4ILIA

Crystal structure of an aar2p s253e phosphomimetic mutant protein
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
304
structure length
290
Chain Sequence
NTVPFTSAPIEVTIGIDQYSFNVKENQPFHGIKDIPIGHVHVIHFQHADNSSMRYGYWFDCRMGNFYIQYDPKDGLYKMMEERDGAKFENIVHNFKERQMMVSYPKIDEDDTWYNLTEFVQMDKIRKIVRKDENQFSYVDSSMTTVQENELSSSSSDPAHSLNYTVINFKSDKSYYLNTVMLQGIFKNSSNYFGELQFAFLNAMFFGNYGSSLQWHAMIELICSEATVPKHMLDKLDEILYYQIKTLPEQYSDILLNERVWNICLYSSFQKNSLHNTEKIMENKYPELLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing
molecule keywords A1 cistron-splicing factor AAR2
publication title Structural basis for dual roles of Aar2p in U5 snRNP assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 75
structure length 290
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.550 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4iliA02
2.60.34.20 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4iliA01
3ZEFA 4ILHB 3SBSA 4ILGA 3SBTB 4I43A 4ILIA
chains in the Genus database with same CATH superfamily
1DG4A 4L23A 4CYMD 2J4DA 1L5JA 1E7UA 1HH8A 3LYAA 4HBDA 2VTBB 1Z6TA 3TWVA 5D0QD 3FFLA 5T4YA 3ASNE 3SI5A 3UT8A 1Z3XA 2QY7A 2FO1E 3PRZA 3CHQA 2P58C 1HFAA 2X6KA 2HR2A 3CVNA 2KM4A 1NA3A 3UM1A 3ZNGA 1N9AA 3MYVA 3SNXA 3QWVA 4HFGA 3RJVA 3FULA 2WVIA 3I4RB 4DX5D 3AG1E 5FQ6A 1U2VG 2I1KA 3IV0A 2XRZA 2XCCA 3AS5A 1OWPA 1JCSA 2MYOA 3LS8A 4BESA 2QYJA 4GAAA 4ME2A 5G55A 1N95A 3LPZA 2C2LA 4GMJA 2DBAA 3I3NA 1TN8A 4KXKB 1EYHA 4O6FA 3EU9A 3JXIA 3CKBA 4HLEA 5FZQA 4F6RD 4DLOA 4WWOA 3C72A 4K5CA 1KT1A 2VSOE 3FUHA 4M3OA 4HY9A 1OT8A 4B9QA 4U95D 3QOUA 2VGEA 3C3OA 2AJAA 2XEHA 3ULYA 4JEUA 1A5EA 5EYPF 2RD0A 3FUJA 3DSXA 4BSXA 3IEGA 2A5UA 3ASFA 2XCBA 1TR4A 2OEWA 7HSCA 3SY2A 2L6JA 1JCQA 2XGOA 3FTSA 4CGWA 4B0ZA 3ZXSA 2WXHA 4J8FA 2KCVA 3N71A 3RKVA 4APFA 4KZ0A 4YNDA 2EINE 1HG2A 2HO1A 3G2UA 5CEDB 3FEYA 5FQ8A 1GW6A 2VJ8A 3MCXA 2VSYA 4GPMA 3UKUG 4G1TA 4AY5A 3EHRA 2BKKB 3T9KA 4AP2A 4JXTA 2HYZA 3ZYQA 2V5QC 4JC8A 5LCWC 3FU3A 3TAXA 4FL9A 1HX8A 2GRNB 3UMVA 3HG0D 3T8KA 2P9IG 2I1JA 4PUCA 5C2YA 3G2WA 1TNOA 1PC2A 4R5LA 4J8DA 5LFAA 5ENRD 4YVOA 1TN7A 5KJMA 4R5KA 2IO2C 3LJ3A 3Q7AA 3CHSA 4GMLA 1QNFA 3HVEA 2IU1A 1N94A 4BTBA 1DC2A 3CEQA 4HRLA 4HRMB 3O48A 1D9SA 5ANRA 3CHOA 2JLBA 1BD8A 1O1SA 3LVQE 3TGOA 2GGFA 2IQCA 4WNEA 2XZTG 2VGYA 1FT2A 5ARGA 3GW4A 1WY6A 3UUXA 5TKYA 4NACA 2H6FA 1N4QA 4R5IA 1LD8A 3UT4A 2RFMA 3ZYMA 1FPPA 4A3VA 4E6HA 1OWOA 2IY0C 4PO2A 4QQIA 3VLDA 3X2QE 4HOSA 5IY5E 2ZISA 3HXCA 4U04A 4GZCA 4LG6A 1HXIA 1O5MA 3PZ2A 2WB2A 4HXIA 3C7NA 4TXPA 4GTVA 4DK5A 2CHXA 5BXUA 4B94A 2ONDA 2J9QA 5AYWD 3LY9A 3ESKA 3CVQA 1H0AA 1BPRA 1DKXA 4A3TA 3CQGB 4XEIG 1LF8A 3UKRG 3UIPC 4UUCA 3BQOA 3Q47B 3OTNA 4BT8A 2WQ6A 4F53A 3UXGA 2R59A 3L16A 3QWWA 1NL4A 3TWUA 5BV1A 4K0RA 3Q78A 1NZNA 2LAHA 1EDUA 3FEXA 2XPYA 1TNZA 3FHEA 4A1GA 2WXLA 3PDNA 2Y4UA 1OUVA 1OXJA 3D2EA 4I43A 3ZXPA 2F8YA 3V2XA 2EILE 3QAQA 3D3MA 2LNIA 5JA4D 2QXLA 2GW1A 2KCLA 3MKQB 2ZGDA 2L0IA 5FQ7A 2C0MA 1MX6A 5KNGA 3Q7FA 1P5QA 3HIZA 4YDYA 2KATA 3ZU7B 5EDSA 4FJZA 2DVWA 4GTPA 4AEZC 4UQXA 4TUUA 5CHEE 4HYBA 1FT1A 2WXFA 3CHMA 5KJNA 4UQYA 3NBNB 2OOEA 4WNGA 1LD7A 5ITZF 4I6JA 1Y8MA 3ZRHA 3TWRA 1ELKA 2X6FA 5KNHD 4PS3A 4CZ2D 5LX8A 2WQ7A 3QARA 4YDEA 4K5BA 4F3VA 2H6HA 3LJNA 2OVFA 2WXJA 2LXMA 1ELWA 3E32A 3B7TA 3Q5MA 1H6KA 2R03A 1TYQG 2AWIA 5A6CA 3CV0A 4WV7A 3HDXA 3C7NB 4EHMA 4I1MA 4I1AA 5HRYA 2J09A 4AIFA 1UW4B 1LTXA 5CMYA 1SZ9A 3CVXA 2KXPC 3R7RA 3AAAC 4EZVA 3SBSA 1RZ4A 3S2AA 3ZYLA 2F0YA 3D9NA 2OP6A 4DJAA 3JCKC 2EIJE 3E34A 4ANVA 4EZLA 3LCAA 3CVYA 4J6IA 3MJWA 3T5XA 4JWEA 4FLHA 4XKCA 4HNAD 5BXOA 4FLBA 4M7CA 3PE3A 4E81A 4I6EA 4BERA 4U0ZA 5AQ9A 1S0PA 4BFRA 5HQ8A 3ML9A 4I9EA 4QFVA 2LSVA 4JWCA 1HO8A 4GTTA 1E96B 3FH8A 3EHNA 3AU5A 4EZWA 5ANLA 2FBNA 4JW1A 4ILHB 2FO7A 3DEOA 4HI9A 2YHCA 3BG1B 3RRMB 1AWCB 3FH7A 3SD5A 1D8EA 2NSZA 4FU3A 2IO3C 1OWLA 1HE8A 2NXPA 4CRWA 4G26A 1EPUA 5B1AE 2XENA 1Q2ZA 4I9CA 1E8XA 3I4GA 3ZEFA 4LRZA 3OXLA 4GMRA 3BG0B 5KWDA 4OVVA 3LY7A 3SHFA 3UT7A 