A 3SFZA 2V4LA 4HFGA 1H2UA 3HVEA 1H19A 5T3RA 1KLXA 2PQRA 4R7LA 3C98A 5FQ4A 2PZIA 3FUNA 3GZ2A 4J0UA 1ZBPA 4FL9A 3WXXA 3MKQB 3O48A 4WWOA 2PM7A 3FH5A 5LFAA 1JPLA 5M72A 4EECA 3QWWA 4L1BA 5A23A 2FF4A 2AW6A 1YUWA 3FU5A 4JXTA 2CHXA 5C2YA 2KZTA 1E96B 5ENNA 4BWRA 5LX8A 2J4DA 4R5GA 3ZYLA 4E85A 1WY6A 4KMOA 1OUVA 1JUQA 1Z3YA 4LCTA 4B8CB 1DKXA 2IF4A 4Y6CA 1NZNA 2AXUA 3U4TA 4TV3A 4C0MA 3ZRHA 1MHQA 3CVQA 1UN9A 3LVQE 4FHJA 1WAO1 2KATA 3FY4A 4K0RA 4DI4A 3R7QA 7HSCA 4NQ0A 4GCNA 4CGVA 4ILGA 2L0TB 3CHSA 3FTWA 2ZU6B 2XCCA 3FUKA 3UT7A 1A17A 4JZYA 4L2YA 3FU0A 4NRHB 4ANWA 5TKYA 4EZXA 3PNTB 2I1KA 3CVPA 3CIAA 3PEUB 1DNPA 2FI7A 3LY9A 5FZRA 1OWNA 5ANRA 4N2QA 3G2VA 3PUJA 1EYHA 3KS2A 3CSTA 1U00A 4J8FA 3FU6A 4NACA 4P29A 3CHMA 4YNDA 2I6HA 2CG3A 4RG6A 2XGOA 5E76A 4KZCA 3FFLA 3FDHA 2QXLA 5FJYA 3B7TA 4GB9A 2R59A 2DIWA 4JC8A 4BTAA 4K03A 3CHRA 1FVHA 3IV0A 4F1SA 3P2BA 3SZ7A 4WNGA 1ZU2A 3CV0A 1EDUA 3QNKA 3CVVA 3OXFA 3LPZA 3B13A 5EDSA 3RRNB 4EZLA 4JWDA 1Q5LA 2XCBA 2IQCA 3CVNA 3FUMA 2I2OA 1BPRA 3VLDA 3D9KA 4JPSA 1DKYA 3GZ1A 2I9CA 4GYOA 1UN8A 2VJ8A 4UQZA 3NZSA 3TGOA 4GA1A 1SZ9A 4F7AA 1H6KA 3CLJA 3FEYA 3PNLB 3U3WA 2JLBA 2Q7FA 4W9RA 3ML8A 4Q94A 3D9PA 4A55A 4IN3B 4XE0A 3T5XA 2WXFA 4EZTA 4U07A 4MKTA 1NA3A 4LEUA 3QOUA 3UUXA 1H2VC 5J08A 5D0OD 2Y4TA 3APFA 4N39A 3LJ3A 4A1GA 2C0MA 5AENA 1U3CA 3CQGB 3LDZA 2L9BA 3D9NA 4YVQC 4Q69A 2YHEA 2PM6A 2XRYA 3UMVA 5C1DA 4HY9A 3C7NB 5KJKA 4QFVA 1HX8A 2X6JA 3DPDA 4N5CA 4B0ZA 3LS8A 1HO8A 3MCXA 2XHEA 4JWCA 3TG5A 3PE4A 3LXUX 2AWIA 4GU5A 4Y6WA 2FBNA 4CCAA 3FTUA 3R9AB 1PY1A 4I6JA 2QY7A 2V0PA 3QC1A 3UT4A 1LF8A 5JJTA 4B89A 2XGMA 1UJJA 2FULA 5EX3A 3MEKA 3U66A 3L13A 5FZQA 5A6CA 4GZCA 3DPPA 4HOSA 4GAAA 3TAXA 2J9QA 2KCVA 1WM5A 3CVXA 3D9OA 4XI0A 2XPIA 2A5UA 5D0QD 5FZSA 3QNJA 2BTDA 2UWJG 4UWHA 5T4YA 1PAQA 3OAWA 3DPOA 3FEXA 1N54A 1Y8MA 1HU3A 4FADA 1GW6A 4N2SA 4MQDA 3RRMB 4GMLA 2IOSA 5KCMA 4D10C 4HOTA 4I1MA 2OP6A 4PO2A 1BPOA 2WM9A 3AU5A 3D9MA 3ZYMA 2UY1B 1JWFA 3EIJA 1HH8A 1UJKA 3MYVA 4JEUA 5EX0A 3S7FA 3FU3A 2WXKA 4ATGA 5G04C 4R5LA 3FTYA 2XPYA 3JQ0A 3LY8A 2MOWA 2X3MA 3Q15A 1U3DA 2NXPA 4TRQA 1NP7A 1OWMA 2CHZA 3QDNA 3CGHA 5BUZA 2VTBB 4OVVA 2WXQA 4Q96A 4BT8A 4I1OB 2Y3AA 3K9IA 5BNWA 3HYMB 3LCAA 2YQ8A 2CFZA 3GZSA 3MV2B 3FUHA 3SBTB 2V7YA 3EDTB 1IQUA 3L22A 4JL0A 1KT0A 3G2SA 3ZHEA 1TJFA 3CQCB 2KM4A 4XX5A 5G04J 4U63A 4UWKA 4PS7A 3FWVA 3TXNA 4AP2A 5HI7A 3FTVA 4CT0A 3D2FA 2BUGA 4H7XA 2XRZA 2XEVA 1VDYA 2YINA 2NSZA 4JA9A 4ME2A 3CVUA 3APDA 3G2UA 3LVRE 5BW8C 3LKUA 5AJDA 3SGHA 3ESKA 2WXLA 3ASFA 3CEQA 3FP3A 2WMOA 3CR3A 3ONLA 3PEVB 4WWNA 3QKYA 4BX9A 2X38A 4FULA 4R5JA 2WXPA 2WXOA 1E7VA 4JHJA 4R5IA 3I4RB 3QWPA 4FJYA 5CMYA 3B7SA 4EZRA 5CCMA 5JHAA 3LEWA 2OVFA 4N3AA 4HLEA 3FUFA 3D9IA 3QAQA 2V5FA 4JWEA 3RO2A 4BY6A 3FULA 4GYWA 2Y4UA 3D9LA 3HVEB 2VSXE 4UWLA 3ZFWA 1TEZA 4AY6A 3DOBA 4PS8A 4OVUA 1H0AA 4XIFA 2C2LA 4WAFA 4AEZC 3ZEFA 3FH8A 2WQ7A 1E8WA 1P5QA 2P58C 2WMNA 3PVLA 4ILIA 3Q49B 3HIZA 1EF1C 4EZKA 3JUIA 3HDXA 4HYBA 3FH7A 4IRUA 4ILHB 3NQPA 4BTBA 3IEGA 5BV1A 4JNFA 5CMWA 4F3VA 4EZPA 2MRIA 4CGWA 3FUIA 4DJAA 4U0SA 2KZTB 4JN4A 1W3BA 4HS2A 4RVBA 2J49A 3VLEA 4U04A 3PH0C 2X6IA 3D3MA 1TJCA 3UT8A 3MZLB 4BSXA 5DBKA 3FUDA 2VGXA 2WXRA 5A7DB 3FUEA 3FTZA 3CK7A 3D9JA 4GMJA 4KVOA 4KZ0A 3ZPJA 3PZDA 4KXKB 4I6EA 4EZZA 1INZA 4E81A 4GZDA 4ANXA 4L23A 2LO6A 4AJWA 3E4BA 3BG1B 2KHOA 2WQ6A 3QARA 3S7BA 3BEEA 3ZGQA 3VTXA 5HQ8A 3HHMA 4PUCA 4EZNA 1Z6TA 3IBEA 2C0LA 4PH4B 3CKBA 3VTYA 3CVYA 1E8YA 4KVMA 4CRWA 3CHOA 3LYAA 2WXIA 1EPUA 2WXJA 3Q4AB 