4ILIA

Crystal structure of an aar2p s253e phosphomimetic mutant protein
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
304
structure length
290
Chain Sequence
NTVPFTSAPIEVTIGIDQYSFNVKENQPFHGIKDIPIGHVHVIHFQHADNSSMRYGYWFDCRMGNFYIQYDPKDGLYKMMEERDGAKFENIVHNFKERQMMVSYPKIDEDDTWYNLTEFVQMDKIRKIVRKDENQFSYVDSSMTTVQENELSSSSSDPAHSLNYTVINFKSDKSYYLNTVMLQGIFKNSSNYFGELQFAFLNAMFFGNYGSSLQWHAMIELICSEATVPKHMLDKLDEILYYQIKTLPEQYSDILLNERVWNICLYSSFQKNSLHNTEKIMENKYPELLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for dual roles of Aar2p in U5 snRNP assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Splicing
molecule keywords A1 cistron-splicing factor AAR2
total genus 75
structure length 290
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.550 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4iliA02
2.60.34.20 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4iliA01
4ILIA 3SBTB 3ZEFA 4ILGA 3SBSA 4I43A 4ILHB
chains in the Genus database with same CATH superfamily
5CEAA 2BF0X 3E33A 2I9CA 3B7TA 3VLEA 3ZFWA 3ZVVA 3ZRHA 1H6OA 3SNXA 3Q73A 3HVEA 2H6IA 4V3IA 2JABA 3D9JA 2DCPA 1AP7A 4K5BA 3CVXA 3DBSA 2J09A 4C0MA 2CG3A 3LY8A 3IHVA 3FTUA 2P58C 4ILHB 2DZOA 3TWSA 1SVXA 4GYWA 1O1TA 4L2LA 3QNJA 3HXDA 4Q96A 1MX2A 3ZUVB 4GYYA 4HRMB 3UT8A 4JWCA 1BU9A 3UUXA 2BEDA 5HI7A 4N2SA 4K5CA 3LPZA 4GZ6A 2RG8A 3UX4A 3FTSA 2PM6A 4N39A 1AWCB 2BKGA 5AQAA 3KEZA 4ANXA 1Z5SC 2XEEA 3ULEG 5JJTA 4TRQA 4UWLA 3URZA 1S0PA 3PVLA 4IYPA 4MRUA 3V30A 2R05A 4AM9A 3IXEA 3RO2A 4EZWA 2KCVA 4HYBA 4BTAA 3FUIA 2V4LA 3D9LA 4GA0A 2IF4A 1TNYA 3D9KA 2NC9A 4KMOA 4KBQA 5LCWC 5B1BE 3G2TA 4GU5A 4BX9A 4R5GA 3I4RB 1HF8A 5KNHD 2L9BA 1Z3YA 2MOWA 1KT0A 2UY1B 4UWGA 4N3CA 3AS5A 4MBGA 2KXPC 3DSXA 3ONKA 1H6PA 3TWQA 2LXLA 2ETCA 3TWRA 3S2AA 3HG0D 3W9FA 3QWVA 4Q94A 2XGOA 2KZTB 3KD7A 1E8YA 3RIBA 4G1TA 1S63A 1HZ4A 1FT1A 5CECB 5EX3A 3FH7A 3PE3A 5BPPA 2CHXA 4I17A 4ILGA 3IEGA 5FZSA 4WUYA 2LSVA 5EX0A 4F3VA 3SBSA 3GW4A 2LO6A 4DLOA 4GMJA 4J0UA 2X6FA 4EZNA 3D9PA 4M7CA 3TWVA 4APOA 5JHAA 3UT4A 5JHBA 4DRXE 1W3BA 2AXZA 4IN3B 4I2WA 3RJVA 2WMNA 2VGXB 3B7UX 3DPPA 4U0UA 2QFCA 5AJDA 3TG5A 5CRUA 3GZ2A 3OAWA 4O60A 1U2VG 1OCOE 2KZTA 4WWOA 3JXJA 3ZIMA 4LG6A 4GTMA 3CLJA 4QFVA 4XE0A 3ZU7B 4AJWA 2P9UG 4JZYA 2DIWA 4LSZE 4GZ5A 4NIKA 1RZ4A 3DPYA 3S7BA 4EZLA 3PRZA 2B0OE 3L08A 2WXOA 1E8WA 4APFA 2XGSA 4J8SA 2QYUA 1JCRA 3CIAA 2LSUA 4KYOB 5AN8A 5EILA 4BT8A 2OV8A 3ZW3A 1N4SA 4XX5A 3FEXA 2RD0A 3R9MA 3TG4A 4LEUA 4E6HA 1IKND 1JCSA 1PAQA 2E2EA 4R5LA 1GW6A 2HM8A 3CHPA 4JD2G 4U8HA 3P1UA 4L1BA 2GRNB 3PUJA 1DC2A 5FQ4A 3G2SA 2C2LA 4PO2A 2I6HA 4JWDA 4UQYA 2QZAA 1UOHA 5CMWA 3ZXSA 3UKRG 1N9AA 1QBQA 4AY6A 4EZSA 4UQZA 1N0RA 2ZGDA 5ENSD 2J49A 2PM7A 3UIPC 4CDNA 1BI7B 5G55A 1XNFA 4UUCA 5G05C 4DJAA 3OXLA 3HXBA 3NF1A 2Y69E 4WWNA 3PH0C 1V55E 2OVBA 3GZSA 4L7TA 2WXFA 3Q4AB 1OY3D 3SD5A 3UM3A 2BKKB 2XRYA 3C3OA 2PL2A 5ENPD 4UWFA 3U4TA 4UI9K 4IRUA 3W9GA 4CYMD 4X8QA 4A63B 1BPRA 4JNFA 4N3AA 2L0IA 2GRPB 3FUHA 4NRHB 4HXIA 3LJNA 3MGBA 2ZXWE 3HRAA 1OWNA 3RRMB 3BUAA 5JA4D 3SFZA 1K1AA 3FUJA 3AG4E 3DSTA 2IO2C 3UKUG 4GCNA 4WNEA 3AS4A 3BEEA 3ESKA 1E7VA 3AJIA 3DPOA 2OCCE 3Q5MA 3MKQA 1N4PA 4EZYA 3CVPA 5D0QD 3FY4A 1TNBA 3RK6A 2LNIA 3PUKA 3TAXA 1KPSB 5FZQA 3T8MA 4JA7A 4DPRA 2WXMA 3JXIA 4JC8A 3DXMG 2I1JA 3QARA 2VTBA 4R5JA 2V4HC 4YNDA 3CK9A 1IQUA 3HXEA 4HOSA 2ETBA 3U64A 1OWOA 2AXVA 3FUKA 4DX6D 3O48A 4DUIA 4E85A 2FO1E 3MV2B 1ELKA 4U7EB 3TWTA 3Q9NC 3UPVA 3IKOB 5HKPA 3Q47B 4ZHBA 3EHMA 1KZPA 4HRNA 4FA6A 4OVVA 4G24A 4BSZB 3CVVA 2YINA 4BERA 1FPPA 4FADA 4ZFHA 4TXRA 1Y6IA 3E37A 4HLEA 5FJYA 1JWFA 1O1RA 1N95A 1BD8A 3FTWA 3K9IA 2X6IA 5DIZA 1QNFA 3ASGA 3MJWA 1Z3XA 4XI0A 5KJLA 1TEZA 3QK0A 3SI5A 4UI9C 2R02A 2R03A 4C0EA 1MX6A 5BXOA 4HOTA 5FQ6A 2EQXA 5D2MC 1YYHA 2X6KA 4H7XA 3I4GA 2WXIA 3CR3A 3BU8A 2J8SD 4F1PA 3SY2A 4KZCA 3U66A 1HH8A 3NAWA 1RW2A 1UW4B 1SA5A 4PDXA 4A3TA 5C1DA 2HO1A 3UIOC 2BPRA 3ZYMA 4TXPA 3UQ3A 4A3VA 2VJ8A 3SFXA 2YQ8A 5ITZF 3UINC 2R17C 3L16A 3J5PA 2H6FA 3FEYA 2FBNA 3FH8A 2YHCA 4A1SA 3SBTB 2R2LA 3NOCD 3R9AB 1OCRE 3LJ3A 4JW1A 4EQFA 4JL0A 3MYVA 1Y8MA 4EZVA 3G2WA 1NA3A 5AQ7A 4YDWA 2X38A 3LDZA 2UWJG 3NZSA 4HY9A 4JA9A 1DKZA 3EU5A 2WXRA 5EYPF 3VLFA 3BG0B 1HXIA 3OXFA 1HS6A 3Q7AA 3G2VA 3E4BA 4P29A 3X2QE 4RSYA 4I1MA 3ML9A 4HQDA 1IHBA 3QB2A 4EPZA 4Y6CA 3ZKJA 2OOEA 2PNNA 2IQCA 3EJNA 3TXMA 3C5RA 4C9BB 1YUWA 4OAUC 2FO7A 3L22A 4PS3A 4YVQC 4U0SA 3EHQA 2OP6A 4JXTA 4DX1A 2XPYA 3D3MA 3I3NA 1H2TC 2F37A 2XZDG 2GGFA 3Q79A 4JWEA 2XGMA 3CV0A 5ANLA 1JUQA 4GPMA 5EYLA 3ZN3A 3D9HA 3DEPA 2ILRA 5CEDB 3DPDA 4MKTA 3NB2A 1SQMA 4ABNA 3FFLA 4MS6A 1WM5A 5BNWA 1QQEA 2QYJA 1NP7A 2VGEA 4JN4A 2AJAA 4LUNU 5EIBE 3D9OA 3DSSA 2P9LG 5HRYA 2GRRB 3CVWA 3KAEA 4Y6WA 4JHKA 3LY7A 1OCZE 2H6GA 1CKRA 5LP0A 4D10C 3HIZA 2L6JA 4DK5A 1BLXB 4JB8P 2F0YA 2VSOE 3ASDA 3N71A 3Q75A 1Q5LA 2WXKA 2PZIA 4ANUA 2EILE 2WXNA 2KM4A 1JWGA 3ASHA 5CRVA 3RU0A 1B89A 4GAAA 1N4RA 3V79K 3L82A 3SHFA 4I6EA 4PS7A 4URKA 4HNAD 4RG9A 3ZPJA 2R59A 4FL9A 4N3BA 2WQHA 4XIFA 1IXVA 1NL4A 3PZ3A 4DLQA 3CK8A 3CKBA 