2GRRB 3EUVA 4XE0A 1W3BA 2BKGA 3DPOA 2A5EA 5BW8C 4Q96A 1SW6A 2XS8A 3N8EA 4N3CA 3PREA 1UJKA 4CDNA 1H6OA 3ZUVB 4MBGA 2DYRE 3KD7A 3DSTA 2P9KG 5HS0A 3QK0A 1NI1A 2DIWA 4V3IA 3DSWA 3TWTA 3DOBA 4EZNA 4N5CA 1WG0A 1H2VC 3CKCA 2P2CP 3GYZA 4JNFA 4I2WA 4AY6A 4GYOA 4JVSA 4R5JA 3NAWA 5AAOA 2Y0BG 3T8MA 5G04J 3RRNB 4LUNU 3VLEA 4U8YD 3PZ3A 4AV7A 4DUIA 4EBAA 2CHZA 5JHAA 2WQHA 5FZRA 4C48B 3UQ3A 1TNBA 4BX8A 4MS6A 4Z68A 3FWVA 2GRLA 2Q7FA 3FUDA 4EZRA 4NRHB 5J08A 3PE4A 4EZPA 4ZFHA 4RG6A 4KZCA 3MKRA 2KCKA 4MLPA 3ML8A 1FVHA 3PZ4A 4JL0A 5G2NA 1KZPA 3C98A 3L17A 1PY1A 4OAUC 4AJWA 2I6HA 2X6JA 1E8WA 3Q73A 2R17C 3FTVA 3DSVA 4EZJA 3V31A 4UWHA 1IQRA 4C9BB 5LP0A 3FTXA 3SFZA 4TRQA 4GTSA 2UWJG 2RG8A 4TUMA 4A55A 4L2LA 4AM9A 4YDWA 5G05J 2L9BA 3LDZA 3U4TA 3QKYA 3CVLA 3PNTB 3ZPJA 5CEAA 4URKA 5EIBE 4D10C 1IKND 2WMNA 2X3MA 4UWKA 4F1SA 4UI9C 3ASHA 2GRPB 2GRMA 4DRXE 5AARA 4LNUD 5EX0A 4DX7D 4GZ5A 1H2TC 4C0EA 3PS6A 3AS8A 1IHBA 3EIQC 2OEVA 3ISMC 4O60A 1V54E 5AJDA 3D9IA 4KT6B 3EIJA 3Q9UC 3SQVA 4Q69A 3VTYA 4U8HA 1Z3YA 2L6BA 3KSQA 4HLLA 4WUYA 5BUZA 5CRUA 1HZ4A 4BTAA 1H6PA 1O1TA 4Y6WA 4L9PA 3CVUA 1MX4A 3ONKA 2I2OA 4A63B 3V79K 4B8CB 1KZOA 2LAIA 3ABKE 3RO3A 3HYMB 1TN6A 4O1PA 5CMWA 1N4SA 3EJNA 3LXUX 1X81A 4X8QA 5EIDA 2R05A 5DBKA 1A17A 2OCCE 4N2SA 2AXVA 1IHGA 3WXXA 1QQEA 4GTOA 4GYYA 3FUIA 1OCOE 3DSUA 1G3NB 4B8AA 1UN8A 4L2YA 1SA4A 1NFIE 3AS4A 3L82A 4FJYA 1ELRA 4B93B 3NQPA 4GCOA 5BNWA 3EU5A 4OYSA 4APOA 3PEVB 1TNUA 4PS8A 4NIKA 3IKOB 1KPSB 1S70B 3KSLA 2YHEA 1AP7A 1HF8A 3MX3A 1JWFA 1TEZA 3QDNA 1U3DA 4JWIA 5AIJA 3LVRE 1BPOA 2FEZA 4EZTA 5ENQD 5JJ7A 3HXFA 3L22A 2MOWA 4G8KA 2L0TB 4XX5A 2AVPA 3IXEA 1MQSA 1V55E 2PL2A 2F37A 4I17A 5JHBA 4JZYA 2WXPA 3U3WA 1U3CA 4G24A 4FULA 5ARFA 2VGXA 1X5BA 3GZ2A 3RSEG 3C5RA 4CEMA 2WXMA 3D9PA 2CHWA 2X6IA 3ASOE 3UIOC 4KVOA 3FU0A 1D8DA 5A7DB 5FT9A 4GA1A 4R7LA 3JUEA 3FTWA 2BF0X 4PS7A 3APDA 5AQAA 5CERB 4EPZA 3HVEB 2P9PG 3D9MA 5ENSD 5C1DA 4GA2A 2QZAA 1HS6A 2C0LA 4AOFA 2GRQB 2IOLA 1QYMA 2R2LA 4BSZB 2ETBA 2QC9A 4GZ3A 3JXJA 2IONA 4HOTA 1FCHA 3D9OA 3QC1A 2QFCA 3CLJA 2V7YA 1OCCE 4K03A 4ACLA 4EZKA 3GZ1A 4WNFA 4IULA 1TJCA 2EIME 4G8LA 4L1BA 2DYSE 1E90A 2PQNA 2P9SG 4ILGA 4ACKA 2J07A 1WAO1 4N39A 2HM8A 5E75A 4GTQA 4DI4A 4DPRA 4EZOA 4F7AA 3TWSA 1SQMA 3D9LA 1NP7A 3CR3A 4CGVA 4Q94A 3LY8A 3D2FA 3CIAA 2VYIA 3Q79A 3L6AA 4FP7A 3J5QB 5B1BE 3IBEA 4MRUA 4JA7A 4XZ4A 1N4RA 4PH4B 3TWWA 3TG5A 2Y69E 4EECA 4FADA 2ZXWE 2CG3A 3FUEA 2HE0A 1TNYA 2LUHA 2XGMA 3KS2A 3PH0C 2XPIA 4H7XA 3MA5A 1UG3A 3D9JA 4J7WA 3NOCD 2RFAA 3B7RL 2ZU6B 3O4ZA 5ENOD 3G2TA 3CGHA 3RAUA 3SO8A 3L13A 5ENPD 2DCPA 2V0PA 5FTPA 2M63A 4KVMA 3LKUA 2VGXB 3EHMA 5JJ6A 3MGBA 4G2VA 3P2BA 5HKPA 4XIFA 4ATZD 3CQCB 3FU6A 4WAFA 1MX2A 1BU9A 3NF1A 1OCRE 1XGWA 3B13A 3IHVA 4JEHA 1INZA 4CT0A 4H7YA 2VQ2A 3DQGA 2BPRA 5AQBA 1ZBPA 4GYWA 4UWGA 3C3QA 5E76A 3URZA 3PZ1A 4E85A 5LCWJ 1S64A 3CHPA 3B7UX 2NC9A 3ZVVA 5A23A 4JWDA 4ABNA 4U7EB 1IQUA 4N5QA 5KJKA 3VLFA 4RSYA 3ZIMA 4I1OB 2YINA 3HRAA 3V30A 4FA6A 3Q49B 4GZDA 4J8YA 5FJYA 3UTMA 2DZNA 3ZHEA 3MV3B 4IN3B 3CSTA 2Y3AA 3ZN3A 3KEAA 3TXNA 4GB9A 4HI8A 2XRYA 3F6QA 1IYGA 3SZ7A 4JHKA 5FZSA 3CHRA 3PVLA 2ETAA 3HXEA 1ZU2A 3FTYA 4ANUA 3V2OA 3JYSA 5KJLA 5T3RA 2P9UG 2RKKA 1JUQA 2XPZA 3J5PA 5CCLA 1OWMA 3DXKG 2KBXA 4MKTA 4GA0A 4ATGA 4RVBA 3UX4A 3SFXA 4AXHA 2AXUA 1SVXA 1N11A 3SGHA 3S7FA 1N0QA 1TJFA 3Q9NC 3DBSA 4G23A 3ZGQA 4HRNA 2AW6A 2KZTA 2KHOA 3L9TA 1YMPA 4EQFA 2E0IA 3W9GA 1FVFA 3CVPA 3EHQA 4FC8A 4K5AB 5AENA 5M72A 4DX6D 3IHYA 2MRIA 4HORA 2J8SD 1QZ2A 3K9IA 2CFUA 2XEEA 4TXRA 3E30A 5BV0A 3CK8A 2DZOA 1CKRA 4JPSA 2WXNA 4JA9A 1DCQA 1YA0A 5AJLA 3MZLB 2EIKE 3UI2A 1OWNA 3RRUA 2OV8A 2P9NG 4NURA 3NZUA 2F8XK 4IRUA 2DWZA 4TXQA 1RW2A 3FUFA 3R9MA 1IXVA 2XS1A 2ETCA 3PZDA 3ESLA 3AJIA 4N3AA 2QYUA 3LEWA 3H0XA 3UM3A 1WM5A 4ANXA 4RLYA 2OVBA 1DKYA 4F00A 3PEUB 2PM6A 5HI7A 3U9WA 4HOQA 5BT1A 4RG9A 3FP3A 2I9CA 3FTUA 3DSSA 4GTRA 4LNBA 4OVUA 4F1PA 4WV5A 3DPDA 2PNNA 2XZDG 1NA0A 3S7JA 2ILRA 2X6HA 2XQ0A 3OXFA 1U00A 4J0UA 2IF4A 1JWGA 2J4BA 