3ASGA 4UWGA 5ARGA 3SBSA 3G2TA 3PREA 3P1UA 4EBAA 4JEHA 4LERA 3AS4A 2VSYA 1HG2A 4HOQA 4ANVA 4XKCA 4TUUA 4GCOA 4CT4A 4PDXA 5G2NA 2OVBA 3TL5A 3RIBA 1S0PA 2HYZA 4G23A 4L2LA 5DIZA 1X5BA 3S7JA 4F53A 5LOZA 4GZ5A 1DG4A 3H0XA 3IKOB 4A3VA 3L6AA 3N8EA 3S7DA 3I5PA 3MKQA 2AXVA 4I43A 1ELWA 3TJPA 3KEZA 4APOA 3FTXA 3ML9A 4MLPA 4DI3A 3ULQA 4HVBA 5FT9A 4XI9A 4HOUA 4AOFA 2YNQA 2PL2A 3JYSA 4OYSA 4EZUA 1HFAA 3MKRA 4RG9A 2CHWA 4URKA 3QB2A 4JHRA 2GGFA 4AVXA 3DPQA 3MA5A 3FTSA 2LSUA 2WPVA 4JNEA 5E84A 4GA0A 4I2ZA 2IOLA 2VSOE 5BV0A 4R5KA 4EZWA 1HE8A 5JHBA 1UG3A 4PS3A 2FO7A 3MX3A 4UQYA 2JEKA 2KCLA 4DLQA 4EZOA 3U64A 3BG0B 1ELRA 2WXGA 2HM8A 3MGBA 4WNEA 4HORA 4EZYA 4GA2A 2X6KA 3JQ1A 5G05C 4ACLA 2L0IA 2E2EA 5ARFA 3CVWA 4AV7A 3UQ3A 4C9BB 1H2TC 2XQ0A 4APFA 3IHVA 5BT1A 4ACKA 2VYIA 2L6JA 4HXIA 3R7RA 4CDNA 4CDRA 4V3IA 4AM9A 4G24A 1XNFA 2IJGX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SBT B;  4ILH B;  3ZEF A;  3SBS A;  4ILG A;  4I43 A;  4ILI A; 
#chains in the Genus database with same CATH topology
 2YHC A;  3PZ1 A;  4BFR A;  5EID A;  1E90 A;  3OTN A;  5JJ6 A;  3GYZ A;  1E8X A;  5G05 J;  4MRU A;  4E6H A;  2J4B A;  1QNF A;  3RU0 A;  3E37 A;  2DYS E;  2PNN A;  2L6B A;  3IHY A;  1FT2 A;  4EZQ A;  4XZ4 A;  1QZ2 A;  2R17 C;  4MS6 A;  4DX7 D;  3L82 A;  3ONK A;  3HXB A;  3E33 A;  2HO1 A;  3EHR A;  5ANL A;  3RSE G;  1XGW A;  4LG6 A;  5CRV A;  5AYW D;  2WB2 A;  4G26 A;  3SI5 A;  2XGS A;  4EHM A;  2E0I A;  5EKQ D;  4UI9 J;  4EPZ A;  3QWV A;  5FTP A;  4ZFH A;  4ZHB A;  4GTR A;  5FWQ A;  2DCP A;  4IYP A;  3ASD A;  1PC2 A;  2LNI A;  1SQM A;  3PUK A;  3DSS A;  3ENE A;  1IHB A;  1MQS A;  3UTM A;  1HXI A;  4BEP A;  4EZV A;  3C72 A;  1O1T A;  5AQA A;  4DLO A;  4XKB A;  2X6F A;  1SZA A;  1UW4 B;  3AU4 A;  3Q5M A;  1K3Z D;  4ABN A;  4WV7 A;  5ENQ D;  4BT9 A;  1OCR E;  4FLB A;  2OOE A;  5KJL A;  4H7Y A;  1OWP A;  3Q47 B;  1JCQ A;  3SF4 A;  4JW1 A;  4LRZ A;  4DPR A;  4G11 A;  1N0R A;  4UQX A;  3RJV A;  1SVX A;  4WV5 A;  2F0Y A;  3TG4 A;  4WWP A;  3RK6 A;  2EIM E;  1OWL A;  4CDM A;  3AJI A;  2OND A;  1FVF A;  3B7R L;  4B94 A;  1B89 A;  2DBA A;  4O6F A;  4LUN U;  2V4L A;  1H2U A;  1KLX A;  4R7L A;  2PZI A;  3GZ2 A;  3WXX A;  3D9H A;  4GPM A;  3O48 A;  2PM7 A;  3FH5 A;  1JPL A;  5M72 A;  2CHX A;  5C2Y A;  1E96 B;  5ENN A;  1WY6 A;  1DKX A;  2XZD G;  1NZN A;  2AXU A;  3UI2 A;  3CVQ A;  1MJ0 A;  1UN9 A;  3LVQ E;  1WAO 1;  3FY4 A;  1NFI E;  4CGV A;  3ASN E;  3CHS A;  2XCC A;  4JZY A;  4NRH B;  2R05 A;  3CIA A;  3PEU B;  3DSW A;  3LY9 A;  2IO2 C;  4YDO A;  5FZR A;  3G2V A;  2XZT G;  2NYJ A;  3PUJ A;  1EYH A;  3TWR A;  4NAC A;  4YDE A;  4KZC A;  2QXL A;  4JC8 A;  4K03 A;  1FVH A;  3P2B A;  3SZ7 A;  3CV0 A;  3QNK A;  3CVV A;  5HS0 A;  3OXF A;  3B13 A;  2I2O A;  3VLD A;  4JPS A;  1TN8 A;  3GZ1 A;  1N11 A;  2VJ8 A;  3NZS A;  3CLJ A;  3ML8 A;  3D9P A;  4IN3 B;  3E32 A;  5H7P A;  4U8Y D;  2WXF A;  5CEC B;  3QOU A;  3HXF A;  3UUX A;  4N39 A;  4A1G A;  1U3C A;  1MYO A;  3D9N A;  3UMV A;  1WG0 A;  4UUC A;  3C7N B;  3Q75 A;  1IKN D;  2X6J A;  3LS8 A;  3MCX A;  1OCZ E;  3TG5 A;  3PE4 A;  2AWI A;  4CCA A;  2WQ6 A;  3R9A B;  5JJT A;  1LF8 A;  4B89 A;  2FUL A;  5A6C A;  4GAA A;  3TAX A;  1Q2Z A;  2J9Q A;  4XI0 A;  5D0Q D;  5FZS A;  2UWJ G;  5BXU A;  1PAQ A;  4YDW A;  2RKK A;  3DPO A;  1Y8M A;  4FAD A;  5ITZ F;  3RRM B;  4GML A;  4HOT A;  1RZ4 A;  2GRR B;  4F6R D;  1UJK A;  1Z5S C;  4ATG A;  4M7C A;  5G04 C;  3JQ0 A;  2XPY