3J5QB 2X6JA 1MJ0A 2M63A 2VSXE 3ULYA 1KLXA 2ETAA 3IHYA 2FEZA 4G2VA 3NBNB 4EZOA 3DSUA 5EN5D 3ABME 4ACLA 3DQGA 1HG2A 2P9IG 2IEJA 3CSTA 4EZZA 2FULA 2C0LA 2VGYA 3B7RL 4H7YA 4GTVA 1Q2ZA 1SA4A 5ENQD 1N11A 2VGXA 5ENOD 3FP3A 2FF4A 3FTYA 5JJ7A 4I6JA 1HFAA 1KZOA 1OWLA 4F7AA 4UI9J 3UM1A 4TV3A 3CHQA 3QNKA 1E7UA 1HO8A 2LAHA 4F00A 4U8YD 3B7SA 2J4BA 2XS1A 3TL5A 1ZB1A 2EIJE 5AAOA 1HX8A 3FWVA 4GCOA 1L5JA 4A1GA 4MLPA 2VTBB 1EPUA 4NQ0A 1UG3A 4EZPA 4BFRA 5EKQD 3HXFA 3EIJA 5CBOA 1N94A 2ZU6B 2EIME 1FCHA 2LAIA 3MV3B 4UWKA 4GTSA 3JUIA 5CMYA 3UI2A 3QAQA 2H6HA 2WQ7A 2CFUA 4BX8A 3CVYA 2JLBA 4KXKB 5FWQA 3LS8A 2AVPA 2KHOA 4FJYA 2ONDA 3ZNGA 5B1AE 4GTRA 5LCWJ 4CCAA 3DPQA 4HOUA 2GRMA 3SZ7A 5AIJA 1D9SA 1LD7A 3OXGA 1IQRA 4XKCA 1H2UA 3RRNB 2WXQA 3PE4A 4R7LA 3ASFA 3ABKE 4HRLA 4EHMA 2GROB 3OTNA 3R7RA 3LY9A 2VQ2A 5J90A 3KSLA 2WPVA 2WXJA 2XZTG 2J4DA 2IJGX 3N8EA 2Q7FA 2V5FA 5A6CA 4B94A 5FTPA 4J8FA 4AXHA 2IU1A 3TGOA 4IULA 3ENEA 1NA0A 3QJZA 2IOLA 2KC7A 3EIQC 3CHOA 4OYSA 5G2NA 4JWIA 1QYMA 3AG2E 3FTVA 5CBNA 2P9NG 3S7JA 3FH5A 3V2XA 3QC1A 1EDUA 5ENRD 1O5MA 1NI1A 4F53A 3UT7A 4FHKA 5KBAA 4FC8A 2QXLA 1PY1A 4MQDA 2MHKA 3MA5A 4G8LA 4AIFA 4EZQA 2ZIRA 3F6QA 4EZUA 1WG0A 3NZUA 4O6FA 3CQCB 2CFZA 5ANRA 3FUFA 3PNTB 3TWWA 4B93B 5G05J 2GRQB 4AVXA 2MYOA 3AS8A 1LF8A 4GMRA 4AEZC 4CDRA 3FHEA 4U63A 4CT0A 1YCSB 4U8VD 1NZNA 3APFA 4N5CA 3EU9A 1S70B 5LX8A 3EHRA 3Q15A 4YVOA 2P2CP 2R5SA 2LXMA 2Y4TA 1TNUA 2F8XK 4AP2A 4O1OA 1LTXA 4F1SA 3Q9UC 4FHJA 3EDTB 3E30A 1E96B 5BW8C 2UY1A 3ZHEA 3U3WA 1K8KG 3P2BA 3FDHA 4FU3A 5AQ9A 7HSCA 2XPIA 3LCAA 4DX5D 3T5VA 2A5EA 5BXUA 3TWUA 2EIKE 2KCLA 4L2YA 5TKYA 4NACA 3I5PA 4R5IA 4WNDA 2DZNA 4PH4B 5C2YA 3AG1E 4HBDA 1BPOA 2XEHA 4EZJA 1VDYA 5A23A 4OAVB 1O1SA 4F01A 1ZBPA 4YDOA 2JEKA 4JHJA 1HG5A 4K0RA 2AXUA 3VLDA 1MQSA 3B13A 2KBXA 4BETA 4TUUA 2FI7A 3R7QA 2L6BA 3ABLE 5E76A 5BT1A 4OVUA 4XI9A 3JCKC 1N4QA 3LVQE 4RG6A 1UJJA 3FUDA 1A5EA 2XCCA 3O4ZA 1S64A 4RLYA 4EZRA 2WVIA 5CHEE 5EDSA 4GA1A 5ARGA 4B0ZA 3CSFA 4FP7A 4UQXA 5AARA 2KATA 1QZ2A 4J8EA 4ANVA 3C7NA 4N2QA 3JQ1A 5FZRA 2RKKA 3JYSA 1HE8A 4U04A 4JEUA 5FQ8A 3LYAA 3ML8A 3HXCA 4BEPA 3UMVA 2J07A 4XEIG 4A55A 1ELRA 2LUHA 4WNGA 3CHRA 5KWDA 1H6KA 1D8EA 3CVNA 5HS0A 4JVSA 4GTTA 4W9RA 3ZGQA 3DSVA 3V2OA 2IFUA 3T8KA 1V54E 3ZHEB 2Y3AA 2KCKA 3CVQA 3MEKA 4NURA 3KSQA 2RFAA 1JPLA 2A4ZA 5KJNA 3QOUA 3KS2A 2I2OA 3C7NB 4GA2A 4FULA 1H19A 2B6CA 4K5AB 2DYRE 2V5QC 4G25A 4I1OB 2XENA 1SW6A 4DX2A 3CVUA 1OXJA 1FVHA 4U95D 1FT2A 1EF1C 1FVFA 3ZYKA 3CHSA 2I1KA 1YA0A 3GYZA 4B89A 4DI3A 4G23A 1N54A 4KT6B 2DWZA 3ZEFA 3D9NA 4LNUD 4QQIA 2GW1A 2VYIA 3D2FA 2HE0A 5ENNA 3AG3E 2F8YA 5M72A 3L54A 1OT8A 2GRLA 1IYGA 4K03A 2Y4UA 4HLLA 3L6AA 2ZISA 5BV0A 2DYSE 3ASNE 4KVMA 4HI8A 3SQVA 5AENA 2YHEA 3CK7A 4BESA 2XCBA 5ENTD 1TNZA 4ATGA 3QWPA 1MYOA 2BUGA 3CGHA 1Z6TA 5AYWD 3S7FA 3PZDA 3AAAC 2C0MA 3ASOE 1WAO1 2IOSA 5KNGA 2BTDA 4CT4A 3FU6A 5FIOA 3QWWA 1YMPA 2WM9A 5A7DB 4ACKA 2EINE 4GTQA 3SGHA 4C48B 3UM0A 1XGWA 2ZGGA 3PEVB 3FU3A 2XQ0A 3RO3A 4CDMA 2A5UA 5G04C 3C98A 4L9PA 4I1AA 3MKRA 2NSZA 1WY6A 3QDNA 5KCMA 4HORA 3RKVA 1NFIE 4WNFA 4B8AA 4CEMA 2QY7A 3CVLA 1U3CA 1JCQA 3IV0A 2AW6A 1DVPA 4KVOA 1SZAA 3DWLG 2V7YA 5H7PA 4RVBA 4CRWA 5ARFA 4I9CA 3E34A 4HB5A 4EBAG 3KEAA 4GPKA 5BUZA 3RSEG 3C3QA 1U3DA 4LCTA 3RRUA 3FUEA 3APDA 3SF4A 1DCQA 3Q7FA 4J8YA 4BSXA 3S7DA 5B3SE 3FU0A 4CGVA 3B7BA 4Q69A 4AY5A 5LOZA 3VTXA 3D9IA 1TR4A 4I9EA 5FINA 2L0TB 4F6RD 1KT1A 1BI8B 3PDNA 3VTYA 5KJMA 2Y1LE 3H0XA 1TJCA 5CERB 4ATZD 2V8SE 2J08A 4AV7A 4XKBA 4UWHA 4U0ZA 4YDEA 3JQ0A 1HU3A 1X81A 3E32A 4U96D 4ILIA 4E81A 1ZU2A 3HVEB 2VSYA 3DRAA 3UM2A 2WMOA 1TYQG 1TNOA 4GYOA 1D8DA 1DKYA 3ESLA 4HVBA 4FJZA 2X3MA 4WV5A 1A17A 4BTBA 3C3RA 2MRIA 3ISMC 2NXPA 3RAUA 4FLBA 4L23A 3U9WA 1DCEA 1K1BA 3FULA 2IONA 3DXKG 1SZ9A 3L17A 1U00A 3QKYA 4TXQA 5JJ6A 4EZKA 3JUEA 3AU5A 4ME2A 3AU4A 5E75A 2XEVA 3HHMA 1N0QA 2HYZA 3NQPA 3FTXA 5DBKA 1EYHA 1OCCE 2XHEA 4LERA 4LNGA 4GTPA 4EZTA 1UJKA 4JPSA 3WXXA 3APCA 1E90A 2P9SG 2RFMA 3NOGD 2J9QA 1H2VC 4EZXA 4LRZA 4N5QA 1G3NB 2PQNA 3B95A 3L13A 3MZLB 5JMND 3PZ2A 3ZYQA 4YDYA 4EECA 2X6HA 3CEQA 3ULQA 2PQRA 4DX7D 3LXUX 3PZ1A 3BQOA 1WDYA 3ZXPA 4DI4A 2CG2A 5KJKA 5E84A 3HDXA 4J6IA 3EHNA 4WV7A 1N52A 4PUCA 2WXGA 4FLHA 3DOBA 2WB2A 4HOQA 4CGWA 1K3ZD 3CKCA 3TWXA 5T4YA 2XPZA 1UN9A 1ELWA 3SO8A 4GZCA 3ONLA 3MX3A 5LFAA 3IBEA 2P9KG 4EBAA 3LKUA 5AJLA 1OUVA 1DG4A 4I2ZA 1TN7A 4I6GA 4I43A 4JHRA 5T3RA 5AQBA 3GZ1A 3G2UA 2CHZA 3D2EA 4B8CB 4R5KA 2DBAA 3Q78A 2WXLA 3MCXA 1MX4A 1H0AA 5EIDA 4U07A 1IHGA 1DNPA 3DSWA 2XRZA 2P9PG 3BG1B 2E0IA 3DEOA 4J7WA 3PZ4A 3HYMB 3UXGA 3CQGB 3MKQB 1P5QA 4XZ4A 3T5XA 2YNQA 2CHWA 4BT9A 4CZ2D 3C72A 4HFGA 2OEVA 5HQ8A 4J8DA 4TUMA 3TXNA 4JNEA 4BY6A 2WXPA 3D9MA 4G11A 4HI9A 3UTMA 2IY0C 4WWPA 2OEWA 2Y0BG 1E8ZA 4GB9A 3FUNA 4RQIA 5T8IA 3FUMA 1E8XA 3PS6A 3ZYLA 2OVFA 3EUVA 4AOFA 4LNBA 1OWMA 2V0PA 2IO3C 4Z68A 2HR2A 2DVWA 1UN8A 1DKXA 1LD8A 4PS8A 3CHMA 3PNLB 4JEHA 2AWIA 5CCLA 4G26A 3TJPA 4GTOA 1OWPA 3V31A 4BWRA 2QC9A 3FU5A 5D0OD 5BV1A 4KZ0A 3PREA 1INZA 1MZCA 4GZDA 5J08A 3PEUB 2WQ6A 4GZ3A 2XS8A 1TN8A 3Q49B 5FT9A 1X5BA 4O1PA 2VSNA 1PC2A 2NYJA 3WG7E 5IY5E 5FQ7A 3LVRE 4ANWA 1TN6A 1TJFA 4M3OA 4WAFA 2WXHA 5CCMA 4G8KA 3LEWA 1MHQA 5D66A 4B9QA 3T9KA 4GMLA 3L9TA 3SFYA 4HS2A 5G04J 3FTZA