3S7DA 4EBAG 3ZHEB 4A1SA 5FQ4A 3HHMA 4KBQA 3PUKA 3ONLA 3C3RA 3E33A 2IJGX 5DIZA 4LERA 2JEKA 2Y4TA 2IEJA 1DKZA 3UPVA 4HOUA 5BPPA 2H6GA 2PM7A 2UY1A 1KT0A 4EZQA 4BETA 4BEPA 4L7TA 3JUIA 4HS2A 3JQ0A 3FUNA 2WXQA 5FIOA 2GROB 3UM0A 5E84A 3G2SA 3OAWA 3ABME 4YVQC 4CT4A 1JCRA 3ZYKA 3HXBA 2V5FA 4JHRA 4ZHBA 3MKQA 5CRVA 4KMOA 4DX1A 3E4BA 4C0MA 1BI8B 2IFUA 1H19A 2CG2A 3FH5A 4Y6CA 5FWQA 4J8SA 2KZTB 3Q4AB 2P9LG 2J49A 5JJTA 1HU3A 5D66A 3B95A 4N3BA 4DLQA 3CVVA 3L08A 3ULEG 2V4HC 1XNFA 1H2UA 3ZFWA 3U66A 1N52A 4EZXA 2WXRA 3CSFA 5EKQD 5D0OD 4YDOA 3BEEA 3ULQA 3B7SA 4WWPA 5AQ7A 4DI3A 3ASGA 2H6IA 3TXMA 4G25A 3PNLB 4HQDA 4BY6A 3MEKA 5D2MC 5JMND 2ZIRA 3NB2A 2ZGGA 2J08A 5EX3A 3FUKA 4P29A 5G04C 1Y6IA 1ZB1A 5ENTD 3QNJA 3Q75A 3NZSA 4EZSA 4PDXA 1MJ0A 1UOHA 3ZW3A 2XGSA 4GZ6A 2EQXA 4F01A 5LOZA 2WM9A 3QNKA 1EF1C 5FINA 2AXZA 3RO2A 4I6GA 1OCZE 1UN9A 4LEUA 2V4LA 4LSZE 2YNQA 3W9FA 3VTXA 3EDTB 3MV2B 4U0SA 4JB8P 1YUWA 1PAQA 1E8YA 4U63A 3TWQA 5T8IA 4XI9A 3R7QA 3U64A 4N2QA 2A4ZA 1UJJA 1SZAA 2CFZA 3FU5A 1S63A 3L54A 2UY1B 4BT9A 4UQZA 4R5GA 3ENEA 5EN5D 3GZSA 4LCTA 2LXLA 3D9HA 3PUJA 1N54A 4ILIA 5H7PA 1K1BA 5CBOA 3ASDA 5G05C 3CK9A 2WXGA 1K3ZD 4W9RA 1O1RA 2R5SA 4BWRA 3TL5A 2WXIA 3KEZA 5CECB 3Q15A 4JHJA 4EZYA 1K8KG 4EZUA 2IOSA 5J90A 5KCMA 4U0UA 1E8ZA 1K1AA 3ABLE 2FULA 3CK7A 4NQ0A 3AG3E 4GPKA 1YYHA 1BLXB 1B89A 1Z5SC 2WXKA 3I5PA 4CDRA 1QBQA 2Y1LE 5CCMA 3APCA 4J8EA 4WWNA 3APFA 2BUGA 4I2ZA 3B7BA 3QWPA 2FI7A 2KC7A 3FTZA 3DPPA 1MYOA 3BU8A 2VTBA 4ANWA 3FUMA 4JD2G 3DWLG 2LSUA 3D9KA 3TJPA 4FHJA 3BUAA 3SFYA 3RK6A 4CDMA 4AVXA 3G2VA 1DNPA 3OXGA 2PZIA 2V8SE 4HB5A 3SF4A 4HVBA 5EYLA 2JABA 3UM2A 2VSXE 4U07A 3AG2E 4OAVB 2XHEA 3QJZA 3P1UA 1MZCA 2FF4A 2NYJA 5EILA 4JN4A 3KAEA 4IYPA 2WXOA 2MHKA 1HG5A 3NOGD 4FHKA 3SBTB 1YCSB 3FDHA 4UI9K 2LO6A 2YQ8A 4UWLA 1JPLA 3DXMG 3TG4A 4B89A 4BX9A 3JQ1A 4LNGA 3RIBA 3T5VA 3DPQA 1MHQA 3AG4E 4MQDA 1KLXA 4RQIA 2WPVA 4GTMA 4GU5A 1N4PA 1VDYA 4U96D 4DX2A 4TV3A 4UI9J 3DEPA 3UINC 2WMOA 3AU4A 3S7BA 5B3SE 4KYOB 3RU0A 2VSNA 4UWFA 1DCEA 4U8VD 4XI0A 4EZZA 2X38A 1N0RA 4JNEA 2E2EA 4XKBA 1BI7B 1DVPA 2R02A 3CVWA 2XEVA 2BTDA 1E7VA 5AN8A 3DPYA 1OY3D 1Q5LA 5ENNA 4O1OA 3WG7E 3E37A 3QB2A 3TWXA 4CCAA 2BEDA 3HXDA 3ZKJA 4GCNA 3R9AB 4WNDA 1SA5A 3DRAA 2B0OE 3FY4A 5CBNA 2B6CA 5KBAA 2PQRA 1WDYA 4G11A
chains in the Genus database with same CATH topology
1U3DA 4WV7A 2J4BA 3S7DA 4EBAG 4JWIA 3ZHEB 4A1SA 3HDXA 5FQ4A 5AIJA 3HHMA 3LVRE 1BPOA 2FEZA 4KBQA 3C7NB 4I1MA 1DG4A 4I1AA 3PUKA 3ONLA 4L23A 2IJGX 4EZTA 5DIZA 4LERA 2JEKA 2Y4TA 5JJ7A 2J4DA 3L22A 2J09A 2MOWA 4AIFA 1DKZA 1UW4B 3UPVA 1L5JA 4HOUA 2L0TB 1E7UA 5CMYA 1SZ9A 5BPPA 4XX5A 1HH8A 3LYAA 2PM7A 3CVXA 2VTBB 3R7RA 2UY1A 4EZVA 1KT0A 4EZQA 2AVPA 1Z6TA 3SBSA 1MQSA 4L7TA 5D0QD 3JUIA 2PL2A 4HS2A 4I17A 3FFLA 3JQ0A 4JZYA 2WXPA 3S2AA 3ZYLA 5JHBA 3U3WA 3D9NA 3FUNA 2OP6A 1U3CA 2WXQA 5T4YA 4G24A 4FULA 3SI5A 3UT8A 5ARFA 4DJAA 1Z3XA 2VGXA 1X5BA 3JCKC 5E84A 2QY7A 4ANVA 4EZLA 3G2SA 3OAWA 3GZ2A 3PRZA 3CHQA 3LCAA 3CVYA 2P58C 4J6IA 4CEMA 4YVQC 1HFAA 2WXMA 2X6KA 2HR2A 3MJWA 3T5XA 4JWEA 4FLHA 3D9PA 4XKCA 4CT4A 2CHWA 2X6IA 3CVNA 2KM4A 3ZYKA 1NA3A 2V5FA 4JHRA 4FLBA 4KVOA 3MKQA 3FU0A 3PE3A 5A7DB 3MYVA 3SNXA 3QWVA 4HFGA 5FT9A 3RJVA 4KMOA 3FULA 4I6EA 4E81A 4U0ZA 4GA1A 3E4BA 4C0MA 2WVIA 1S0PA 1H19A 2IFUA 2CG2A 3FH5A 3I4RB 4BFRA 4R7LA 5FQ6A 5HQ8A 4Y6CA 2I1KA 3IV0A 3FTWA 5FWQA 2XRZA 2XCCA 3ML9A 4I9EA 4J8SA 4QFVA 2KZTB 3Q4AB 2LSVA 2BF0X 4PS7A 3APDA 3AS5A 4JWCA 4EPZA 2J49A 1OWPA 5JJTA 3HVEB 1HU3A 1HO8A 1E96B 3D9MA 4N3BA 3FH8A 3EHNA 3AU5A 3LS8A 4DLQA 3CVVA 3L08A 5C1DA 4GAAA 4ME2A 5G55A 1XNFA 3LPZA 4GA2A 2C2LA 4GMJA 4EZWA 1H2UA 1HS6A 3ZFWA 5ANLA 2C0LA 2FBNA 4JW1A 3U66A 4ILHB 4AOFA 1N52A 2FO7A 2IOLA 2DBAA 2WXRA 3CSFA 4EZXA 1CKRA 2YHCA 3I3NA 5EKQD 3BG1B 4GZ3A 3RRMB 4KXKB 2IONA 5D0OD 4HOTA 3FH7A 3BEEA 1EYHA 4O6FA 3SD5A 3ULQA 1FCHA 3B7SA 3CKBA 3D9OA 4HLEA 3QC1A 5FZQA 4WWPA 2NSZA 4FU3A 4WWOA 4DLOA 2QFCA 4DI3A 1KT1A 1OWLA 2VSOE 3ASGA 3FUHA 3CLJA 1HE8A 2V7YA 3TXMA 2NXPA 4M3OA 