A;  3LY8 A;  2QC9 A;  4OVV A;  2VTB B;  4HI9 A;  4I1O B;  3SBT B;  2V7Y A;  1IQU A;  3L22 A;  4LNB A;  4C48 B;  3FTV A;  2BUG A;  4H7X A;  3DXM G;  2XEV A;  3KSL A;  5AN8 A;  3LKU A;  3ESK A;  2WXL A;  3ONL A;  2X38 A;  4FUL A;  2WXP A;  4FJY A;  3QWP A;  5CCM A;  5JHA A;  4LSZ E;  3DSX A;  4HLE A;  2V5F A;  2Y4U A;  3HVE B;  4AY6 A;  1TEZ A;  3DOB A;  4GTQ A;  4XIF A;  2C2L A;  4AEZ C;  1P5Q A;  2WMN A;  4HYB A;  3JUI A;  2BED A;  4JB8 P;  3FH7 A;  5BV1 A;  4U95 D;  1TNO A;  4EZP A;  3FUI A;  4J7W A;  4DJA A;  4U0S A;  2KZT B;  2ZIS A;  1O1S A;  1TJC A;  3UT8 A;  3MZL B;  4BSX A;  1TN7 A;  3FTZ A;  3CK7 A;  4GMJ A;  3ZPJ A;  3HXE A;  3PZD A;  4GZD A;  2HE0 A;  2DYR E;  3S7B A;  2BKG A;  3HHM A;  4PUC A;  5B3S E;  2LXM A;  3CVY A;  5HKP A;  3ZU7 B;  1E8Y A;  3F6Q A;  3TWS A;  1RW2 A;  3CHO A;  4UWG A;  5ARG A;  3SBS A;  3G2T A;  3P1U A;  4EBA A;  1HG2 A;  4HOQ A;  4TUU A;  5G2N A;  4G23 A;  1X5B A;  3S7J A;  3IKO B;  4A3V A;  3N8E A;  3S7D A;  3I5P A;  2AXV A;  4APO A;  4DI3 A;  2YNQ A;  4OYS A;  2H6H A;  2CHW A;  3MA5 A;  1FPP A;  4GMR A;  2WPV A;  4JNE A;  4GA0 A;  3UM3 A;  4EZW A;  2LXL A;  4PS3 A;  4UQY A;  2JEK A;  4EZO A;  2WXG A;  4WNE A;  4QQI A;  5G05 C;  4ACL A;  4C9B B;  1H2T C;  3IHV A;  3DWL G;  2VYI A;  2L6J A;  4AM9 A;  4JNF A;  3PE3 A;  2ION A;  5CEA A;  5LP0 A;  4OAV B;  4JHK A;  5CCL A;  3SNX A;  3SFY A;  4I17 A;  1L5J A;  5CHE E;  3O4Z A;  3ZYQ A;  3LJN A;  5BPP A;  2J08 A;  4RSY A;  3KAE A;  1SA5 A;  3U9W A;  1HZ4 A;  1K8K G;  2CFU A;  4GTS A;  1D9S A;  3T9K A;  2MHK A;  2IU1 A;  4UI9 C;  2KCK A;  3UIO C;  1HS6 A;  1YMP A;  2WXM A;  2M63 A;  1E8Z A;  4NUR A;  4FHK A;  3C5R A;  3C7N A;  3NB2 A;  4WNF A;  1ELK A;  3L17 A;  4L7T A;  4AIF A;  2QFC A;  4FP7 A;  2GW1 A;  3PDN A;  3URZ A;  3G2W A;  4EQF A;  1OWO A;  4G2V A;  3UIP C;  2WQH A;  5CBO A;  4EZJ A;  2FO1 E;  2PQN A;  3FUJ A;  1MZC A;  1D8E A;  3L54 A;  1TN6 A;  2H6I A;  4HRL A;  2VSN A;  2VTB A;  2VGX B;  3ZNG A;  5AIJ A;  3X2Q E;  1H6P A;  4CEM A;  4BX8 A;  3PZ4 A;  5FQ6 A;  1N52 A;  1DKZ A;  3T8M A;  1OXJ A;  1JWG A;  1TYQ G;  2LUH A;  4DK5 A;  4GPK A;  2GRL A;  2V8S E;  4M3O A;  3EHN A;  1E7U A;  2J07 A;  4KT6 B;  1NA0 A;  4KYO B;  5G55 A;  4HFG A;  1N94 A;  3HVE A;  5FQ4 A;  3FUN A;  1ZBP A;  2A5E A;  3MKQ B;  5KNG A;  4WWO A;  5LFA A;  3QWW A;  3J5P A;  2KZT A;  4BWR A;  5LX8 A;  4R5G A;  3ZYL A;  4E85 A;  4LCT A;  1JUQ A;  4Y6C A;  3V31 A;  4FHJ A;  1SW6 A;  7HSC A;  4ILG A;  2L0T B;  1BLX B;  2EIN E;  3UT7 A;  3FU0 A;  3HXC A;  4J8F A;  3V2X A;  3Q9U C;  3CHM A;  4YND A;  2I6H A;  5FJY A;  3HG0 D;  4GB9 A;  2Y0B G;  3CHR A;  1FT1 A;  1ZU2 A;  1EDU A;  5EDS A;  4EZL A;  1KZP A;  1BPR A;  5EYL A;  3TGO A;  2R2L A;  4F7A A;  3FEY A;  2JLB A;  2Q7F A;  4W9R A;  1K1A A;  4A55 A;  4K5A B;  4MKT A;  3ISM C;  5D0O D;  2Y4T A;  2GRQ B;  2OEW A;  3LDZ A;  2PM6 A;  2XRY A;  5C1D A;  5ENR D;  4HY9 A;  5ENT D;  1HX8 A;  4N5C A;  4JWC A;  2QYJ A;  4XEI G;  1PY1 A;  4I6J A;  2QY7 A;  3QC1 A;  3DEP A;  5EX3 A;  4BER A;  4GZC A;  1JCR A;  4HOS A;  2B6C A;  2DWZ A;  4UWH A;  4G8L A;  3FEX A;  1GW6 A;  2IOS A;  2KXP C;  3AU5 A;  1TR4 A;  3D9M A;  3ZYM A;  2UY1 B;  4GTV A;  3R9M A;  1HH8 A;  5EIB E;  2WXK A;  4R5L A;  3C3O A;  5BUZ A;  2DZN A;  1QYM A;  2WXQ A;  4O1P A;  2Y3A A;  3K9I A;  5BNW A;  2YQ8 A;  3FUH A;  3EU9 A;  4JL0 A;  2KM4 A;  4XX5 A;  5HI7 A;  3D2F A;  1YCS B;  2ETC A;  3AG1 