chains in the Genus database with same CATH topology
4FJYA 3PZDA 3CK9A 4YNDA 2C0MA 2ONDA 3S7FA 1IQUA 1WAO1 2BF0X 4CCAA 2IOSA 5LCWJ 4HOSA 2BTDA 4HOUA 3DPQA 4CT4A 2GRMA 3U64A 3SZ7A 3FU6A 2I9CA 1OWOA 5AIJA 3B7TA 3VLEA 3QWWA 3ZFWA 2WM9A 3OXGA 2AXVA 5A7DB 4R5JA 4ACKA 3ZVVA 3FUKA 1IQRA 3SGHA 3ZRHA 4XKCA 3O48A 3SNXA 1H2UA 4E85A 1XGWA 3RRNB 2WXQA 3PEVB 3PE4A 4R7LA 3HVEA 3FU3A 2XQ0A 3RO3A 4CDMA 2A5UA 3ASFA 5G04C 4V3IA 3C98A 3D9JA 3MV2B 1ELKA 2DCPA 3OTNA 4I1AA 3MKRA 3R7RA 2NSZA 3LY9A 1WY6A 3QDNA 5KCMA 3UPVA 4HORA 2VQ2A 3IKOB 3CVXA 5J90A 3RKVA 2WPVA 3Q47B 3EHMA 4WNFA 3DBSA 4B8AA 2WXJA 2J09A 4C0MA 4CEMA 2CG3A 2QY7A 3CVLA 2J4DA 3LY8A 1U3CA 2IJGX 3IHVA 4FA6A 4OVVA 3N8EA 2Q7FA 2V5FA 3FTUA 2P58C 5A6CA 4G24A 4ILHB 3IV0A 4B94A 5FTPA 4J8FA 3CVVA 2YINA 2AW6A 1DVPA 4KVOA 1SZAA 4AXHA 4FADA 2IU1A 2V7YA 4RVBA 3TGOA 4CRWA 5ARFA 4GYWA 3ENEA 1NA0A 4I9CA 4IULA 4L2LA 3QJZA 2IOLA 3QNJA 1Y6IA 4Q96A 4EBAG 2KC7A 4HLEA 4GPKA 3EIQC 5FJYA 3CHOA 1JWFA 4GYYA 4OYSA 5G2NA 3FTWA 4JWIA 3UT8A 5BUZA 4JWCA 3FTVA 1U3DA 3UUXA 4LCTA 3K9IA 5HI7A 3RRUA 2X6IA 3FUEA 3APDA 5DIZA 1QNFA 4N2SA 3S7JA 3SF4A 3FH5A 3ASGA 3LPZA 3MJWA 1EDUA 3QC1A 1Z3XA 4GZ6A 2RG8A 3UX4A 4BSXA 3S7DA 4F53A 3FTSA 4XI0A 2PM6A 4N39A 3FU0A 3UT7A 4CGVA 5KJLA 1TEZA 4FHKA 3QK0A 3KEZA 4ANXA 3SI5A 4Q69A 4AY5A 4UI9C 5JJTA 4FC8A 5LOZA 4TRQA 3D9IA 4UWLA 1PY1A 3VTXA 2QXLA 4MQDA 2MHKA 4I9EA 3MA5A 4AIFA 3URZA 1S0PA 2L0TB 3PVLA 4IYPA 1KT1A 4C0EA 3PDNA 4MRUA 3VTYA 5FQ6A 4HOTA 5KJMA 4EZQA 2EQXA 3H0XA 4AM9A 4EZUA 3RO2A 4EZWA 1TJCA 2KCVA 2X6KA 4H7XA 3NZUA 2V8SE 4O6FA 3I4GA 2WXIA 3CR3A 2J08A 3CQCB 4AV7A 2CFZA 4XKBA 4UWHA 4U0ZA 4BTAA 5ANRA 3JQ0A 3FUFA 3PNTB 4HYBA 4KZCA 3FUIA 2V4LA 3D9LA 1HU3A 4GA0A 5G05J 1HH8A 4AVXA 3U66A 3AS8A 4ILIA 4E81A 1UW4B 1LF8A 1ZU2A 2IF4A 3HVEB 4PDXA 4AEZC 2VSYA 4A3TA 2HO1A 4CDRA 5C1DA 2BPRA 3ZYMA 3UQ3A 3FHEA 4A3VA 2VJ8A 3D9KA 2WMOA 2YQ8A 2NC9A 4KMOA 2R17C 3L16A 4U63A 4CT0A 3FEYA 1NZNA 4KBQA 5LCWC 2FBNA 3G2TA 3APFA 4N5CA 3FH8A 4GYOA 4GU5A 4BX9A 2YHCA 1DKYA 4A1SA 3ESLA 4HVBA 4FJZA 4R5GA 3SBTB 2X3MA 3I4RB 5LX8A 3R9AB 4WV5A 1HF8A 3LJ3A 3Q15A 4YVOA 2R5SA 1A17A 4JW1A 4EQFA 4JL0A 4BTBA 2Y4TA 2L9BA 1Z3YA 3MYVA 2MOWA 1Y8MA 1KT0A 2MRIA 4AP2A 2UY1B 4EZVA 4F1SA 3G2WA 1NA3A 2NXPA 4FHJA 2X38A 4UWGA 4FLBA 4N3CA 3LDZA 2UWJG 3EDTB 1E96B 3NZSA 2UY1A 5BW8C 4L23A 3ZHEA 3AS5A 4HY9A 4JA9A 3U9WA 3U3WA 1DKZA 2WXRA 3FULA 3P2BA 3FDHA 3VLFA 2IONA 4FU3A 3ONKA 1SZ9A 3BG0B 3L17A 7HSCA 1U00A 1HXIA 2XPIA 3LCAA 3OXFA 3QKYA 3T5VA 1HS6A 3S2AA 3G2VA 5JJ6A 3E4BA 3QWVA 4EZKA 3AU5A 2XGOA 4Q94A 2KZTB 4P29A 3KD7A 1E8YA 2KCLA 3RIBA 4G1TA 4ME2A 4RSYA 4I1MA 3AU4A 5E75A 4L2YA 1HZ4A 2XEVA 3HHMA 5TKYA 4NACA 5EX3A 3ML9A 2HYZA 3I5PA 3NQPA 3FTXA 3FH7A 3PE3A 3QB2A 4WNDA 2CHXA 5DBKA 4EPZA 4I17A 4Y6CA 5BPPA 4R5IA 1EYHA 2OOEA 3IEGA 4ILGA 2XHEA 2IQCA 4PH4B 3EJNA 4LERA 5FZSA 5C2YA 3TXMA 1BPOA 4EZJA 1VDYA 5A23A 4EZTA 4WUYA 4C9BB 1UJKA 2LSVA 1YUWA 4JPSA 3WXXA 5EX0A 2FO7A 4F01A 1ZBPA 4F3VA 3APCA 1E90A 3L22A 4PS3A 2JEKA 4YVQC 3SBSA 4JHJA 3GW4A 1HG5A 2LO6A 4K0RA 4U0SA 2J9QA 4DLOA 1H2VC 4EZXA 4LRZA 2AXUA 4GMJA 4J0UA 1MQSA 2X6FA 3VLDA 4EZNA 2PQNA 3B13A 3D9PA 1DG4A 3L13A 4APOA 3MZLB 4TUUA 5JHAA 2FI7A 2OP6A 3R7QA 3UT4A 5JHBA 3ZYQA 4JXTA 5E76A 1W3BA 4EECA 2AXZA 5BT1A 2X6HA 2XPYA 4OVUA 3D3MA 3I3NA 3CEQA 3ULQA 1H2TC 2PQRA 4XI9A 3JCKC 4IN3B 3LXUX 3LVQE 4I2WA 4RG6A 2GGFA 3RJVA 4JWEA 2XGMA 1UJJA 3CV0A 2WMNA 3FUDA 5ANLA 4DI4A 2CG2A 5KJKA 5E84A 2XCCA 2VGXB 3B7UX 3HDXA 3DPPA 4J6IA 1JUQA 3O4ZA 4U0UA 2QFCA 3EHNA 3ZN3A 4WV7A 1N52A 5AJDA 4PUCA 2ILRA 4EZRA 3DPDA 4MKTA 2WVIA 5CHEE 3TG5A 4GA1A 5EDSA 1SQMA 4ABNA 2WXGA 4FLHA 3DOBA 3GZ2A 3FFLA 2WB2A 4HOQA 4CGWA 4MS6A 3OAWA 5ARGA 1WM5A 5BNWA 1QQEA 3CKCA 4B0ZA 3CSFA 1NP7A 2KZTA 4FP7A 5T4YA 4JN4A 4LUNU 2XPZA 4UQXA 4WWOA 1UN9A 3ZIMA 2KATA 1ELWA 1QZ2A 3D9OA 4GZCA 4J8EA 3CLJA 4ANVA 3ONLA 4QFVA 3CVWA 4XE0A 3MX3A 3C7NA 5LFAA 3IBEA 3KAEA 4JHKA 3LY7A 4Y6WA 4EBAA 3LKUA 3JQ1A 1OUVA 5AJLA 4AJWA 4I2ZA 4N2QA 4I6GA 5FZRA 4I43A 3JYSA 1CKRA 1HE8A 4JZYA 5LP0A 2DIWA 4JHRA 4JEUA 4U04A 4GZ5A 4D10C 3HIZA 5T3RA 5FQ8A 3LYAA 2L6JA 3GZ1A 3S7BA 3G2UA 4EZLA 2CHZA 3ML8A 3D2EA 4DK5A 2VSOE 3PRZA 4B8CB 3UMVA 3ASDA 3L08A 2WXOA 3N71A 2J07A 4R5KA 1E8WA 2DBAA 4A55A 1ELRA 4APFA 1Q5LA 2XGSA 3CHRA 2WXLA 4J8SA 4WNGA 2WXKA 1H6KA 3MCXA 2PZIA 4ANUA 1H0AA 3CIAA 3CVNA 2LSUA 2WXNA 4U07A 1IHGA 4KYOB 2KM4A 1DNPA 1JWGA 4JVSA 3ASHA 4BT8A 4W9RA 2OV8A 3RU0A 3ZW3A 1B89A 2XRZA 4GAAA 4XX5A 3SHFA 3FEXA 4I6EA 3ZGQA 3BG1B 4PS7A 2E0IA 4URKA 2RD0A 3TG4A 2IFUA 4RG9A 3ZPJA 4LEUA 4E6HA 2R59A 4FL9A 4N3BA 3HYMB 2WQHA 4XIFA 1PAQA 3CQGB 3MKQB 1P5QA 4DLQA 3CK8A 3CKBA 2X6JA 2E2EA 4XZ4A 4R5LA 1GW6A 2HM8A 3T5XA 3CHPA 2YNQA 2CHWA 4BT9A 4HFGA 2M63A 3ZHEB 2Y3AA 5HQ8A 2KCKA 3CVQA 4J8DA 3MEKA 4NURA 2VSXE 4U8HA 3P1UA 3TXNA 4JNEA 4BY6A 3D9MA 1KLXA 2WXPA 4G11A 1JPLA 4L1BA 2A4ZA 5KJNA 