4CRWA 4G25A 3PNLB 4G26A 1EPUA 4K03A 4BY6A 3MEKA 4ACLA 4EZKA 4HY9A 3GZ1A 4B9QA 4WNFA 4IULA 4I9CA 1E8XA 1TJCA 3I4GA 3QOUA 3ZEFA 4LRZA 4L1BA 2J08A 3OXLA 1E90A 2PQNA 4JEUA 2RD0A 3FUKA 4P29A 3FUJA 5EX3A 5G04C 1Y6IA 4BSXA 3BG0B 4ILGA 4ACKA 2J07A 3IEGA 4OVVA 1WAO1 2A5UA 3ASFA 3LY7A 3SHFA 2XCBA 3UT7A 4N39A 3QNJA 2HM8A 7HSCA 5E75A 3NZSA 4DI4A 2L6JA 4DPRA 4EZOA 4F7AA 4EZSA 4PDXA 4XE0A 1W3BA 1SQMA 2XGOA 3FTSA 3ZW3A 2XGSA 3DPOA 3D9LA 4CGWA 4B0ZA 3ZXSA 2WXHA 4J8FA 1NP7A 3CR3A 2KCVA 4CGVA 4GZ6A 3N71A 4Q94A 2EQXA 3LY8A 3D2FA 3CIAA 4F01A 2VYIA 5LOZA 3RKVA 4KZ0A 4YNDA 1HG2A 5BW8C 2HO1A 2WM9A 3G2UA 1EF1C 3L6AA 3QNKA 4Q96A 3FEYA 2AXZA 5FQ8A 3N8EA 4N3CA 1GW6A 2VJ8A 3RO2A 3MCXA 2VSYA 4I6GA 3PREA 1UN9A 1UJKA 4CDNA 4FP7A 4G1TA 4AY5A 3KD7A 3IBEA 4LEUA 2V4LA 4MRUA 2YNQA 4JA7A 4AP2A 4XZ4A 4PH4B 3QK0A 3VTXA 4JXTA 3TG5A 4EECA 3EDTB 2HYZA 3ZYQA 2DIWA 4V3IA 3MV2B 4FADA 4U0SA 1YUWA 1PAQA 2CG3A 4JC8A 3FUEA 4N5CA 5LCWC 3DOBA 4EZNA 3FU3A 3TAXA 1E8YA 4U63A 4FL9A 3KS2A 2XGMA 1HX8A 3PH0C 5T8IA 4XI9A 3R7QA 1H2VC 3U64A 3UMVA 3CKCA 2XPIA 2A4ZA 1UJJA 2I1JA 3GYZA 4PUCA 5C2YA 4N2QA 4JNFA 1SZAA 3G2WA 4I2WA 4H7XA 4AY6A 4GYOA 3MA5A 1UG3A 4JVSA 3D9JA 1PC2A 2CFZA 3FU5A 4R5LA 3B7RL 4J8DA 5LFAA 4R5JA 2ZU6B 3L54A 3O4ZA 2UY1B 3T8MA 4YVOA 4BT9A 5G04J 3G2TA 4UQZA 3CGHA 5KJMA 3RRNB 4R5KA 4LUNU 3VLEA 4R5GA 3L13A 2DCPA 2V0PA 3ENEA 3GZSA 3LJ3A 4LCTA 5FTPA 4AV7A 4EBAA 2M63A 3CHSA 4GMLA 1QNFA 3HVEA 2IU1A 4BTBA 3PUJA 1N54A 3CEQA 2CHZA 3LKUA 4ILIA 4KVMA 5JHAA 2WQHA 2VGXB 5FZRA 3O48A 3ASDA 5ANRA 3CHOA 2JLBA 3CK9A 3EHMA 2WXGA 3MGBA 5G05C 5JJ6A 4BX8A 4W9RA 4G2VA 3LVQE 4MS6A 3TGOA 3P2BA 4XIFA 3FWVA 2GRLA 2Q7FA 2GGFA 3CQCB 3FUDA 2R5SA 2IQCA 3FU6A 3TL5A 4WAFA 2WXIA 4BWRA 3KEZA 4EZRA 4NRHB 3Q15A 4WNEA 5J08A 4JHJA 3NF1A 4EZYA 3PE4A 4EZPA 2VGYA 4RG6A 4EZUA 2IOSA 1XGWA 3B13A 4KZCA 5J90A 3IHVA 4JEHA 5KCMA 1INZA 4U0UA 5ARGA 3MKRA 4CT0A 2KCKA 4H7YA 1E8ZA 4MLPA 3GW4A 1WY6A 3UUXA 2VQ2A 3DQGA 5TKYA 4NACA 3ML8A 1FVHA 2FULA 3CK7A 2BPRA 1ZBPA 4GYWA 4UWGA 4JL0A 4NQ0A 5G2NA 5E76A 4R5IA 3URZA 3C98A 4E85A 4GPKA 3L17A 1PY1A 5LCWJ 3UT4A 3CHPA 3ZYMA 3B7UX 2NC9A 4AJWA 3ZVVA 2I6HA 5A23A 2X6JA 4ABNA 4JWDA 4A3VA 4E6HA 1B89A 1E8WA 2R17C 1IQUA 1OWOA 4PO2A 5KJKA 3VLDA 3VLFA 4HOSA 3FTVA 2WXKA 4EZJA 4RSYA 3ZIMA 3I5PA 4I1OB 4U04A 2YINA 4UWHA 1IQRA 4GZCA 4CDRA 4C9BB 5CCMA 5LP0A 3FTXA 4FA6A 3APCA 3Q49B 3SFZA 1HXIA 4GZDA 4J8EA 4TRQA 4WWNA 3APFA 2WB2A 2BUGA 5FJYA 4I2ZA 3ZHEA 3QWPA 2UWJG 4HXIA 2RG8A 2FI7A 3MV3B 3C7NA 2KC7A 3FTZA 4DK5A 4IN3B 2CHXA 3CSTA 4A55A 2Y3AA 3ZN3A 4B94A 3DPPA 2ONDA 2J9QA 5AYWD 4L2LA 3LY9A 3TXNA 4AM9A 5G05J 4GB9A 2XRYA 1IYGA 2L9BA 3SZ7A 4JHKA 5FZSA 3CHRA 3LDZA 3PVLA 3U4TA 2VTBA 3QKYA 3CVLA 4ANWA 3ESKA 3PNTB 3CVQA 1H0AA 1BPRA 1ZU2A 1DKXA 4A3TA 3CQGB 3FTYA 3ZPJA 4URKA 4ANUA 3FUMA 3JYSA 1LF8A 4D10C 5T3RA 5KJLA 2LSUA 3D9KA 3TJPA 1JUQA 2WMNA 4APFA 2XPZA 2X3MA 3Q47B 4FHJA 5CCLA 3OTNA 1OWMA 4BT8A 2WQ6A 4MKTA 4GA0A 4UWKA 4UI9C 4F1SA 4F53A 3ASHA 4ATGA 3RK6A 4RVBA 3UX4A 2R59A 3L16A 4AXHA 4CDMA 2AXUA 3G2VA 3QWWA 4AVXA 1DNPA 3OXGA 5BV1A 2GRMA 3SGHA 4K0RA 5EX0A 2PZIA 1NZNA 2LAHA 4GZ5A 2V8SE 1H2TC 3S7FA 3SF4A 4HVBA 2VSXE 1TJFA 4C0EA 1EDUA 3PS6A 3DBSA 4G23A 4U07A 3AS8A 3EIQC 3FEXA 2XPYA 3ZGQA 3FHEA 2XHEA 2AW6A 4A1GA 3QJZA 2WXLA 3P1UA 2FF4A 2KZTA 3PDNA 5AJDA 2KHOA 3D9IA 2Y4UA 4KT6B 3EIJA 1OUVA 2E0IA 4EQFA 3D2EA 4JN4A 4I43A 3KAEA 4IYPA 2WXOA 1FVFA 2MHKA 3CVPA 4Q69A 4FC8A 3QAQA 5AENA 3D3MA 5M72A 3VTYA 1HG5A 3IHYA 2MRIA 4HORA 2LNIA 1QZ2A 3K9IA 4FHKA 3UQ3A 4U8HA 2CFUA 3SBTB 1Z3YA 5BV0A 3CK8A 3FDHA 4J0UA 2QXLA 2GW1A 2KCLA 3MKQB 4WUYA 2L0IA 2LO6A 2C0MA 4UI9K 5FQ7A 2YQ8A 4JPSA 2WXNA 1P5QA 3HIZA 5BUZA 1HZ4A 1JPLA 4JA9A 4UWLA 1YA0A 2KATA 5AJLA 4BTAA 3MZLB 3TG4A 4B89A 4BX9A 3JQ1A 4Y6WA 3RIBA 5EDSA 3CVUA 4FJZA 1OWNA 3T5VA 3ONKA 2I2OA 3DPQA 1MHQA 4AEZC 4B8CB 4UQXA 2LAIA 4TUUA 4MQDA 3RO3A 1KLXA 3HYMB 2WPVA 5CHEE 3RRUA 4GU5A 5CMWA 4HYBA 1VDYA 2OV8A 3EJNA 4NURA 3LXUX 3NZUA 4UI9J 4TV3A 2WXFA 3CHMA 5KJNA 4IRUA 4UQYA 3AU4A 