E;  2YIN A;  4ME2 A;  5AJD A;  3SGH A;  3EHQ A;  2XEE A;  3ASF A;  1SA4 A;  4HI8 A;  2QYU A;  2WMO A;  3CR3 A;  3QKY A;  4BX9 A;  2ZXW E;  2JAB A;  1E7V A;  4JHJ A;  5CMY A;  4EZR A;  3QAQ A;  4O60 A;  3FUL A;  4OVU A;  1DC2 A;  1E8W A;  3PVL A;  4B9Q A;  3Q49 B;  3HIZ A;  1EF1 C;  1ZB1 A;  4IRU A;  4BTB A;  3IEG A;  2MRI A;  2ETB A;  3VLE A;  2X6I A;  4BET A;  1DCE A;  2IEJ A;  2VGX A;  2WXR A;  3FUE A;  4KXK B;  1TNZ A;  1INZ A;  4ANX A;  4AJW A;  3HRA A;  3QAR A;  3C3Q A;  3ZGQ A;  3VTX A;  5HQ8 A;  2C0L A;  3RAU A;  5ENS D;  5AQ9 A;  4KVM A;  4HQD A;  2WXI A;  1EPU A;  3Q4A B;  3ASG A;  3PRE A;  3AG4 E;  2XS8 A;  3J5Q B;  3AS4 A;  2VSY A;  4ANV A;  3TL5 A;  1DG4 A;  4U96 D;  3L6A A;  2MYO A;  3MKQ A;  4I43 A;  1ELW A;  4HVB A;  4XI9 A;  4HOU A;  4ATZ D;  1HFA A;  3DSU A;  2DVW A;  3FTS A;  1TNB A;  2VSO E;  5JHB A;  3MX3 A;  4BSZ B;  2KCL A;  4DLQ A;  5IY5 E;  3IXE A;  4GA2 A;  2X6K A;  3JQ1 A;  2E2E A;  3CVW A;  4APF A;  5BT1 A;  3R7R A;  4V3I A;  4G24 A;  1XNF A;  3MKR A;  2IJG X;  3NBN B;  2FEZ A;  2P9K G;  1MX2 A;  3SFX A;  3CVL A;  3KD7 A;  5T8I A;  1Y6I A;  2KC7 A;  4K5C A;  3PRZ A;  3CK8 A;  3ASH A;  3HXD A;  1IQR A;  4FU3 A;  3TXM A;  3OXL A;  5J90 A;  3QJZ A;  5KJN A;  3TWX A;  3FHE A;  1N95 A;  3ZIM A;  4LNG A;  4J8S A;  1DCQ A;  2RG8 A;  1CKR A;  4FA6 A;  1DVP A;  2VGY A;  4F00 A;  1HF8 A;  2EQX A;  3NF1 A;  2ZGG A;  1KT1 A;  3RO3 A;  2GRP B;  3CK9 A;  3EIQ C;  5AJL A;  2IY0 C;  2XPZ A;  2J09 A;  1BD8 A;  4FJZ A;  4U0Z A;  1QQE A;  1U2V G;  3I4G A;  2H6F A;  4G25 A;  3MJW A;  3ESL A;  2IO3 C;  4GZ6 A;  3DQG A;  4J8E A;  3ZW3 A;  3CHQ A;  3AS8 A;  3EJN A;  4WUY A;  3NOC D;  3OXG A;  2GRN B;  3VLF A;  2RD0 A;  4GYY A;  2UY1 A;  1LD7 A;  1YA0 A;  4N3B A;  3EHM A;  1IYG A;  3LY7 A;  4I9C A;  3V79 K;  1HG5 A;  1BI7 B;  2GRO B;  5FIN A;  3B7U X;  4ANU A;  3JCK C;  5LCW J;  4C0E A;  3N71 A;  4EBA G;  3ZN3 A;  4J8D A;  4B8A A;  1FCH A;  2OEV A;  4GTP A;  3ABM E;  3CHP A;  2ETA A;  3T5V A;  3ZXP A;  3ZYK A;  3RRU A;  2AXZ A;  4F01 A;  4FC8 A;  3I3N A;  2P9N G;  4I6G A;  3SD5 A;  4JVS A;  3APC A;  2ILR A;  4A1S A;  2X6H A;  3TWV A;  3JUE A;  5T3R A;  5EN5 D;  1H19 A;  3C98 A;  4FL9 A;  4DRX E;  1OY3 D;  2H6G A;  2FF4 A;  2XEH A;  4KMO A;  1OUV A;  2IF4 A;  2F8Y A;  3U4T A;  4TV3 A;  1MHQ A;  4K0R A;  4NQ0 A;  3PZ3 A;  4EZX A;  1A17 A;  4L2Y A;  5TKY A;  1KPS B;  3UM0 A;  2I1K A;  3CVP A;  1DNP A;  4GTM A;  4B93 B;  1OWN A;  5ANR A;  3KS2 A;  5AQB A;  3FU6 A;  3Q9N C;  2XGO A;  3FFL A;  3FDH A;  2R59 A;  4GTT A;  3C3R A;  3IV0 A;  4F1S A;  4TXR A;  1BU9 A;  3LPZ A;  3RRN B;  4JWD A;  1Q5L A;  2XCB A;  2IQC A;  3FUM A;  3TWW A;  4DUI A;  1DKY A;  2I9C A;  1UN8 A;  1D8D A;  3ABL E;  1SZ9 A;  1H6K A;  3U3W A;  4Q94 A;  1AP7 A;  4XE0 A;  3T5X A;  4EZT A;  1H6O A;  4U07 A;  2ZIR A;  4LEU A;  5J08 A;  1H2V C;  3KSQ A;  1O1R A;  3LJ3 A;  4YVQ C;  2YHE A;  4QFV A;  3DPD A;  3UM1 A;  4RQI A;  4GU5 A;  3FTU A;  2V0P A;  1UJJ A;  3MEK A;  3U66 A;  3L13 A;  3DPP A;  4CYM D;  1KZO A;  2KCV A;  5CER B;  1WM5 A;  3CVX A;  4BES A;  2XPI A;  2BTD A;  5T4Y A;  3AAA C;  3DRA A;  1N54 A;  1HU3 A;  5KCM A;  3DPY A;  1BPO A;  2WM9 A;  4K5B A;  3EIJ A;  5EX0 A;  1O5M A;  3FU3 A;  3FTY A;  2MOW A;  4Z68 A;  3Q15 A;  2NXP A;  4TRQ A;  1MX4 A;  1NP7 A;  3CGH A;  4Q96 A;  4BT8 A;  3Q73 A;  2B0O E;  3HYM B;  3LCA A;  2CFZ A;  3GZS A;  3EDT B;  2J8S D;  4F1P A;  1TJF A;  3CQC