3IHYA 3PUJA 3QOUA 5FQ4A 2FEZA 3G2SA 2C2LA 2I2OA 3KS2A 3C7NB 4GA2A 4G2VA 4WWPA 4PO2A 2I6HA 4FULA 1H19A 4UQYA 4JWDA 1E8ZA 4GB9A 5CMWA 3FUNA 3ZXSA 4EZOA 5T8IA 3FUMA 4G25A 4I1OB 4ACLA 4AY6A 1E8XA 4UQZA 4EZSA 3PS6A 3ZYLA 2J49A 2PM7A 2OVFA 3DQGA 4AOFA 4CDNA 1HG2A 3CSTA 4EZZA 3CVUA 1OWMA 2V0PA 5G55A 1XNFA 5G05C 2FULA 4DJAA 2HR2A 2C0LA 3OXLA 1FVHA 2VGYA 3B7RL 4H7YA 1UN8A 3NF1A 1EF1C 1FVFA 4WWNA 1DKXA 4PS8A 3PH0C 3ZYKA 3CHSA 2I1KA 1YA0A 3GYZA 2OVBA 2VGXA 3CHMA 3GZSA 4L7TA 2WXFA 3PNLB 4B89A 4JEHA 3FP3A 2FF4A 2AWIA 3FTYA 4DI3A 5CCLA 4G23A 5JJ7A 4I6JA 1HFAA 3Q4AB 4G26A 1N54A 4KT6B 3SD5A 1OWLA 4F7AA 3ZEFA 4UI9J 3TJPA 3D9NA 3CHQA 1OWPA 4TV3A 2XRYA 3QNKA 4BWRA 3FU5A 2PL2A 1E7UA 5D0OD 2GW1A 2VYIA 1HO8A 4UWFA 3U4TA 5BV1A 4UI9K 4IRUA 4KZ0A 2LAHA 3PREA 1BPRA 4F00A 4JNFA 4N3AA 2L0IA 3D2FA 3B7SA 3FUHA 5ENNA 1INZA 4GZDA 4NRHB 4HXIA 5J08A 3PEUB 3MGBA 2J4BA 2WQ6A 3TL5A 4GZ3A 5M72A 1OWNA 1HX8A 3L54A 3Q49B 5FT9A 3FWVA 1X5BA 3RRMB 3SFZA 2GRLA 3FUJA 4GCOA 1L5JA 4A1GA 1IYGA 4GCNA 2VSNA 4WNEA 3AS4A 4MLPA 3BEEA 3ESKA 1E7VA 3DPOA 2VTBB 1PC2A 4K03A 3Q5MA 1EPUA 2Y4UA 3MKQA 4NQ0A 1UG3A 3L6AA 4EZPA 4EZYA 5FQ7A 5BV0A 4BFRA 5EKQD 3LVRE 4ANWA 3CVPA 3EIJA 3FY4A 4KVMA 1TJFA 5D0QD 4M3OA 4WAFA 3RK6A 2LNIA 2ZU6B 5AENA 1FCHA 2WXHA 2LAIA 2YHEA 3MV3B 3PUKA 4UWKA 3CK7A 3TAXA 5CCMA 3LEWA 3JUIA 5FZQA 3T8MA 1MHQA 2XCBA 5CMYA 4ATGA 4JA7A 4DPRA 2WXMA 4B9QA 4JC8A 3QWPA 3QAQA 4GMLA 2BUGA 3CGHA 2WQ7A 2CFUA 1Z6TA 4HS2A 4BX8A 2I1JA 3QARA 5G04J 3CVYA 2JLBA 4KXKB 5AYWD 5FWQA 2VTBA 3LS8A 3FTZA 2AVPA 2KHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILI A;  3SBT B;  3ZEF A;  4ILG A;  3SBS A;  4I43 A;  4ILH B; 
#chains in the Genus database with same CATH topology
 5CEA A;  2BF0 X;  3E33 A;  2I9C A;  3B7T A;  3VLE A;  3ZFW A;  3ZVV A;  3ZRH A;  1H6O A;  3SNX A;  3Q73 A;  3HVE A;  2H6I A;  4V3I A;  2JAB A;  3D9J A;  2DCP A;  1AP7 A;  4K5B A;  3CVX A;  3DBS A;  2J09 A;  4C0M A;  2CG3 A;  3LY8 A;  3IHV A;  3FTU A;  2P58 C;  4ILH B;  2DZO A;  3TWS A;  1SVX A;  4GYW A;  1O1T A;  4L2L A;  3QNJ A;  3HXD A;  4Q96 A;  1MX2 A;  3ZUV B;  4GYY A;  4HRM B;  3UT8 A;  4JWC A;  1BU9 A;  3UUX A;  2BED A;  5HI7 A;  4N2S A;  4K5C A;  3LPZ A;  4GZ6 A;  2RG8 A;  3UX4 A;  3FTS A;  2PM6 A;  4N39 A;  1AWC B;  2BKG A;  5AQA A;  3KEZ A;  4ANX A;  1Z5S C;  2XEE A;  3ULE G;  5JJT A;  4TRQ A;  4UWL A;  3URZ A;  1S0P A;  3PVL A;  4IYP A;  4MRU A;  3V30 A;  2R05 A;  4AM9 A;  3IXE A;  3RO2 A;  4EZW A;  2KCV A;  4HYB A;  4BTA A;  3FUI A;  2V4L A;  3D9L A;  4GA0 A;  2IF4 A;  1TNY A;  3D9K A;  2NC9 A;  4KMO A;  4KBQ A;  5LCW C;  5B1B E;  3G2T A;  4GU5 A;  4BX9 A;  4R5G A;  3I4R B;  1HF8 A;  5KNH D;  2L9B A;  1Z3Y A;  2MOW A;  1KT0 A;  2UY1 B;  4UWG A;  4N3C A;  3AS5 A;  4MBG A;  2KXP C;  3DSX A;  3ONK A;  1H6P A;  3TWQ A;  2LXL A;  2ETC A;  3TWR A;  3S2A A;  3HG0 D;  3W9F A;  3QWV A;  4Q94 A;  2XGO A;  2KZT B;  3KD7 A;  1E8Y A;  3RIB A;  4G1T A;  1S63 A;  1HZ4 A;  1FT1 A;  5CEC B;  5EX3 A;  3FH7 A;  3PE3 A;  5BPP A;  2CHX A;  4I17 A;  4ILG A;  3IEG A;  5FZS A;  4WUY A;  2LSV A;  5EX0 A;  4F3V A;  3SBS A;  3GW4 A;  2LO6 A;  4DLO A;  4GMJ A;  4J0U A;  2X6F A;  4EZN A;  3D9P A;  4M7C A;  3TWV A;  4APO A;  5JHA A;  3UT4 A;  5JHB A;  4DRX E;  1W3B A;  2AXZ A;  4IN3 B;  4I2W A;  3RJV A;  2WMN A;  2VGX B;  3B7U X;  3DPP A;  4U0U A;  2QFC A;  5AJD A;  3TG5 A;  5CRU A;  3GZ2 A;  3OAW A;  4O60 A;  1U2V G;  1OCO E;  2KZT A;  4WWO A;  3JXJ A;  3ZIM A;  4LG6 A;  4GTM A;  3CLJ A;  4QFV A;  4XE0 A;  3ZU7 B;  4AJW A;  2P9U G;  4JZY A;  2DIW A;  4LSZ E;  4GZ5 A;  4NIK A;  1RZ4 A;  3DPY A;  3S7B A;  4EZL A;  3PRZ A;  2B0O E;  3L08 A;  2WXO A;  1E8W A;  4APF A;  2XGS A;  4J8S A;  2QYU A;  1JCR A;  3CIA A;  2LSU A;  4KYO B;  5AN8 A;  5EIL A;  4BT8 A;  2OV8 A;  3ZW3 A;  1N4S A;  4XX5 A;  3FEX A;  2RD0 A;  3R9M A;  3TG4 A;  4LEU A;  4E6H A;  1IKN D;  1JCS A;  1PAQ A;  2E2E A;  4R5L A;  1GW6 A;  2HM8 A;  3CHP A;  4JD2 G;  4U8H A;  3P1U A;  4L1B A;  2GRN B;  3PUJ A;  1DC2 A;  5FQ4 A;  3G2S A;  2C2L A;  4PO2 A;  2I6H A;  4JWD A;  4UQY A;  2QZA A;  1UOH A;  5CMW A;  3ZXS A;  3UKR G;  1N9A A;  1QBQ A;  4AY6 A;  4EZS A;  4UQZ A;  1N0R A;  2ZGD A;  5ENS D;  2J49 A;  2PM7 A;  3UIP C;  4CDN A;  1BI7 B;  5G55 A;  1XNF A;  4UUC A;  5G05 C;  4DJA A;  3OXL A;  3HXB A;  3NF1 A;  2Y69 E;  4WWN A;  3PH0 C;  1V55 E;  2OVB A;  3GZS A;  4L7T A;  2WXF A;  3Q4A B;  1OY3 D;  3SD5 A;  3UM3 A;  2BKK B;  2XRY A;  3C3O A;  2PL2 A;  5ENP D;  4UWF A;  3U4T A;  4UI9 K;  4IRU A;  3W9G A;  4CYM D;  4X8Q A;  4A63 B;  1BPR A;  4JNF A;  4N3A A;  2L0I A;  2GRP B;  3FUH A;  4NRH B;  4HXI A;  3LJN A;  3MGB A;  2ZXW E;  3HRA A;  1OWN A;  3RRM B;  3BUA A;  5JA4 D;  3SFZ A;  1K1A A;  3FUJ A;  3AG4 E;  3DST A;  2IO2 C;  3UKU G;  4GCN A;  4WNE A;  3AS4 A;  3BEE A;  3ESK A;  1E7V A;  3AJI A;  3DPO A;  2OCC E;  3Q5M A;  3MKQ A;  1N4P A;  4EZY A;  3CVP A;  5D0Q D;  3FY4 A;  1TNB A;  3RK6 A;  2LNI A;  3PUK A;  3TAX A;  1KPS B;  5FZQ A;  