2WMOA 5DBKA 1A17A 3S7BA 2OOEA 4WNGA 4N2SA 2AXVA 3FUFA 4KYOB 1IHGA 3RU0A 2VSNA 4I6JA 1QQEA 4GYYA 4UWFA 3PZDA 3ESLA 3WXXA 4N3AA 3LEWA 4XI0A 3H0XA 1WM5A 4EZZA 4ANXA 2OVBA 1Y8MA 3FUIA 3ZRHA 1DKYA 4F00A 2X38A 4B8AA 4JNEA 1UN8A 4L2YA 2E2EA 3AS4A 4XKBA 1ELKA 2X6FA 2PM6A 1DVPA 3PEUB 5HI7A 4FJYA 4PS3A 5LX8A 3CVWA 3U9WA 1ELRA 2XEVA 2BTDA 1E7VA 3NQPA 4HOQA 4GCOA 5BT1A 5BNWA 4RG9A 4OYSA 1Q5LA 2WQ7A 3QARA 3FP3A 2I9CA 3FTUA 5ENNA 4F3VA 4APOA 3PEVB 2OVFA 3QB2A 4PS8A 4CCAA 2WXJA 3IKOB 4OVUA 4GCNA 3R9AB 4WNDA 2YHEA 4WV5A 1ELWA 3DPDA 3B7TA 3Q5MA 1NA0A 3S7JA 2ILRA 3FY4A 2X6HA 2XQ0A 2PQRA 1H6KA 3OXFA 1HF8A 3MX3A 4G11A 1JWFA 2AWIA 1TEZA 2IF4A 1U00A 5A6CA 3QDNA 3CV0A 1JWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZEF A;  4ILH B;  3SBS A;  4ILG A;  3SBT B;  4I43 A;  4ILI A; 
#chains in the Genus database with same CATH topology
 1DG4 A;  4L23 A;  4CYM D;  2J4D A;  1L5J A;  1E7U A;  1HH8 A;  3LYA A;  4HBD A;  2VTB B;  1Z6T A;  3TWV A;  5D0Q D;  3FFL A;  5T4Y A;  3ASN E;  3SI5 A;  3UT8 A;  1Z3X A;  2QY7 A;  2FO1 E;  3PRZ A;  3CHQ A;  2P58 C;  1HFA A;  2X6K A;  2HR2 A;  3CVN A;  2KM4 A;  1NA3 A;  3UM1 A;  3ZNG A;  1N9A A;  3MYV A;  3SNX A;  3QWV A;  4HFG A;  3RJV A;  3FUL A;  2WVI A;  3I4R B;  4DX5 D;  3AG1 E;  5FQ6 A;  1U2V G;  2I1K A;  3IV0 A;  2XRZ A;  2XCC A;  3AS5 A;  1OWP A;  1JCS A;  2MYO A;  3LS8 A;  4BES A;  2QYJ A;  4GAA A;  4ME2 A;  5G55 A;  1N95 A;  3LPZ A;  2C2L A;  4GMJ A;  2DBA A;  3I3N A;  1TN8 A;  4KXK B;  1EYH A;  4O6F A;  3EU9 A;  3JXI A;  3CKB A;  4HLE A;  5FZQ A;  4F6R D;  4DLO A;  4WWO A;  3C72 A;  4K5C A;  1KT1 A;  2VSO E;  3FUH A;  4M3O A;  4HY9 A;  1OT8 A;  4B9Q A;  4U95 D;  3QOU A;  2VGE A;  3C3O A;  2AJA A;  2XEH A;  3ULY A;  4JEU A;  1A5E A;  5EYP F;  2RD0 A;  3FUJ A;  3DSX A;  4BSX A;  3IEG A;  2A5U A;  3ASF A;  2XCB A;  1TR4 A;  2OEW A;  7HSC A;  3SY2 A;  2L6J A;  1JCQ A;  2XGO A;  3FTS A;  4CGW A;  4B0Z A;  3ZXS A;  2WXH A;  4J8F A;  2KCV A;  3N71 A;  3RKV A;  4APF A;  4KZ0 A;  4YND A;  2EIN E;  1HG2 A;  2HO1 A;  3G2U A;  5CED B;  3FEY A;  5FQ8 A;  1GW6 A;  2VJ8 A;  3MCX A;  2VSY A;  4GPM A;  3UKU G;  4G1T A;  4AY5 A;  3EHR A;  2BKK B;  3T9K A;  4AP2 A;  4JXT A;  2HYZ A;  3ZYQ A;  2V5Q C;  4JC8 A;  5LCW C;  3FU3 A;  3TAX A;  4FL9 A;  1HX8 A;  2GRN B;  3UMV A;  3HG0 D;  3T8K A;  2P9I G;  2I1J A;  4PUC A;  5C2Y A;  3G2W A;  1TNO A;  1PC2 A;  4R5L A;  4J8D A;  5LFA A;  5ENR D;  4YVO A;  1TN7 A;  5KJM A;  4R5K A;  2IO2 C;  3LJ3 A;  3Q7A A;  3CHS A;  4GML A;  1QNF A;  3HVE A;  2IU1 A;  1N94 A;  4BTB A;  1DC2 A;  3CEQ A;  4HRL A;  4HRM B;  3O48 A;  1D9S A;  5ANR A;  3CHO A;  2JLB A;  1BD8 A;  1O1S A;  3LVQ E;  3TGO A;  2GGF A;  2IQC A;  4WNE A;  2XZT G;  2VGY A;  1FT2 A;  5ARG A;  3GW4 A;  1WY6 A;  3UUX A;  5TKY A;  4NAC A;  2H6F A;  1N4Q A;  4R5I A;  1LD8 A;  3UT4 A;  2RFM A;  3ZYM A;  1FPP A;  4A3V A;  4E6H A;  1OWO A;  2IY0 C;  4PO2 A;  4QQI A;  3VLD A;  3X2Q E;  4HOS A;  5IY5 E;  2ZIS A;  3HXC A;  4U04 A;  4GZC A;  4LG6 A;  1HXI A;  1O5M A;  3PZ2 A;  2WB2 A;  4HXI A;  3C7N A;  4TXP A;  4GTV A;  4DK5 A;  2CHX A;  5BXU A;  4B94 A;  2OND A;  2J9Q A;  5AYW D;  3LY9 A;  3ESK A;  3CVQ A;  1H0A A;  1BPR A;  1DKX A;  4A3T A;  3CQG B;  4XEI G;  1LF8 A;  3UKR G;  3UIP C;  4UUC A;  3BQO A;  3Q47 B;  3OTN A;  4BT8 A;  2WQ6 A;  4F53 A;  3UXG A;  2R59 A;  3L16 A;  3QWW A;  1NL4 A;  3TWU A;  5BV1 A;  4K0R A;  3Q78 A;  1NZN A;  2LAH A;  1EDU A;  3FEX A;  2XPY A;  1TNZ A;  3FHE A;  4A1G A;  2WXL A;  3PDN A;  2Y4U A;  1OUV A;  1OXJ A;  3D2E A;  4I43 A;  3ZXP A;  2F8Y A;  3V2X A;  2EIL E;  3QAQ A;  3D3M A;  2LNI A;  5JA4 D;  2QXL A;  2GW1 A;  2KCL A;  3MKQ B;  2ZGD A;  2L0I A;  5FQ7 A;  2C0M A;  1MX6 A;  5KNG A;  3Q7F A;  1P5Q A;  3HIZ A;  4YDY A;  2KAT A;  3ZU7 B;  5EDS A;  4FJZ A;  2DVW A;  4GTP A;  4AEZ C;  4UQX A;  4TUU A;  5CHE E;  4HYB A;  1FT1 A;  2WXF A;  3CHM A;  5KJN A;  4UQY A;  3NBN B;  2OOE A;  4WNG A;  