B;  1YYH A;  4U63 A;  4UWK A;  3FWV A;  4AP2 A;  4JA9 A;  1VDY A;  3CVU A;  3APD A;  3G2U A;  3LVR E;  3CEQ A;  3FP3 A;  3ZUV B;  4R5J A;  2WXO A;  4R5I A;  3B7S A;  3LEW A;  1OCO E;  4N3A A;  2AJA A;  3ZKJ A;  3FUF A;  1N4P A;  4JWE A;  4BY6 A;  4GYW A;  4UWL A;  3D9L A;  2VSX E;  1K1B A;  4PS8 A;  1H0A A;  2WQ7 A;  3FH8 A;  2EIJ E;  4EZK A;  3EU5 A;  4ILI A;  3HDX A;  3TWU A;  5EIL A;  4ILH B;  3NQP A;  5KBA A;  5CMW A;  1UOH A;  4RVB A;  5KWD A;  2J49 A;  3ULE G;  4U04 A;  2RFM A;  5DBK A;  3FUD A;  5A7D B;  4KZ0 A;  3Q78 A;  4E81 A;  3BUA A;  3E4B A;  2QZA A;  3BG1 B;  2KHO A;  3BEE A;  2RFA A;  1IXV A;  3B95 A;  4EZN A;  1Z6T A;  3IBE A;  4PH4 B;  3CKB A;  4N5Q A;  4HRN A;  4CRW A;  3LYA A;  2WXJ A;  4JEH A;  4LER A;  3BU8 A;  1G3N B;  3DSV A;  3Q7F A;  4GCO A;  2BKK B;  4CT4 A;  4PDX A;  4G8K A;  5DIZ A;  4L2L A;  5LOZ A;  4GZ5 A;  5BXO A;  2VGE A;  3KEZ A;  1X81 A;  3ML9 A;  4MLP A;  3UKR G;  2PL2 A;  5AAO A;  4EZU A;  4RG9 A;  4JHR A;  2GGF A;  4AVX A;  2LSU A;  3UIN C;  2KBX A;  5BV0 A;  4R5K A;  1HE8 A;  3U64 A;  1ELR A;  4EZY A;  5ARF A;  4AV7 A;  3T8K A;  3UQ3 A;  2XQ0 A;  3ABK E;  4MBG A;  4ACK A;  4CDN A;  1S64 A;  2P9P G;  2IFU A;  1LTX A;  5CRU A;  5KNH D;  1AWC B;  3RKV A;  2P2C P;  2AVP A;  2OV8 A;  2WVI A;  4WND A;  3CSF A;  5B1A E;  1MX6 A;  4HB5 A;  3DEO A;  3E34 A;  5JJ7 A;  4FLH A;  4EZS A;  3L9T A;  2ZGD A;  3MV3 B;  3B7B A;  5EYP F;  2LAH A;  2XEN A;  5AAR A;  3NZU A;  3S2A A;  1N4Q A;  3CKC A;  4UI9 K;  2BF0 X;  2WXH A;  3ZHE B;  4GZ3 A;  1N4R A;  3JXI A;  3D2E A;  3UPV A;  1BI8 B;  4JA7 A;  2BPR A;  4U8H A;  4U0U A;  3QK0 A;  2R02 A;  1V55 E;  3SHF A;  4UWF A;  5D2M C;  2LAI A;  3L16 A;  4TXP A;  4YVO A;  4KBQ A;  2R5S A;  4AY5 A;  5FQ8 A;  3KEA A;  2V5Q C;  2F37 A;  2WXN A;  4L9P A;  5KJM A;  5LCW C;  4TUM A;  1Z3X A;  3ZXS A;  2VQ2 A;  5B1B E;  3DBS A;  4A3T A;  4JWI A;  3UM2 A;  2GRM A;  3W9F A;  4CZ2 D;  2HR2 A;  2LSV A;  4AXH A;  4I1A A;  4I9E A;  2NC9 A;  3AS5 A;  1IHG A;  1TNU A;  3L08 A;  4I2W A;  2A4Z A;  3Q79 A;  3TWT A;  1JCS A;  4OAU C;  4IUL A;  2CG2 A;  1N9A A;  4G1T A;  4J6I A;  1S70 B;  4DX1 A;  2R03 A;  3ZVV A;  5FQ7 A;  3TWQ A;  4N3C A;  4O1O A;  5E75 A;  4LNU D;  3PS6 A;  4PO2 A;  3UX4 A;  3GW4 A;  4YDY A;  2I1J A;  3SFZ A;  5FIO A;  2OCC E;  2PQR A;  4J0U A;  5ENP D;  3AG3 E;  1QBQ A;  3W9G A;  1N0Q A;  4HLL A;  4EEC A;  4L1B A;  5A23 A;  2AW6 A;  1YUW A;  2Y1L E;  3FU5 A;  4JXT A;  3SY2 A;  2J4D A;  2P9L G;  1Z3Y A;  4B8C B;  4C0M A;  3ZRH A;  4TXQ A;  2KAT A;  3WG7 E;  4DI4 A;  3R7Q A;  4GCN A;  3FTW A;  2ZU6 B;  3FUK A;  4ANW A;  3PNT B;  2FI7 A;  2V4H C;  5CBN A;  4N2Q A;  3CST A;  1U00 A;  3DST A;  4P29 A;  5AQ7 A;  2XS1 A;  2CG3 A;  4RG6 A;  5E76 A;  5D66 A;  3B7T A;  3ULY A;  2DIW A;  2P9S G;  4BTA A;  1A5E A;  4WNG A;  3CVN A;  3D9K A;  4GYO A;  4UQZ A;  3V30 A;  4GA1 A;  3PNL B;  4JD2 G;  1NA3 A;  4RLY A;  3APF A;  2C0M A;  5AEN A;  3DXK G;  3CQG B;  2L9B A;  4Q69 A;  5KJK A;  4B0Z A;  1HO8 A;  2XHE A;  3SQV A;  3LXU X;  4Y6W A;  2FBN A;  3UT4 A;  2XGM A;  4NIK A;  5FZQ A;  3D9O A;  5HRY A;  2A5U A;  3QNJ A;  4J8Y A;  3OAW A;  4N2S A;  4MQD A;  4D10 C;  4I1M A;  2OP6 A;  1JWF A;  5CED B;  3MYV A;  4JEU A;  3S7F A;  5JMN D;  2X3M A;  1U3D A;  2CHZ A;  1OWM A;  3QDN A;  1NL4 A;  3MV2 B;  4HRM B;  1S63 A;  1KT0 A;  3G2S A;  3ZHE A;  1WDY A;  4A63 B;  5G04 J;  4PS7 A;  3TXN A;  3EUV A;  4CT0 A;  4X8Q