3T8M A;  4JA7 A;  4DPR A;  2WXM A;  3JXI A;  4JC8 A;  3DXM G;  2I1J A;  3QAR A;  2VTB A;  4R5J A;  2V4H C;  4YND A;  3CK9 A;  1IQU A;  3HXE A;  4HOS A;  2ETB A;  3U64 A;  1OWO A;  2AXV A;  3FUK A;  4DX6 D;  3O48 A;  4DUI A;  4E85 A;  2FO1 E;  3MV2 B;  1ELK A;  4U7E B;  3TWT A;  3Q9N C;  3UPV A;  3IKO B;  5HKP A;  3Q47 B;  4ZHB A;  3EHM A;  1KZP A;  4HRN A;  4FA6 A;  4OVV A;  4G24 A;  4BSZ B;  3CVV A;  2YIN A;  4BER A;  1FPP A;  4FAD A;  4ZFH A;  4TXR A;  1Y6I A;  3E37 A;  4HLE A;  5FJY A;  1JWF A;  1O1R A;  1N95 A;  1BD8 A;  3FTW A;  3K9I A;  2X6I A;  5DIZ A;  1QNF A;  3ASG A;  3MJW A;  1Z3X A;  4XI0 A;  5KJL A;  1TEZ A;  3QK0 A;  3SI5 A;  4UI9 C;  2R02 A;  2R03 A;  4C0E A;  1MX6 A;  5BXO A;  4HOT A;  5FQ6 A;  2EQX A;  5D2M C;  1YYH A;  2X6K A;  4H7X A;  3I4G A;  2WXI A;  3CR3 A;  3BU8 A;  2J8S D;  4F1P A;  3SY2 A;  4KZC A;  3U66 A;  1HH8 A;  3NAW A;  1RW2 A;  1UW4 B;  1SA5 A;  4PDX A;  4A3T A;  5C1D A;  2HO1 A;  3UIO C;  2BPR A;  3ZYM A;  4TXP A;  3UQ3 A;  4A3V A;  2VJ8 A;  3SFX A;  2YQ8 A;  5ITZ F;  3UIN C;  2R17 C;  3L16 A;  3J5P A;  2H6F A;  3FEY A;  2FBN A;  3FH8 A;  2YHC A;  4A1S A;  3SBT B;  2R2L A;  3NOC D;  3R9A B;  1OCR E;  3LJ3 A;  4JW1 A;  4EQF A;  4JL0 A;  3MYV A;  1Y8M A;  4EZV A;  3G2W A;  1NA3 A;  5AQ7 A;  4YDW A;  2X38 A;  3LDZ A;  2UWJ G;  3NZS A;  4HY9 A;  4JA9 A;  1DKZ A;  3EU5 A;  2WXR A;  5EYP F;  3VLF A;  3BG0 B;  1HXI A;  3OXF A;  1HS6 A;  3Q7A A;  3G2V A;  3E4B A;  4P29 A;  3X2Q E;  4RSY A;  4I1M A;  3ML9 A;  4HQD A;  1IHB A;  3QB2 A;  4EPZ A;  4Y6C A;  3ZKJ A;  2OOE A;  2PNN A;  2IQC A;  3EJN A;  3TXM A;  3C5R A;  4C9B B;  1YUW A;  4OAU C;  2FO7 A;  3L22 A;  4PS3 A;  4YVQ C;  4U0S A;  3EHQ A;  2OP6 A;  4JXT A;  4DX1 A;  2XPY A;  3D3M A;  3I3N A;  1H2T C;  2F37 A;  2XZD G;  2GGF A;  3Q79 A;  4JWE A;  2XGM A;  3CV0 A;  5ANL A;  1JUQ A;  4GPM A;  5EYL A;  3ZN3 A;  3D9H A;  3DEP A;  2ILR A;  5CED B;  3DPD A;  4MKT A;  3NB2 A;  1SQM A;  4ABN A;  3FFL A;  4MS6 A;  1WM5 A;  5BNW A;  1QQE A;  2QYJ A;  1NP7 A;  2VGE A;  4JN4 A;  2AJA A;  4LUN U;  5EIB E;  3D9O A;  3DSS A;  2P9L G;  5HRY A;  2GRR B;  3CVW A;  3KAE A;  4Y6W A;  4JHK A;  3LY7 A;  1OCZ E;  2H6G A;  1CKR A;  5LP0 A;  4D10 C;  3HIZ A;  2L6J A;  4DK5 A;  1BLX B;  4JB8 P;  2F0Y A;  2VSO E;  3ASD A;  3N71 A;  3Q75 A;  1Q5L A;  2WXK A;  2PZI A;  4ANU A;  2EIL E;  2WXN A;  2KM4 A;  1JWG A;  3ASH A;  5CRV A;  3RU0 A;  1B89 A;  4GAA A;  1N4R A;  3V79 K;  3L82 A;  3SHF A;  4I6E A;  4PS7 A;  4URK A;  4HNA D;  4RG9 A;  3ZPJ A;  2R59 A;  4FL9 A;  4N3B A;  2WQH A;  4XIF A;  1IXV A;  1NL4 A;  3PZ3 A;  4DLQ A;  3CK8 A;  3CKB A;  3J5Q B;  2X6J A;  1MJ0 A;  2M63 A;  2VSX E;  3ULY A;  1KLX A;  2ETA A;  3IHY A;  2FEZ A;  4G2V A;  3NBN B;  4EZO A;  3DSU A;  5EN5 D;  3ABM E;  4ACL A;  3DQG A;  1HG2 A;  2P9I G;  2IEJ A;  3CST A;  4EZZ A;  2FUL A;  2C0L A;  2VGY A;  3B7R L;  4H7Y A;  4GTV A;  1Q2Z A;  1SA4 A;  5ENQ D;  1N11 A;  2VGX A;  5ENO D;  3FP3 A;  2FF4 A;  3FTY A;  5JJ7 A;  4I6J A;  1HFA A;  1KZO A;  1OWL A;  4F7A A;  4UI9 J;  3UM1 A;  4TV3 A;  3CHQ A;  3QNK A;  1E7U A;  1HO8 A;  2LAH A;  4F00 A;  4U8Y D;  3B7S A;  2J4B A;  2XS1 A;  3TL5 A;  1ZB1 A;  2EIJ E;  5AAO A;  1HX8 A;  3FWV A;  4GCO A;  1L5J A;  4A1G A;  4MLP A;  2VTB B;  1EPU A;  4NQ0 A;  1UG3 A;  4EZP A;  4BFR A;  5EKQ D;  3HXF A;  3EIJ A;  5CBO A;  1N94 A;  2ZU6 B;  2EIM E;  1FCH A;  2LAI A;  3MV3 B;  4UWK A;  4GTS A;  3JUI A;  5CMY A;  3UI2 A;  3QAQ A;  2H6H A;  2WQ7 A;  2CFU A;  4BX8 A;  3CVY A;  2JLB A;  4KXK B;  5FWQ A;  3LS8 A;  2AVP A;  2KHO A;  4FJY A;  2OND A;  3ZNG A;  5B1A E;  4GTR A;  5LCW J;  4CCA A;  3DPQ A;  4HOU A;  2GRM A;  3SZ7 A;  5AIJ A;  1D9S A;  1LD7 A;  3OXG A;  1IQR A;  4XKC A;  1H2U A;  3RRN B;  2WXQ A;  3PE4 A;  4R7L A;  3ASF A;  3ABK E;  4HRL A;  4EHM A;  2GRO B;  3OTN A;  3R7R A;  3LY9 A;  2VQ2 A;  5J90 A;  3KSL A;  2WPV A;  2WXJ A;  2XZT G;  2J4D A;  2IJG X;  3N8E A;  2Q7F A;  2V5F A;  5A6C A;  4B94 A;  5FTP A;  4J8F A;  4AXH A;  2IU1 A;  3TGO A;  4IUL A;  3ENE A;  1NA0 A;  3QJZ A;  2IOL A;  2KC7 A;  3EIQ C;  3CHO A;  4OYS A;  5G2N A;  4JWI A;  1QYM A;  3AG2 E;  3FTV A;  5CBN A;  2P9N G;  3S7J A;  3FH5 A;  3V2X A;  3QC1 A;  1EDU A;  5ENR D;  1O5M A;  1NI1 A;  4F53 A;  3UT7 A;  4FHK A;  5KBA A;  4FC8 A;  2QXL A;  1PY1 A;  4MQD A;  2MHK A;  3MA5 A;  4G8L A;  4AIF A;  4EZQ A;  2ZIR A;  3F6Q A;  4EZU A;  1WG0 A;  3NZU A;  4O6F A;  3CQC B;  2CFZ A;  5ANR A;  3FUF A;  3PNT B;  3TWW A;  4B93 B;  5G05 J;  2GRQ B;  4AVX A;  2MYO A;  3AS8 A;  1LF8 A;  4GMR A;  4AEZ C;  4CDR A;  3FHE A;  4U63 A;  4CT0 A;  1YCS B;  4U8V D;  1NZN A;  3APF A;  4N5C A;  3EU9 A;  1S70 B;  5LX8 A;  3EHR A;  3Q15 A;  4YVO A;  2P2C P;  2R5S A;  2LXM A;  2Y4T A;  1TNU A;  2F8X K;  4AP2 A;  4O1O A;  1LTX A;  4F1S A;  3Q9U C;  4FHJ A;  3EDT B;  3E30 A;  1E96 B;  5BW8 C;  2UY1 A;  3ZHE A;  3U3W A;  1K8K G;  3P2B A;  3FDH A;  4FU3 A;  5AQ9 A;  7HSC A;  2XPI A;  3LCA