1LD7 A;  5ITZ F;  4I6J A;  1Y8M A;  3ZRH A;  3TWR A;  1ELK A;  2X6F A;  5KNH D;  4PS3 A;  4CZ2 D;  5LX8 A;  2WQ7 A;  3QAR A;  4YDE A;  4K5B A;  4F3V A;  2H6H A;  3LJN A;  2OVF A;  2WXJ A;  2LXM A;  1ELW A;  3E32 A;  3B7T A;  3Q5M A;  1H6K A;  2R03 A;  1TYQ G;  2AWI A;  5A6C A;  3CV0 A;  4WV7 A;  3HDX A;  3C7N B;  4EHM A;  4I1M A;  4I1A A;  5HRY A;  2J09 A;  4AIF A;  1UW4 B;  1LTX A;  5CMY A;  1SZ9 A;  3CVX A;  2KXP C;  3R7R A;  3AAA C;  4EZV A;  3SBS A;  1RZ4 A;  3S2A A;  3ZYL A;  2F0Y A;  3D9N A;  2OP6 A;  4DJA A;  3JCK C;  2EIJ E;  3E34 A;  4ANV A;  4EZL A;  3LCA A;  3CVY A;  4J6I A;  3MJW A;  3T5X A;  4JWE A;  4FLH A;  4XKC A;  4HNA D;  5BXO A;  4FLB A;  4M7C A;  3PE3 A;  4E81 A;  4I6E A;  4BER A;  4U0Z A;  5AQ9 A;  1S0P A;  4BFR A;  5HQ8 A;  3ML9 A;  4I9E A;  4QFV A;  2LSV A;  4JWC A;  1HO8 A;  4GTT A;  1E96 B;  3FH8 A;  3EHN A;  3AU5 A;  4EZW A;  5ANL A;  2FBN A;  4JW1 A;  4ILH B;  2FO7 A;  3DEO A;  4HI9 A;  2YHC A;  3BG1 B;  3RRM B;  1AWC B;  3FH7 A;  3SD5 A;  1D8E A;  2NSZ A;  4FU3 A;  2IO3 C;  1OWL A;  1HE8 A;  2NXP A;  4CRW A;  4G26 A;  1EPU A;  5B1A E;  2XEN A;  1Q2Z A;  4I9C A;  1E8X A;  3I4G A;  3ZEF A;  4LRZ A;  3OXL A;  4GMR A;  3BG0 B;  5KWD A;  4OVV A;  3LY7 A;  3SHF A;  3UT7 A;  2GRR B;  3EUV A;  4XE0 A;  1W3B A;  2BKG A;  3DPO A;  2A5E A;  5BW8 C;  4Q96 A;  1SW6 A;  2XS8 A;  3N8E A;  4N3C A;  3PRE A;  1UJK A;  4CDN A;  1H6O A;  3ZUV B;  4MBG A;  2DYR E;  3KD7 A;  3DST A;  2P9K G;  5HS0 A;  3QK0 A;  1NI1 A;  2DIW A;  4V3I A;  3DSW A;  3TWT A;  3DOB A;  4EZN A;  4N5C A;  1WG0 A;  1H2V C;  3CKC A;  2P2C P;  3GYZ A;  4JNF A;  4I2W A;  4AY6 A;  4GYO A;  4JVS A;  4R5J A;  3NAW A;  5AAO A;  2Y0B G;  3T8M A;  5G04 J;  3RRN B;  4LUN U;  3VLE A;  4U8Y D;  3PZ3 A;  4AV7 A;  4DUI A;  4EBA A;  2CHZ A;  5JHA A;  2WQH A;  5FZR A;  4C48 B;  3UQ3 A;  1TNB A;  4BX8 A;  4MS6 A;  4Z68 A;  3FWV A;  2GRL A;  2Q7F A;  3FUD A;  4EZR A;  4NRH B;  5J08 A;  3PE4 A;  4EZP A;  4ZFH A;  4RG6 A;  4KZC A;  3MKR A;  2KCK A;  4MLP A;  3ML8 A;  1FVH A;  3PZ4 A;  4JL0 A;  5G2N A;  1KZP A;  3C98 A;  3L17 A;  1PY1 A;  4OAU C;  4AJW A;  2I6H A;  2X6J A;  1E8W A;  3Q73 A;  2R17 C;  3FTV A;  3DSV A;  4EZJ A;  3V31 A;  4UWH A;  1IQR A;  4C9B B;  5LP0 A;  3FTX A;  3SFZ A;  4TRQ A;  4GTS A;  2UWJ G;  2RG8 A;  4TUM A;  4A55 A;  4L2L A;  4AM9 A;  4YDW A;  5G05 J;  2L9B A;  3LDZ A;  3U4T A;  3QKY A;  3CVL A;  3PNT B;  3ZPJ A;  5CEA A;  4URK A;  5EIB E;  4D10 C;  1IKN D;  2WMN A;  2X3M A;  4UWK A;  4F1S A;  4UI9 C;  3ASH A;  2GRP B;  2GRM A;  4DRX E;  5AAR A;  4LNU D;  5EX0 A;  4DX7 D;  4GZ5 A;  1H2T C;  4C0E A;  3PS6 A;  3AS8 A;  1IHB A;  3EIQ C;  2OEV A;  3ISM C;  4O60 A;  1V54 E;  5AJD A;  3D9I A;  4KT6 B;  3EIJ A;  3Q9U C;  3SQV A;  4Q69 A;  3VTY A;  4U8H A;  1Z3Y A;  2L6B A;  3KSQ A;  4HLL A;  4WUY A;  5BUZ A;  5CRU A;  1HZ4 A;  4BTA A;  1H6P A;  1O1T A;  4Y6W A;  4L9P A;  3CVU A;  1MX4 A;  3ONK A;  2I2O A;  4A63 B;  3V79 K;  4B8C B;  1KZO A;  2LAI A;  3ABK E;  3RO3 A;  3HYM B;  1TN6 A;  4O1P A;  5CMW A;  1N4S A;  3EJN A;  3LXU X;  1X81 A;  4X8Q A;  5EID A;  2R05 A;  5DBK A;  1A17 A;  2OCC E;  4N2S A;  2AXV A;  1IHG A;  3WXX A;  1QQE A;  4GTO A;  4GYY A;  3FUI A;  1OCO E;  3DSU A;  1G3N B;  4B8A A;  1UN8 A;  4L2Y A;  1SA4 A;  1NFI E;  3AS4 A;  3L82 A;  4FJY A;  1ELR A;  4B93 B;  3NQP A;  4GCO A;  5BNW A;  3EU5 A;  4OYS A;  4APO A;  3PEV B;  1TNU A;  4PS8 A;  4NIK A;  3IKO B;  1KPS B;  1S70 B;  3KSL A;  2YHE A;  1AP7 A;  1HF8 A;  3MX3 A;  1JWF A;  1TEZ A;  3QDN A;  1U3D A;  4JWI A;  5AIJ A;  3LVR E;  1BPO A;  2FEZ A;  4EZT A;  5ENQ D;  5JJ7 A;  3HXF A;  3L22 A;  2MOW A;  4G8K A;  2L0T B;  4XX5 A;  2AVP A;  3IXE A;  1MQS A;  1V55 E;  2PL2 A;  2F37 A;  4I17 A;  5JHB A;  4JZY A;  2WXP A;  3U3W A;  1U3C A;  4G24 A;  4FUL A;  5ARF A;  2VGX A;  1X5B A;  3GZ2 A;  3RSE G;  3C5R A;  4CEM A;  2WXM A;  3D9P A;  2CHW A;  2X6I A;  3ASO E;  3UIO C;  4KVO