A;  2XRZ A;  2NSZ A;  5BW8 C;  3BQO A;  3AG2 E;  3PEV B;  4WWN A;  3I4R B;  1OCC E;  1V54 E;  2OVF A;  4HNA D;  3D9I A;  3RO2 A;  3ZFW A;  4WAF A;  1OT8 A;  3ASO E;  3ZEF A;  2P58 C;  2Y69 E;  3JXJ A;  4F3V A;  4CGW A;  4JN4 A;  1W3B A;  4DX6 D;  4HS2 A;  1NI1 A;  3PZ2 A;  3PH0 C;  3D3M A;  3Q7A A;  4HBD A;  4KVO A;  3D9J A;  4I6E A;  4U7E B;  4EZZ A;  3V2O A;  4L23 A;  2LO6 A;  4GTO A;  2EIK E;  1TNY A;  3VTY A;  2F8X K;  3UXG A;  3UKU G;  4DX5 D;  4XKC A;  2OVB A;  3RIB A;  1S0P A;  2HYZ A;  4F53 A;  2P9I G;  1LD8 A;  3H0X A;  3TJP A;  3FTX A;  3ULQ A;  1N4S A;  5FT9 A;  4U8V D;  5JA4 D;  4AOF A;  3SO8 A;  3JYS A;  4URK A;  4DX2 A;  3QB2 A;  3DPQ A;  3NOG D;  5E84 A;  4I2Z A;  2IOL A;  5ENO D;  1UG3 A;  2FO7 A;  3E30 A;  3BG0 B;  2HM8 A;  3MGB A;  4HOR A;  2L0I A;  3NAW A;  2P9U G;  2DZO A;  2EIL E;  4HXI A;  4CDR A; 
#chains in the Genus database with same CATH homology
 2YHC A;  4BFR A;  2FEZ A;  3PE3 A;  2IFU A;  1E90 A;  3OTN A;  5JJ6 A;  3RKV A;  3CVL A;  2ION A;  2AVP A;  2OV8 A;  2WVI A;  3GYZ A;  3KD7 A;  4WND A;  1E8X A;  5G05 J;  3CSF A;  5LP0 A;  4JHK A;  4MRU A;  4E6H A;  5T8I A;  5CCL A;  2J4B A;  3SNX A;  1Y6I A;  2KC7 A;  1QNF A;  3PRZ A;  4I17 A;  3RU0 A;  5JJ7 A;  1L5J A;  5CHE E;  3IHY A;  4FLH A;  3O4Z A;  3CK8 A;  3ZYQ A;  3ASH A;  4EZS A;  4EZQ A;  4XZ4 A;  3MV3 B;  1QZ2 A;  1IQR A;  2R17 C;  4FU3 A;  3TXM A;  5BPP A;  2J08 A;  3OXL A;  4RSY A;  3KAE A;  4MS6 A;  2LAH A;  3U9W A;  3QJZ A;  5KJN A;  5J90 A;  3ONK A;  1HZ4 A;  2CFU A;  3FHE A;  3NZU A;  3S2A A;  2MHK A;  3ZIM A;  2HO1 A;  2IU1 A;  3CKC A;  4UI9 C;  4J8S A;  4UI9 K;  2BF0 X;  2KCK A;  2RG8 A;  2WXH A;  4GZ3 A;  3ZHE B;  4FA6 A;  1CKR A;  1DVP A;  2VGY A;  4F00 A;  1HS6 A;  5ANL A;  1HF8 A;  2EQX A;  3NF1 A;  1KT1 A;  1XGW A;  2WXM A;  3CK9 A;  2M63 A;  1E8Z A;  3EIQ C;  5AJL A;  4NUR A;  3RO3 A;  3D2E A;  5AYW D;  4FHK A;  2WB2 A;  2XPZ A;  3UPV A;  2J09 A;  4G26 A;  3SI5 A;  2XGS A;  3C7N A;  4FJZ A;  4U0Z A;  1QQE A;  4JA7 A;  2E0I A;  4WNF A;  2BPR A;  3I4G A;  4UI9 J;  5EKQ D;  1ELK A;  3L17 A;  4G25 A;  3MJW A;  3ESL A;  3QWV A;  4L7T A;  4U8H A;  5FTP A;  4EPZ A;  4U0U A;  4GZ6 A;  4AIF A;  3QK0 A;  2QFC A;  4FP7 A;  2GW1 A;  3DQG A;  3SHF A;  4J8E A;  3PDN A;  4UWF A;  5FWQ A;  2LAI A;  3URZ A;  2DCP A;  4IYP A;  3ASD A;  1PC2 A;  2LNI A;  3G2W A;  3L16 A;  4EQF A;  3ZW3 A;  4YVO A;  1SQM A;  1OWO A;  4G2V A;  4KBQ A;  3CHQ A;  3PUK A;  2R5S A;  2WQH A;  3AS8 A;  3ENE A;  5FQ8 A;  4AY5 A;  3EJN A;  4WUY A;  1MQS A;  2WXN A;  5KJM A;  3OXG A;  4EZJ A;  5LCW C;  1HXI A;  3VLF A;  1Z3X A;  2PQN A;  2RD0 A;  3ZXS A;  4GYY A;  2UY1 A;  4EZV A;  3FUJ A;  2VQ2 A;  3DBS A;  4A3T A;  1YA0 A;  3L54 A;  3EHM A;  4N3B A;  4JWI A;  1IYG A;  3LY7 A;  4DLO A;  4XKB A;  4I9C A;  2X6F A;  1HG5 A;  2GRM A;  1SZA A;  1UW4 B;  2HR2 A;  2LSV A;  2VSN A;  3AU4 A;  4I1A A;  3Q5M A;  4AXH A;  2VTB A;  2VGX B;  4I9E A;  2NC9 A;  3B7U X;  4ABN A;  4ANU A;  4WV7 A;  4B9Q A;  3AS5 A;  1IHG A;  3JCK C;  5LCW J;  5AIJ A;  4BT9 A;  4C0E A;  3N71 A;  3L08 A;  4EBA G;  3ZN3 A;  4FLB A;  4J8D A;  4B8A A;  2OOE A;  1FCH A;  4I2W A;  2A4Z A;  4CEM A;  5KJL A;  4BX8 A;  4IUL A;  2CG2 A;  4H7Y A;  1OWP A;  3Q47 B;  5FQ6 A;  4G1T A;  1N52 A;  4JW1 A;  3SF4 A;  4J6I A;  4LRZ A;  4DPR A;  4G11 A;  1DKZ A;  4UQX A;  3RJV A;  3ZVV A;  3CHP A;  4WV5 A;  3T8M A;  5FQ7 A;  1JWG A;  4N3C A;  3T5V A;  3ZYK