A;  4DX5 D;  3T5V A;  2A5E A;  5BXU A;  3TWU A;  2EIK E;  2KCL A;  4L2Y A;  5TKY A;  4NAC A;  3I5P A;  4R5I A;  4WND A;  2DZN A;  4PH4 B;  5C2Y A;  3AG1 E;  4HBD A;  1BPO A;  2XEH A;  4EZJ A;  1VDY A;  5A23 A;  4OAV B;  1O1S A;  4F01 A;  1ZBP A;  4YDO A;  2JEK A;  4JHJ A;  1HG5 A;  4K0R A;  2AXU A;  3VLD A;  1MQS A;  3B13 A;  2KBX A;  4BET A;  4TUU A;  2FI7 A;  3R7Q A;  2L6B A;  3ABL E;  5E76 A;  5BT1 A;  4OVU A;  4XI9 A;  3JCK C;  1N4Q A;  3LVQ E;  4RG6 A;  1UJJ A;  3FUD A;  1A5E A;  2XCC A;  3O4Z A;  1S64 A;  4RLY A;  4EZR A;  2WVI A;  5CHE E;  5EDS A;  4GA1 A;  5ARG A;  4B0Z A;  3CSF A;  4FP7 A;  4UQX A;  5AAR A;  2KAT A;  1QZ2 A;  4J8E A;  4ANV A;  3C7N A;  4N2Q A;  3JQ1 A;  5FZR A;  2RKK A;  3JYS A;  1HE8 A;  4U04 A;  4JEU A;  5FQ8 A;  3LYA A;  3ML8 A;  3HXC A;  4BEP A;  3UMV A;  2J07 A;  4XEI G;  4A55 A;  1ELR A;  2LUH A;  4WNG A;  3CHR A;  5KWD A;  1H6K A;  1D8E A;  3CVN A;  5HS0 A;  4JVS A;  4GTT A;  4W9R A;  3ZGQ A;  3DSV A;  3V2O A;  2IFU A;  3T8K A;  1V54 E;  3ZHE B;  2Y3A A;  2KCK A;  3CVQ A;  3MEK A;  4NUR A;  3KSQ A;  2RFA A;  1JPL A;  2A4Z A;  5KJN A;  3QOU A;  3KS2 A;  2I2O A;  3C7N B;  4GA2 A;  4FUL A;  1H19 A;  2B6C A;  4K5A B;  2DYR E;  2V5Q C;  4G25 A;  4I1O B;  2XEN A;  1SW6 A;  4DX2 A;  3CVU A;  1OXJ A;  1FVH A;  4U95 D;  1FT2 A;  1EF1 C;  1FVF A;  3ZYK A;  3CHS A;  2I1K A;  1YA0 A;  3GYZ A;  4B89 A;  4DI3 A;  4G23 A;  1N54 A;  4KT6 B;  2DWZ A;  3ZEF A;  3D9N A;  4LNU D;  4QQI A;  2GW1 A;  2VYI A;  3D2F A;  2HE0 A;  5ENN A;  3AG3 E;  2F8Y A;  5M72 A;  3L54 A;  1OT8 A;  2GRL A;  1IYG A;  4K03 A;  2Y4U A;  4HLL A;  3L6A A;  2ZIS A;  5BV0 A;  2DYS E;  3ASN E;  4KVM A;  4HI8 A;  3SQV A;  5AEN A;  2YHE A;  3CK7 A;  4BES A;  2XCB A;  5ENT D;  1TNZ A;  4ATG A;  3QWP A;  1MYO A;  2BUG A;  3CGH A;  1Z6T A;  5AYW D;  3S7F A;  3PZD A;  3AAA C;  2C0M A;  3ASO E;  1WAO 1;  2IOS A;  5KNG A;  2BTD A;  4CT4 A;  3FU6 A;  5FIO A;  3QWW A;  1YMP A;  2WM9 A;  5A7D B;  4ACK A;  2EIN E;  4GTQ A;  3SGH A;  4C48 B;  3UM0 A;  1XGW A;  2ZGG A;  3PEV B;  3FU3 A;  2XQ0 A;  3RO3 A;  4CDM A;  2A5U A;  5G04 C;  3C98 A;  4L9P A;  4I1A A;  3MKR A;  2NSZ A;  1WY6 A;  3QDN A;  5KCM A;  4HOR A;  3RKV A;  1NFI E;  4WNF A;  4B8A A;  4CEM A;  2QY7 A;  3CVL A;  1U3C A;  1JCQ A;  3IV0 A;  2AW6 A;  1DVP A;  4KVO A;  1SZA A;  3DWL G;  2V7Y A;  5H7P A;  4RVB A;  4CRW A;  5ARF A;  4I9C A;  3E34 A;  4HB5 A;  4EBA G;  3KEA A;  4GPK A;  5BUZ A;  3RSE G;  3C3Q A;  1U3D A;  4LCT A;  3RRU A;  3FUE A;  3APD A;  3SF4 A;  1DCQ A;  3Q7F A;  4J8Y A;  4BSX A;  3S7D A;  5B3S E;  3FU0 A;  4CGV A;  3B7B A;  4Q69 A;  4AY5 A;  5LOZ A;  3VTX A;  3D9I A;  1TR4 A;  4I9E A;  5FIN A;  2L0T B;  4F6R D;  1KT1 A;  1BI8 B;  3PDN A;  3VTY A;  5KJM A;  2Y1L E;  3H0X A;  1TJC A;  5CER B;  4ATZ D;  2V8S E;  2J08 A;  4AV7 A;  4XKB A;  4UWH A;  4U0Z A;  4YDE A;  3JQ0 A;  1HU3 A;  1X81 A;  3E32 A;  4U96 D;  4ILI A;  4E81 A;  1ZU2 A;  3HVE B;  2VSY A;  3DRA A;  3UM2 A;  2WMO A;  1TYQ G;  1TNO A;  4GYO A;  1D8D A;  1DKY A;  3ESL A;  4HVB A;  4FJZ A;  2X3M A;  4WV5 A;  1A17 A;  4BTB A;  3C3R A;  2MRI A;  3ISM C;  2NXP A;  3RAU A;  4FLB A;  4L23 A;  3U9W A;  1DCE A;  1K1B A;  3FUL A;  2ION A;  3DXK G;  1SZ9 A;  3L17 A;  1U00 A;  3QKY A;  4TXQ A;  5JJ6 A;  4EZK A;  3JUE A;  3AU5 A;  4ME2 A;  3AU4 A;  5E75 A;  2XEV A;  3HHM A;  1N0Q A;  2HYZ A;  3NQP A;  3FTX A;  5DBK A;  1EYH A;  1OCC E;  2XHE A;  4LER A;  4LNG A;  4GTP A;  4EZT A;  1UJK A;  4JPS A;  3WXX A;  3APC A;  1E90 A;  2P9S G;  2RFM A;  3NOG D;  2J9Q A;  1H2V C;  4EZX A;  4LRZ A;  4N5Q A;  1G3N B;  2PQN A;  3B95 A;  3L13 A;  3MZL B;  5JMN D;  3PZ2 A;  3ZYQ A;  4YDY A;  4EEC A;  2X6H A;  3CEQ A;  3ULQ A;  2PQR A;  4DX7 D;  3LXU X;  3PZ1 A;  3BQO A;  1WDY A;  3ZXP A;  4DI4 A;  2CG2 A;  5KJK A;  5E84 A;  3HDX A;  4J6I A;  3EHN A;  4WV7 A;  1N52 A;  4PUC A;  2WXG A;  4FLH A;  3DOB A;  2WB2 A;  4HOQ A;  4CGW A;  1K3Z D;  3CKC A;  3TWX A;  5T4Y A;  2XPZ A;  1UN9 A;  1ELW A;  3SO8 A;  4GZC A;  3ONL A;  3MX3 A;  5LFA A;  3IBE A;  2P9K G;  4EBA A;  3LKU A;  5AJL A;  1OUV A;  1DG4 A;  4I2Z A;  1TN7 A;  4I6G A;  4I43 A;  4JHR A;  5T3R A;  5AQB A;  3GZ1 A;  3G2U A;  2CHZ A;  3D2E A;  4B8C B;  4R5K A;  2DBA A;  3Q78 A;  2WXL A;  3MCX A;  1MX4 A;  1H0A A;  5EID A;  4U07 A;  1IHG A;  1DNP A;  3DSW A;  2XRZ A;  2P9P G;  3BG1 B;  2E0I A;  3DEO A;  4J7W A;  3PZ4 A;  3HYM B;  3UXG A;  3CQG B;  3MKQ B;  1P5Q A;  4XZ4 A;  3T5X A;  2YNQ A;  2CHW A;  4BT9 A;  4CZ2 D;  3C72 A;  4HFG A;  2OEV A;  5HQ8 A;  4J8D A;  4TUM A;  3TXN A;  4JNE A;  4BY6 A;  2WXP A;  3D9M A;  4G11 A;  4HI9 A;  3UTM A;  2IY0 C;  4WWP A;  2OEW A;  2Y0B G;  1E8Z A;  4GB9 A;  3FUN A;  4RQI A;  5T8I A;  3FUM A;  1E8X A;  3PS6 A;  3ZYL A;  2OVF A;  3EUV A;  4AOF A;  4LNB A;  1OWM A;  2V0P A;  2IO3 C;  4Z68 A;  2HR2 A;  2DVW A;  1UN8 A;  1DKX A;  1LD8 A;  4PS8 A;  3CHM A;  3PNL B;  4JEH A;  2AWI A;  5CCL A;  4G26 A;  3TJP A;  4GTO A;  1OWP A;  3V31 A;  4BWR A;  2QC9 A;  3FU5 A;  5D0O D;  5BV1 A;  4KZ0 A;  3PRE A;  1INZ A;  1MZC A;  4GZD A;  5J08 A;  3PEU B;  2WQ6 A;  4GZ3 A;  2XS8 A;  1TN8 A;  3Q49 B;  5FT9 A;  1X5B A;  4O1P A;  2VSN A;  1PC2 A;  2NYJ A;  3WG7 E;  5IY5 E;  5FQ7 A;  3LVR E;  4ANW A;  1TN6 A;  1TJF A;  4M3O A;  4WAF A;  2WXH A;  5CCM A;  4G8K A;  3LEW A;  1MHQ A;  5D66 A;  4B9Q A;  3T9K A;  4GML A;  3L9T A;  3SFY A;  4HS2 A;  5G04 J;  3FTZ A; 