A;  3FU0 A;  1D8D A;  5A7D B;  5FT9 A;  4GA1 A;  4R7L A;  3JUE A;  3FTW A;  2BF0 X;  4PS7 A;  3APD A;  5AQA A;  5CER B;  4EPZ A;  3HVE B;  2P9P G;  3D9M A;  5ENS D;  5C1D A;  4GA2 A;  2QZA A;  1HS6 A;  2C0L A;  4AOF A;  2GRQ B;  2IOL A;  1QYM A;  2R2L A;  4BSZ B;  2ETB A;  2QC9 A;  4GZ3 A;  3JXJ A;  2ION A;  4HOT A;  1FCH A;  3D9O A;  3QC1 A;  2QFC A;  3CLJ A;  2V7Y A;  1OCC E;  4K03 A;  4ACL A;  4EZK A;  3GZ1 A;  4WNF A;  4IUL A;  1TJC A;  2EIM E;  4G8L A;  4L1B A;  2DYS E;  1E90 A;  2PQN A;  2P9S G;  4ILG A;  4ACK A;  2J07 A;  1WAO 1;  4N39 A;  2HM8 A;  5E75 A;  4GTQ A;  4DI4 A;  4DPR A;  4EZO A;  4F7A A;  3TWS A;  1SQM A;  3D9L A;  1NP7 A;  3CR3 A;  4CGV A;  4Q94 A;  3LY8 A;  3D2F A;  3CIA A;  2VYI A;  3Q79 A;  3L6A A;  4FP7 A;  3J5Q B;  5B1B E;  3IBE A;  4MRU A;  4JA7 A;  4XZ4 A;  1N4R A;  4PH4 B;  3TWW A;  3TG5 A;  2Y69 E;  4EEC A;  4FAD A;  2ZXW E;  2CG3 A;  3FUE A;  2HE0 A;  1TNY A;  2LUH A;  2XGM A;  3KS2 A;  3PH0 C;  2XPI A;  4H7X A;  3MA5 A;  1UG3 A;  3D9J A;  4J7W A;  3NOC D;  2RFA A;  3B7R L;  2ZU6 B;  3O4Z A;  5ENO D;  3G2T A;  3CGH A;  3RAU A;  3SO8 A;  3L13 A;  5ENP D;  2DCP A;  2V0P A;  5FTP A;  2M63 A;  4KVM A;  3LKU A;  2VGX B;  3EHM A;  5JJ6 A;  3MGB A;  4G2V A;  3P2B A;  5HKP A;  4XIF A;  4ATZ D;  3CQC B;  3FU6 A;  4WAF A;  1MX2 A;  1BU9 A;  3NF1 A;  1OCR E;  1XGW A;  3B13 A;  3IHV A;  4JEH A;  1INZ A;  4CT0 A;  4H7Y A;  2VQ2 A;  3DQG A;  2BPR A;  5AQB A;  1ZBP A;  4GYW A;  4UWG A;  3C3Q A;  5E76 A;  3URZ A;  3PZ1 A;  4E85 A;  5LCW J;  1S64 A;  3CHP A;  3B7U X;  2NC9 A;  3ZVV A;  5A23 A;  4JWD A;  4ABN A;  4U7E B;  1IQU A;  4N5Q A;  5KJK A;  3VLF A;  4RSY A;  3ZIM A;  4I1O B;  2YIN A;  3HRA A;  3V30 A;  4FA6 A;  3Q49 B;  4GZD A;  4J8Y A;  5FJY A;  3UTM A;  2DZN A;  3ZHE A;  3MV3 B;  4IN3 B;  3CST A;  2Y3A A;  3ZN3 A;  3KEA A;  3TXN A;  4GB9 A;  4HI8 A;  2XRY A;  3F6Q A;  1IYG A;  3SZ7 A;  4JHK A;  5FZS A;  3CHR A;  3PVL A;  2ETA A;  3HXE A;  1ZU2 A;  3FTY A;  4ANU A;  3V2O A;  3JYS A;  5KJL A;  5T3R A;  2P9U G;  2RKK A;  1JUQ A;  2XPZ A;  3J5P A;  5CCL A;  1OWM A;  3DXK G;  2KBX A;  4MKT A;  4GA0 A;  4ATG A;  4RVB A;  3UX4 A;  3SFX A;  4AXH A;  2AXU A;  1SVX A;  1N11 A;  3SGH A;  3S7F A;  1N0Q A;  1TJF A;  3Q9N C;  3DBS A;  4G23 A;  3ZGQ A;  4HRN A;  2AW6 A;  2KZT A;  2KHO A;  3L9T A;  1YMP A;  4EQF A;  2E0I A;  3W9G A;  1FVF A;  3CVP A;  3EHQ A;  4FC8 A;  4K5A B;  5AEN A;  5M72 A;  4DX6 D;  3IHY A;  2MRI A;  4HOR A;  2J8S D;  1QZ2 A;  3K9I A;  2CFU A;  2XEE A;  4TXR A;  3E30 A;  5BV0 A;  3CK8 A;  2DZO A;  1CKR A;  4JPS A;  2WXN A;  4JA9 A;  1DCQ A;  1YA0 A;  5AJL A;  3MZL B;  2EIK E;  3UI2 A;  1OWN A;  3RRU A;  2OV8 A;  2P9N G;  4NUR A;  3NZU A;  2F8X K;  4IRU A;  2DWZ A;  4TXQ A;  1RW2 A;  3FUF A;  3R9M A;  1IXV A;  2XS1 A;  2ETC A;  3PZD A;  3ESL A;  3AJI A;  4N3A A;  2QYU A;  3LEW A;  3H0X A;  3UM3 A;  1WM5 A;  4ANX A;  4RLY A;  2OVB A;  1DKY A;  4F00 A;  3PEU B;  2PM6 A;  5HI7 A;  3U9W A;  4HOQ A;  5BT1 A;  4RG9 A;  3FP3 A;  2I9C A;  3FTU A;  3DSS A;  4GTR A;  4LNB A;  4OVU A;  4F1P A;  4WV5 A;  3DPD A;  2PNN A;  2XZD G;  1NA0 A;  3S7J A;  2ILR A;  2X6H A;  2XQ0 A;  3OXF A;  1U00 A;  4J0U A;  2IF4 A;  1JWG A;  2J4B A;  3S7D A;  4EBA G;  3ZHE B;  4A1S A;  5FQ4 A;  3HHM A;  4KBQ A;  3PUK A;  3ONL A;  3C3R A;  3E33 A;  2IJG X;  5DIZ A;  4LER A;  2JEK A;  2Y4T A;  2IEJ A;  1DKZ A;  3UPV A;  4HOU A;  5BPP A;  2H6G A;  2PM7 A;  2UY1 A;  1KT0 A;  4EZQ A;  4BET A;  4BEP A;  4L7T A;  3JUI A;  4HS2 A;  3JQ0 A;  3FUN A;  2WXQ A;  5FIO A;  2GRO B;  3UM0 A;  5E84 A;  3G2S A;  3OAW A;  3ABM E;  4YVQ C;  4CT4 A;  1JCR A;  3ZYK A;  3HXB A;  2V5F A;  4JHR A;  4ZHB A;  3MKQ A;  5CRV A;  4KMO A;  4DX1 A;  3E4B A;  4C0M A;  1BI8 B;  2IFU A;  1H19 A;  2CG2 A;  3FH5 A;  4Y6C A;  5FWQ A;  4J8S A;  2KZT B;  3Q4A B;  2P9L G;  2J49 A;  5JJT A;  1HU3 A;  5D66 A;  3B95 A;  4N3B A;  4DLQ A;  3CVV A;  3L08 A;  3ULE