A;  3TG4 A;  5E75 A;  3RRU A;  4WWP A;  2AXZ A;  3RK6 A;  4FC8 A;  4DK5 A;  4GPK A;  3I3N A;  4F01 A;  2GRL A;  2V8S E;  4I6G A;  1OWL A;  4M3O A;  3SD5 A;  3PS6 A;  4CDM A;  2OND A;  3EHN A;  1FVF A;  3B7R L;  4JVS A;  4B94 A;  1B89 A;  3APC A;  2ILR A;  3GW4 A;  3UX4 A;  1E7U A;  4A1S A;  2X6H A;  2DBA A;  2J07 A;  4O6F A;  2I1J A;  4KT6 B;  1NA0 A;  4KYO B;  4LUN U;  5G55 A;  3SFZ A;  2V4L A;  4HFG A;  1H2U A;  3HVE A;  1H19 A;  5T3R A;  1KLX A;  2PQR A;  4R7L A;  3C98 A;  5FQ4 A;  2PZI A;  3FUN A;  3GZ2 A;  4J0U A;  1ZBP A;  4FL9 A;  3WXX A;  3MKQ B;  3O48 A;  4WWO A;  2PM7 A;  3FH5 A;  5LFA A;  1JPL A;  5M72 A;  4EEC A;  3QWW A;  4L1B A;  5A23 A;  2FF4 A;  2AW6 A;  1YUW A;  3FU5 A;  4JXT A;  2CHX A;  5C2Y A;  2KZT A;  1E96 B;  5ENN A;  4BWR A;  5LX8 A;  2J4D A;  4R5G A;  3ZYL A;  4E85 A;  1WY6 A;  4KMO A;  1OUV A;  1JUQ A;  1Z3Y A;  4LCT A;  4B8C B;  1DKX A;  2IF4 A;  4Y6C A;  1NZN A;  2AXU A;  3U4T A;  4TV3 A;  4C0M A;  3ZRH A;  1MHQ A;  3CVQ A;  1UN9 A;  3LVQ E;  4FHJ A;  1WAO 1;  2KAT A;  3FY4 A;  4K0R A;  4DI4 A;  3R7Q A;  7HSC A;  4NQ0 A;  4GCN A;  4CGV A;  4ILG A;  2L0T B;  3CHS A;  3FTW A;  2ZU6 B;  2XCC A;  3FUK A;  3UT7 A;  1A17 A;  4JZY A;  4L2Y A;  3FU0 A;  4NRH B;  4ANW A;  5TKY A;  4EZX A;  3PNT B;  2I1K A;  3CVP A;  3CIA A;  3PEU B;  1DNP A;  2FI7 A;  3LY9 A;  5FZR A;  1OWN A;  5ANR A;  4N2Q A;  3G2V A;  3PUJ A;  1EYH A;  3KS2 A;  3CST A;  1U00 A;  4J8F A;  3FU6 A;  4NAC A;  4P29 A;  3CHM A;  4YND A;  2I6H A;  2CG3 A;  4RG6 A;  2XGO A;  5E76 A;  4KZC A;  3FFL A;  3FDH A;  2QXL A;  5FJY A;  3B7T A;  4GB9 A;  2R59 A;  2DIW A;  4JC8 A;  4BTA A;  4K03 A;  3CHR A;  1FVH A;  3IV0 A;  4F1S A;  3P2B A;  3SZ7 A;  4WNG A;  1ZU2 A;  3CV0 A;  1EDU A;  3QNK A;  3CVV A;  3OXF A;  3LPZ A;  3B13 A;  5EDS A;  3RRN B;  4EZL A;  4JWD A;  1Q5L A;  2XCB A;  2IQC A;  3CVN A;  3FUM A;  2I2O A;  1BPR A;  3VLD A;  3D9K A;  4JPS A;  1DKY A;  3GZ1 A;  2I9C A;  4GYO A;  1UN8 A;  2VJ8 A;  4UQZ A;  3NZS A;  3TGO A;  4GA1 A;  1SZ9 A;  4F7A A;  1H6K A;  3CLJ A;  3FEY A;  3PNL B;  3U3W A;  2JLB A;  2Q7F A;  4W9R A;  3ML8 A;  4Q94 A;  3D9P A;  4A55 A;  4IN3 B;  4XE0 A;  3T5X A;  2WXF A;  4EZT A;  4U07 A;  4MKT A;  1NA3 A;  4LEU A;  3QOU A;  3UUX A;  1H2V C;  5J08 A;  5D0O D;  2Y4T A;  3APF A;  4N39 A;  3LJ3 A;  4A1G A;  2C0M A;  5AEN A;  1U3C A;  3CQG B;  3LDZ A;  2L9B A;  3D9N A;  4YVQ C;  4Q69 A;  2YHE A;  2PM6 A;  2XRY A;  3UMV A;  5C1D A;  4HY9 A;  3C7N B;  5KJK A;  4QFV A;  1HX8 A;  2X6J A;  3DPD A;  4N5C A;  4B0Z A;  3LS8 A;  1HO8 A;  3MCX A;  2XHE A;  4JWC A;  3TG5 A;  3PE4 A;  3LXU X;  2AWI A;  4GU5 A;  4Y6W A;  2FBN A;  4CCA A;  3FTU A;  3R9A B;  1PY1 A;  4I6J A;  2QY7 A;  2V0P A;  3QC1 A;  3UT4 A;  1LF8 A;  5JJT A;  4B89 A;  2XGM A;  1UJJ A;  2FUL A;  5EX3 A;  3MEK A;  3U66 A;  3L13 A;  5FZQ A;  5A6C A;  4GZC A;  3DPP A;  4HOS A;  4GAA A;  3TAX A;  2J9Q A;  2KCV A;  1WM5 A;  3CVX A;  3D9O A;  4XI0 A;  2XPI A;  2A5U A;  5D0Q D;  5FZS A;  3QNJ A;  2BTD A;  2UWJ G;  4UWH A;  5T4Y A;  1PAQ A;  3OAW A;  3DPO A;  3FEX A;  1N54 A;  1Y8M A;  1HU3 A;  4FAD A;  1GW6 A;  4N2S A;  4MQD A;  3RRM B;  4GML A;  2IOS A;  5KCM A;  4D10 C;  4HOT A;  4I1M A;  2OP6 A;  4PO2 A;  1BPO A;  2WM9 A;  3AU5 A;  3D9M A;  3ZYM A;  2UY1 B;  1JWF A;  3EIJ A;  1HH8 A;  1UJK A;  3MYV A;  4JEU A;  5EX0 A;  3S7F A;  3FU3 A;  2WXK A;  4ATG A;  5G04 C;  4R5L A;  3FTY A;  2XPY A;  3JQ0 A;  3LY8 A;  