#chains in the Genus database with same CATH homology
 4FJY A;  3PZD A;  3CK9 A;  4YND A;  2C0M A;  2OND A;  3S7F A;  1IQU A;  1WAO 1;  2BF0 X;  4CCA A;  2IOS A;  5LCW J;  4HOS A;  2BTD A;  4HOU A;  3DPQ A;  4CT4 A;  2GRM A;  3U64 A;  3SZ7 A;  3FU6 A;  2I9C A;  1OWO A;  5AIJ A;  3B7T A;  3VLE A;  3QWW A;  3ZFW A;  2WM9 A;  3OXG A;  2AXV A;  5A7D B;  4R5J A;  4ACK A;  3ZVV A;  3FUK A;  1IQR A;  3SGH A;  3ZRH A;  4XKC A;  3O48 A;  3SNX A;  1H2U A;  4E85 A;  1XGW A;  3RRN B;  2WXQ A;  3PEV B;  3PE4 A;  4R7L A;  3HVE A;  3FU3 A;  2XQ0 A;  3RO3 A;  4CDM A;  2A5U A;  3ASF A;  5G04 C;  4V3I A;  3C98 A;  3D9J A;  3MV2 B;  1ELK A;  2DCP A;  3OTN A;  4I1A A;  3MKR A;  3R7R A;  2NSZ A;  3LY9 A;  1WY6 A;  3QDN A;  5KCM A;  3UPV A;  4HOR A;  2VQ2 A;  3IKO B;  3CVX A;  5J90 A;  3RKV A;  2WPV A;  3Q47 B;  3EHM A;  4WNF A;  3DBS A;  4B8A A;  2WXJ A;  2J09 A;  4C0M A;  4CEM A;  2CG3 A;  2QY7 A;  3CVL A;  2J4D A;  3LY8 A;  1U3C A;  2IJG X;  3IHV A;  4FA6 A;  4OVV A;  3N8E A;  2Q7F A;  2V5F A;  3FTU A;  2P58 C;  5A6C A;  4G24 A;  4ILH B;  3IV0 A;  4B94 A;  5FTP A;  4J8F A;  3CVV A;  2YIN A;  2AW6 A;  1DVP A;  4KVO A;  1SZA A;  4AXH A;  4FAD A;  2IU1 A;  2V7Y A;  4RVB A;  3TGO A;  4CRW A;  5ARF A;  4GYW A;  3ENE A;  1NA0 A;  4I9C A;  4IUL A;  4L2L A;  3QJZ A;  2IOL A;  3QNJ A;  1Y6I A;  4Q96 A;  4EBA G;  2KC7 A;  4HLE A;  4GPK A;  3EIQ C;  5FJY A;  3CHO A;  1JWF A;  4GYY A;  4OYS A;  5G2N A;  3FTW A;  4JWI A;  3UT8 A;  5BUZ A;  4JWC A;  3FTV A;  1U3D A;  3UUX A;  4LCT A;  3K9I A;  5HI7 A;  3RRU A;  2X6I A;  3FUE A;  3APD A;  5DIZ A;  1QNF A;  4N2S A;  3S7J A;  3SF4 A;  3FH5 A;  3ASG A;  3LPZ A;  3MJW A;  1EDU A;  3QC1 A;  1Z3X A;  4GZ6 A;  2RG8 A;  3UX4 A;  4BSX A;  3S7D A;  4F53 A;  3FTS A;  4XI0 A;  2PM6 A;  4N39 A;  3FU0 A;  3UT7 A;  4CGV A;  5KJL A;  1TEZ A;  4FHK A;  3QK0 A;  3KEZ A;  4ANX A;  3SI5 A;  4Q69 A;  4AY5 A;  4UI9 C;  5JJT A;  4FC8 A;  5LOZ A;  4TRQ A;  3D9I A;  4UWL A;  1PY1 A;  3VTX A;  2QXL A;  4MQD A;  2MHK A;  4I9E A;  3MA5 A;  4AIF A;  3URZ A;  1S0P A;  2L0T B;  3PVL A;  4IYP A;  1KT1 A;  4C0E A;  3PDN A;  4MRU A;  3VTY A;  5FQ6 A;  4HOT A;  5KJM A;  4EZQ A;  2EQX A;  3H0X A;  4AM9 A;  4EZU A;  3RO2 A;  4EZW A;  1TJC A;  2KCV A;  2X6K A;  4H7X A;  3NZU A;  2V8S E;  4O6F A;  3I4G A;  2WXI A;  3CR3 A;  2J08 A;  3CQC B;  4AV7 A;  2CFZ A;  4XKB A;  4UWH A;  4U0Z A;  4BTA A;  5ANR A;  3JQ0 A;  3FUF A;  3PNT B;  4HYB A;  4KZC A;  3FUI A;  2V4L A;  3D9L A;  1HU3 A;  4GA0 A;  5G05 J;  1HH8 A;  4AVX A;  3U66 A;  3AS8 A;  4ILI A;  4E81 A;  1UW4 B;  1LF8 A;  1ZU2 A;  2IF4 A;  3HVE B;  4PDX A;  4AEZ C;  2VSY A;  4A3T A;  2HO1 A;  4CDR A;  5C1D A;  2BPR A;  3ZYM A;  3UQ3 A;  3FHE A;  4A3V A;  2VJ8 A;  3D9K A;  2WMO A;  2YQ8 A;  2NC9 A;  4KMO A;  2R17 C;  3L16 A;  4U63 A;  4CT0 A;  3FEY A;  1NZN A;  4KBQ A;  5LCW C;  2FBN A;  3G2T A;  3APF A;  4N5C A;  3FH8 A;  4GYO A;  4GU5 A;  4BX9 A;  2YHC A;  1DKY A;  4A1S A;  3ESL A;  4HVB A;  4FJZ A;  4R5G A;  3SBT B;  2X3M A;  3I4R B;  5LX8 A;  3R9A B;  4WV5 A;  1HF8 A;  3LJ3 A;  3Q15 A;  4YVO A;  2R5S A;  1A17 A;  4JW1 A;  4EQF A;  4JL0 A;  4BTB A;  2Y4T A;  2L9B A;  1Z3Y A;  3MYV A;  2MOW A;  1Y8M A;  1KT0 A;  2MRI A;  4AP2 A;  2UY1 B;  4EZV A;  4F1S A;  3G2W A;  1NA3 A;  2NXP A;  4FHJ A;  2X38 A;  4UWG A;  4FLB A;  4N3C A;  3LDZ A;  2UWJ G;  3EDT B;  1E96 B;  3NZS A;  2UY1 A;  5BW8 C;  4L23 A;  3ZHE A;  3AS5 A;  4HY9 A;  4JA9 A;  3U9W A;  3U3W A;  1DKZ A;  2WXR A;  3FUL A;  3P2B A;  3FDH A;  3VLF A;  2ION A;  4FU3 A;  3ONK A;  1SZ9 A;  3BG0 B;  3L17 A;  7HSC A;  1U00 A;  1HXI A;  2XPI A;  3LCA A;  3OXF A;  3QKY A;  3T5V A;  1HS6 A;  3S2A A;  3G2V A;  5JJ6 A;  3E4B A;  3QWV A;  4EZK A;  3AU5 A;  2XGO A;  4Q94 A;  2KZT B;  4P29 A;  3KD7 A;  1E8Y A;  2KCL A;  3RIB A;  4G1T A;  4ME2 A;  4RSY A;  4I1M A;  3AU4 A;  5E75 A;  4L2Y A;  1HZ4 A;  2XEV A;  3HHM A;  5TKY A;  4NAC A;  5EX3 A;  3ML9 A;  2HYZ A;  3I5P A;  3NQP A;  3FTX A;  3FH7 A;  3PE3 A;  3QB2 A;  4WND A;  2CHX A;  5DBK A;  4EPZ A;  4I17 A;  4Y6C A;  5BPP A;  4R5I A;  1EYH A;  2OOE A;  3IEG A;  4ILG A;  2XHE A;  2IQC A;  4PH4 B;  3EJN A;  4LER A;  5FZS A;  5C2Y A;  3TXM A;  1BPO A;  4EZJ A;  1VDY A;  5A23 A;  4EZT A;  4WUY A;  4C9B B;  1UJK A;  2LSV A;  1YUW A;  4JPS A;  3WXX A;  5EX0 A;  2FO7 A;  4F01 A;  1ZBP A;  4F3V A;  3APC A;  1E90 A;  3L22 A;  4PS3 A;  2JEK A;  4YVQ C;  3SBS A;  4JHJ A;  3GW4 A;  1HG5 A;  2LO6 A;  4K0R A;  4U0S A;  2J9Q A;  4DLO A;  1H2V C;  4EZX A;  