2MOW A;  2X3M A;  3Q15 A;  1U3D A;  2NXP A;  4TRQ A;  1NP7 A;  1OWM A;  2CHZ A;  3QDN A;  3CGH A;  5BUZ A;  2VTB B;  4OVV A;  2WXQ A;  4Q96 A;  4BT8 A;  4I1O B;  2Y3A A;  3K9I A;  5BNW A;  3HYM B;  3LCA A;  2YQ8 A;  2CFZ A;  3GZS A;  3MV2 B;  3FUH A;  3SBT B;  2V7Y A;  3EDT B;  1IQU A;  3L22 A;  4JL0 A;  1KT0 A;  3G2S A;  3ZHE A;  1TJF A;  3CQC B;  2KM4 A;  4XX5 A;  5G04 J;  4U63 A;  4UWK A;  4PS7 A;  3FWV A;  3TXN A;  4AP2 A;  5HI7 A;  3FTV A;  4CT0 A;  3D2F A;  2BUG A;  4H7X A;  2XRZ A;  2XEV A;  1VDY A;  2YIN A;  2NSZ A;  4JA9 A;  4ME2 A;  3CVU A;  3APD A;  3G2U A;  3LVR E;  5BW8 C;  3LKU A;  5AJD A;  3SGH A;  3ESK A;  2WXL A;  3ASF A;  3CEQ A;  3FP3 A;  2WMO A;  3CR3 A;  3ONL A;  3PEV B;  4WWN A;  3QKY A;  4BX9 A;  2X38 A;  4FUL A;  4R5J A;  2WXP A;  2WXO A;  1E7V A;  4JHJ A;  4R5I A;  3I4R B;  3QWP A;  4FJY A;  5CMY A;  3B7S A;  4EZR A;  5CCM A;  5JHA A;  3LEW A;  2OVF A;  4N3A A;  4HLE A;  3FUF A;  3D9I A;  3QAQ A;  2V5F A;  4JWE A;  3RO2 A;  4BY6 A;  3FUL A;  4GYW A;  2Y4U A;  3D9L A;  3HVE B;  2VSX E;  4UWL A;  3ZFW A;  1TEZ A;  4AY6 A;  3DOB A;  4PS8 A;  4OVU A;  1H0A A;  4XIF A;  2C2L A;  4WAF A;  4AEZ C;  3ZEF A;  3FH8 A;  2WQ7 A;  1E8W A;  1P5Q A;  2P58 C;  2WMN A;  3PVL A;  4ILI A;  3Q49 B;  3HIZ A;  1EF1 C;  4EZK A;  3JUI A;  3HDX A;  4HYB A;  3FH7 A;  4IRU A;  4ILH B;  3NQP A;  4BTB A;  3IEG A;  5BV1 A;  4JNF A;  5CMW A;  4F3V A;  4EZP A;  2MRI A;  4CGW A;  3FUI A;  4DJA A;  4U0S A;  2KZT B;  4JN4 A;  1W3B A;  4HS2 A;  4RVB A;  2J49 A;  3VLE A;  4U04 A;  3PH0 C;  2X6I A;  3D3M A;  1TJC A;  3UT8 A;  3MZL B;  4BSX A;  5DBK A;  3FUD A;  2VGX A;  2WXR A;  5A7D B;  3FUE A;  3FTZ A;  3CK7 A;  3D9J A;  4GMJ A;  4KVO A;  4KZ0 A;  3ZPJ A;  3PZD A;  4KXK B;  4I6E A;  4EZZ A;  1INZ A;  4E81 A;  4GZD A;  4ANX A;  4L23 A;  2LO6 A;  4AJW A;  3E4B A;  3BG1 B;  2KHO A;  2WQ6 A;  3QAR A;  3S7B A;  3BEE A;  3ZGQ A;  3VTX A;  5HQ8 A;  3HHM A;  4PUC A;  4EZN A;  1Z6T A;  3IBE A;  2C0L A;  4PH4 B;  3CKB A;  3VTY A;  3CVY A;  1E8Y A;  4KVM A;  4CRW A;  3CHO A;  3LYA A;  2WXI A;  1EPU A;  2WXJ A;  3Q4A B;  3ASG A;  4UWG A;  5ARG A;  3SBS A;  3G2T A;  3PRE A;  3P1U A;  4EBA A;  4JEH A;  4LER A;  3AS4 A;  2VSY A;  1HG2 A;  4HOQ A;  4ANV A;  4XKC A;  4TUU A;  4GCO A;  4CT4 A;  4PDX A;  5G2N A;  2OVB A;  3TL5 A;  3RIB A;  1S0P A;  2HYZ A;  4G23 A;  4L2L A;  5DIZ A;  1X5B A;  3S7J A;  4F53 A;  5LOZ A;  4GZ5 A;  1DG4 A;  3H0X A;  3IKO B;  4A3V A;  3L6A A;  3N8E A;  3S7D A;  3I5P A;  3MKQ A;  2AXV A;  4I43 A;  1ELW A;  3TJP A;  3KEZ A;  4APO A;  3FTX A;  3ML9 A;  4MLP A;  4DI3 A;  3ULQ A;  4HVB A;  5FT9 A;  4XI9 A;  4HOU A;  4AOF A;  2YNQ A;  2PL2 A;  3JYS A;  4OYS A;  4EZU A;  1HFA A;  3MKR A;  4RG9 A;  2CHW A;  4URK A;  3QB2 A;  4JHR A;  2GGF A;  4AVX A;  3DPQ A;  3MA5 A;  3FTS A;  2LSU A;  2WPV A;  4JNE A;  5E84 A;  4GA0 A;  4I2Z A;  2IOL A;  2VSO E;  5BV0 A;  4R5K A;  4EZW A;  1HE8 A;  5JHB A;  1UG3 A;  4PS3 A;  2FO7 A;  3MX3 A;  4UQY A;  2JEK A;  2KCL A;  4DLQ A;  4EZO A;  3U64 A;  3BG0 B;  1ELR A;  2WXG A;  2HM8 A;  3MGB A;  4WNE A;  4HOR A;  4EZY A;  4GA2 A;  2X6K A;  3JQ1 A;  5G05 C;  4ACL A;  2L0I A;  2E2E A;  5ARF A;  3CVW A;  4AV7 A;  3UQ3 A;  4C9B B;  1H2T C;  2XQ0 A;  4APF A;  3IHV A;  5BT1 A;  4ACK A;  2VYI A;  2L6J A;  4HXI A;  3R7R A;  4CDN A;  4CDR A;  4V3I A;  4AM9 A;  4G24 A;  1XNF A;  2IJG X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...