4LRZ A;  2AXU A;  4GMJ A;  4J0U A;  1MQS A;  2X6F A;  3VLD A;  4EZN A;  2PQN A;  3B13 A;  3D9P A;  1DG4 A;  3L13 A;  4APO A;  3MZL B;  4TUU A;  5JHA A;  2FI7 A;  2OP6 A;  3R7Q A;  3UT4 A;  5JHB A;  3ZYQ A;  4JXT A;  5E76 A;  1W3B A;  4EEC A;  2AXZ A;  5BT1 A;  2X6H A;  2XPY A;  4OVU A;  3D3M A;  3I3N A;  3CEQ A;  3ULQ A;  1H2T C;  2PQR A;  4XI9 A;  3JCK C;  4IN3 B;  3LXU X;  3LVQ E;  4I2W A;  4RG6 A;  2GGF A;  3RJV A;  4JWE A;  2XGM A;  1UJJ A;  3CV0 A;  2WMN A;  3FUD A;  5ANL A;  4DI4 A;  2CG2 A;  5KJK A;  5E84 A;  2XCC A;  2VGX B;  3B7U X;  3HDX A;  3DPP A;  4J6I A;  1JUQ A;  3O4Z A;  4U0U A;  2QFC A;  3EHN A;  3ZN3 A;  4WV7 A;  1N52 A;  5AJD A;  4PUC A;  2ILR A;  4EZR A;  3DPD A;  4MKT A;  2WVI A;  5CHE E;  3TG5 A;  4GA1 A;  5EDS A;  1SQM A;  4ABN A;  2WXG A;  4FLH A;  3DOB A;  3GZ2 A;  3FFL A;  2WB2 A;  4HOQ A;  4CGW A;  4MS6 A;  3OAW A;  5ARG A;  1WM5 A;  5BNW A;  1QQE A;  3CKC A;  4B0Z A;  3CSF A;  1NP7 A;  2KZT A;  4FP7 A;  5T4Y A;  4JN4 A;  4LUN U;  2XPZ A;  4UQX A;  4WWO A;  1UN9 A;  3ZIM A;  2KAT A;  1ELW A;  1QZ2 A;  3D9O A;  4GZC A;  4J8E A;  3CLJ A;  4ANV A;  3ONL A;  4QFV A;  3CVW A;  4XE0 A;  3MX3 A;  3C7N A;  5LFA A;  3IBE A;  3KAE A;  4JHK A;  3LY7 A;  4Y6W A;  4EBA A;  3LKU A;  3JQ1 A;  1OUV A;  5AJL A;  4AJW A;  4I2Z A;  4N2Q A;  4I6G A;  5FZR A;  4I43 A;  3JYS A;  1CKR A;  1HE8 A;  4JZY A;  5LP0 A;  2DIW A;  4JHR A;  4JEU A;  4U04 A;  4GZ5 A;  4D10 C;  3HIZ A;  5T3R A;  5FQ8 A;  3LYA A;  2L6J A;  3GZ1 A;  3S7B A;  3G2U A;  4EZL A;  2CHZ A;  3ML8 A;  3D2E A;  4DK5 A;  2VSO E;  3PRZ A;  4B8C B;  3UMV A;  3ASD A;  3L08 A;  2WXO A;  3N71 A;  2J07 A;  4R5K A;  1E8W A;  2DBA A;  4A55 A;  1ELR A;  4APF A;  1Q5L A;  2XGS A;  3CHR A;  2WXL A;  4J8S A;  4WNG A;  2WXK A;  1H6K A;  3MCX A;  2PZI A;  4ANU A;  1H0A A;  3CIA A;  3CVN A;  2LSU A;  2WXN A;  4U07 A;  1IHG A;  4KYO B;  2KM4 A;  1DNP A;  1JWG A;  4JVS A;  3ASH A;  4BT8 A;  4W9R A;  2OV8 A;  3RU0 A;  3ZW3 A;  1B89 A;  2XRZ A;  4GAA A;  4XX5 A;  3SHF A;  3FEX A;  4I6E A;  3ZGQ A;  3BG1 B;  4PS7 A;  2E0I A;  4URK A;  2RD0 A;  3TG4 A;  2IFU A;  4RG9 A;  3ZPJ A;  4LEU A;  4E6H A;  2R59 A;  4FL9 A;  4N3B A;  3HYM B;  2WQH A;  4XIF A;  1PAQ A;  3CQG B;  3MKQ B;  1P5Q A;  4DLQ A;  3CK8 A;  3CKB A;  2X6J A;  2E2E A;  4XZ4 A;  4R5L A;  1GW6 A;  2HM8 A;  3T5X A;  3CHP A;  2YNQ A;  2CHW A;  4BT9 A;  4HFG A;  2M63 A;  3ZHE B;  2Y3A A;  5HQ8 A;  2KCK A;  3CVQ A;  4J8D A;  3MEK A;  4NUR A;  2VSX E;  4U8H A;  3P1U A;  3TXN A;  4JNE A;  4BY6 A;  3D9M A;  1KLX A;  2WXP A;  4G11 A;  1JPL A;  4L1B A;  2A4Z A;  5KJN A;  3IHY A;  3PUJ A;  3QOU A;  5FQ4 A;  2FEZ A;  3G2S A;  2C2L A;  2I2O A;  3KS2 A;  3C7N B;  4GA2 A;  4G2V A;  4WWP A;  4PO2 A;  2I6H A;  4FUL A;  1H19 A;  4UQY A;  4JWD A;  1E8Z A;  4GB9 A;  5CMW A;  3FUN A;  3ZXS A;  4EZO A;  5T8I A;  3FUM A;  4G25 A;  4I1O B;  4ACL A;  4AY6 A;  1E8X A;  4UQZ A;  4EZS A;  3PS6 A;  3ZYL A;  2J49 A;  2PM7 A;  2OVF A;  3DQG A;  4AOF A;  4CDN A;  1HG2 A;  3CST A;  4EZZ A;  3CVU A;  1OWM A;  2V0P A;  5G55 A;  1XNF A;  5G05 C;  2FUL A;  4DJA A;  2HR2 A;  2C0L A;  3OXL A;  1FVH A;  2VGY A;  3B7R L;  4H7Y A;  1UN8 A;  3NF1 A;  1EF1 C;  1FVF A;  4WWN A;  1DKX A;  4PS8 A;  3PH0 C;  3ZYK A;  3CHS A;  2I1K A;  1YA0 A;  3GYZ A;  2OVB A;  2VGX A;  3CHM A;  3GZS A;  4L7T A;  2WXF A;  3PNL B;  4B89 A;  4JEH A;  3FP3 A;  2FF4 A;  2AWI A;  3FTY A;  4DI3 A;  5CCL A;  4G23 A;  5JJ7 A;  4I6J A;  1HFA A;  3Q4A B;  4G26 A;  1N54 A;  4KT6 B;  3SD5 A;  1OWL A;  4F7A A;  3ZEF A;  4UI9 J;  3TJP A;  3D9N A;  3CHQ A;  1OWP A;  4TV3 A;  2XRY A;  3QNK A;  4BWR A;  3FU5 A;  2PL2 A;  1E7U A;  5D0O D;  2GW1 A;  2VYI A;  1HO8 A;  4UWF A;  3U4T A;  5BV1 A;  4UI9 K;  4IRU A;  4KZ0 A;  2LAH A;  3PRE A;  1BPR A;  4F00 A;  4JNF A;  4N3A A;  2L0I A;  3D2F A;  3B7S A;  3FUH A;  5ENN A;  1INZ A;  4GZD A;  4NRH B;  4HXI A;  5J08 A;  3PEU B;  3MGB A;  2J4B A;  2WQ6 A;  3TL5 A;  4GZ3 A;  5M72 A;  1OWN A;  1HX8 A;  3L54 A;  3Q49 B;  5FT9 A;  3FWV A;  1X5B A;  3RRM B;  3SFZ A;  2GRL A;  3FUJ A;  4GCO A;  1L5J A;  4A1G A;  1IYG A;  4GCN A;  2VSN A;  4WNE A;  3AS4 A;  4MLP A;  3BEE A;  3ESK A;  1E7V A;  3DPO A;  2VTB B;  1PC2 A;  4K03 A;  3Q5M A;  1EPU A;  2Y4U A;  3MKQ A;  4NQ0 A;  1UG3 A;  3L6A A;  4EZP A;  4EZY A;  5FQ7 A;  5BV0 A;  4BFR A;  5EKQ D;  3LVR E;  4ANW A;  3CVP A;  3EIJ A;  3FY4 A;  4KVM A;  1TJF A;  5D0Q D;  4M3O A;  4WAF A;  3RK6 A;  2LNI A;  2ZU6 B;  5AEN A;  1FCH A;  2WXH A;  2LAI A;  2YHE A;  3MV3 B;  3PUK A;  4UWK A;  3CK7 A;  3TAX A;  5CCM A;  3LEW A;  3JUI A;  5FZQ A;  3T8M A;  1MHQ A;  2XCB A;  5CMY A;  4ATG A;  4JA7 A;  4DPR A;  2WXM A;  4B9Q A;  4JC8 A;  3QWP A;  3QAQ A;  4GML A;  2BUG A;  3CGH A;  2WQ7 A;  2CFU A;  1Z6T A;  4HS2 A;  4BX8 A;  2I1J A;  3QAR A;  5G04 J;  3CVY A;  2JLB A;  4KXK B;  5AYW D;  5FWQ A;  2VTB A;  3LS8 A;  3FTZ A;  2AVP A;  2KHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...