G;  2V4H C;  1XNF A;  1H2U A;  3ZFW A;  3U66 A;  1N52 A;  4EZX A;  2WXR A;  3CSF A;  5EKQ D;  5D0O D;  4YDO A;  3BEE A;  3ULQ A;  3B7S A;  4WWP A;  5AQ7 A;  4DI3 A;  3ASG A;  2H6I A;  3TXM A;  4G25 A;  3PNL B;  4HQD A;  4BY6 A;  3MEK A;  5D2M C;  5JMN D;  2ZIR A;  3NB2 A;  2ZGG A;  2J08 A;  5EX3 A;  3FUK A;  4P29 A;  5G04 C;  1Y6I A;  1ZB1 A;  5ENT D;  3QNJ A;  3Q75 A;  3NZS A;  4EZS A;  4PDX A;  1MJ0 A;  1UOH A;  3ZW3 A;  2XGS A;  4GZ6 A;  2EQX A;  4F01 A;  5LOZ A;  2WM9 A;  3QNK A;  1EF1 C;  5FIN A;  2AXZ A;  3RO2 A;  4I6G A;  1OCZ E;  1UN9 A;  4LEU A;  2V4L A;  4LSZ E;  2YNQ A;  3W9F A;  3VTX A;  3EDT B;  3MV2 B;  4U0S A;  4JB8 P;  1YUW A;  1PAQ A;  1E8Y A;  4U63 A;  3TWQ A;  5T8I A;  4XI9 A;  3R7Q A;  3U64 A;  4N2Q A;  2A4Z A;  1UJJ A;  1SZA A;  2CFZ A;  3FU5 A;  1S63 A;  3L54 A;  2UY1 B;  4BT9 A;  4UQZ A;  4R5G A;  3ENE A;  5EN5 D;  3GZS A;  4LCT A;  2LXL A;  3D9H A;  3PUJ A;  1N54 A;  4ILI A;  5H7P A;  1K1B A;  5CBO A;  3ASD A;  5G05 C;  3CK9 A;  2WXG A;  1K3Z D;  4W9R A;  1O1R A;  2R5S A;  4BWR A;  3TL5 A;  2WXI A;  3KEZ A;  5CEC B;  3Q15 A;  4JHJ A;  4EZY A;  1K8K G;  4EZU A;  2IOS A;  5J90 A;  5KCM A;  4U0U A;  1E8Z A;  1K1A A;  3ABL E;  2FUL A;  3CK7 A;  4NQ0 A;  3AG3 E;  4GPK A;  1YYH A;  1BLX B;  1B89 A;  1Z5S C;  2WXK A;  3I5P A;  4CDR A;  1QBQ A;  2Y1L E;  5CCM A;  3APC A;  4J8E A;  4WWN A;  3APF A;  2BUG A;  4I2Z A;  3B7B A;  3QWP A;  2FI7 A;  2KC7 A;  3FTZ A;  3DPP A;  1MYO A;  3BU8 A;  2VTB A;  4ANW A;  3FUM A;  4JD2 G;  3DWL G;  2LSU A;  3D9K A;  3TJP A;  4FHJ A;  3BUA A;  3SFY A;  3RK6 A;  4CDM A;  4AVX A;  3G2V A;  1DNP A;  3OXG A;  2PZI A;  2V8S E;  4HB5 A;  3SF4 A;  4HVB A;  5EYL A;  2JAB A;  3UM2 A;  2VSX E;  4U07 A;  3AG2 E;  4OAV B;  2XHE A;  3QJZ A;  3P1U A;  1MZC A;  2FF4 A;  2NYJ A;  5EIL A;  4JN4 A;  3KAE A;  4IYP A;  2WXO A;  2MHK A;  1HG5 A;  3NOG D;  4FHK A;  3SBT B;  1YCS B;  3FDH A;  4UI9 K;  2LO6 A;  2YQ8 A;  4UWL A;  1JPL A;  3DXM G;  3TG4 A;  4B89 A;  4BX9 A;  3JQ1 A;  4LNG A;  3RIB A;  3T5V A;  3DPQ A;  1MHQ A;  3AG4 E;  4MQD A;  1KLX A;  4RQI A;  2WPV A;  4GTM A;  4GU5 A;  1N4P A;  1VDY A;  4U96 D;  4DX2 A;  4TV3 A;  4UI9 J;  3DEP A;  3UIN C;  2WMO A;  3AU4 A;  3S7B A;  5B3S E;  4KYO B;  3RU0 A;  2VSN A;  4UWF A;  1DCE A;  4U8V D;  4XI0 A;  4EZZ A;  2X38 A;  1N0R A;  4JNE A;  2E2E A;  4XKB A;  1BI7 B;  1DVP A;  2R02 A;  3CVW A;  2XEV A;  2BTD A;  1E7V A;  5AN8 A;  3DPY A;  1OY3 D;  1Q5L A;  5ENN A;  4O1O A;  3WG7 E;  3E37 A;  3QB2 A;  3TWX A;  4CCA A;  2BED A;  3HXD A;  3ZKJ A;  4GCN A;  3R9A B;  4WND A;  1SA5 A;  3DRA A;  2B0O E;  3FY4 A;  5CBN A;  2B6C A;  5KBA A;  2PQR A;  1WDY A;  4G11 A; 
#chains in the Genus database with same CATH homology
 1U3D A;  4WV7 A;  2J4B A;  3S7D A;  4EBA G;  4JWI A;  3ZHE B;  4A1S A;  3HDX A;  5FQ4 A;  5AIJ A;  3HHM A;  3LVR E;  1BPO A;  2FEZ A;  4KBQ A;  3C7N B;  4I1M A;  1DG4 A;  4I1A A;  3PUK A;  3ONL A;  4L23 A;  2IJG X;  4EZT A;  5DIZ A;  4LER A;  2JEK A;  2Y4T A;  5JJ7 A;  2J4D A;  3L22 A;  2J09 A;  2MOW A;  4AIF A;  1DKZ A;  1UW4 B;  3UPV A;  1L5J A;  4HOU A;  2L0T B;  1E7U A;  5CMY A;  1SZ9 A;  5BPP A;  4XX5 A;  1HH8 A;  3LYA A;  2PM7 A;  3CVX A;  2VTB B;  3R7R A;  2UY1 A;  4EZV A;  1KT0 A;  4EZQ A;  2AVP A;  1Z6T A;  3SBS A;  1MQS A;  4L7T A;  5D0Q D;  3JUI A;  2PL2 A;  4HS2 A;  4I17 A;  3FFL A;  3JQ0 A;  4JZY A;  2WXP A;  3S2A A;  3ZYL A;  5JHB A;  3U3W A;  3D9N A;  3FUN A;  2OP6 A;  1U3C A;  2WXQ A;  5T4Y A;  4G24 A;  4FUL A;  3SI5 A;  3UT8 A;  5ARF A;  4DJA A;  1Z3X A;  2VGX A;  1X5B A;  3JCK C;  5E84 A;  2QY7 A;  4ANV A;  4EZL A;  3G2S A;  3OAW A;  3GZ2 A;  3PRZ A;  3CHQ A;  3LCA A;  3CVY A;  2P58 C;  4J6I A;  4CEM A;  4YVQ C;  1HFA A;  2WXM A;  2X6K A;  2HR2 A;  3MJW A;  3T5X A;  4JWE A;  4FLH A;  3D9P A;  4XKC A;  4CT4 A;  2CHW A;  2X6I A;  3CVN A;  2KM4 A;  3ZYK A;  1NA3 A;  2V5F A;  4JHR A;  4FLB A;  4KVO A;  3MKQ A;  3FU0 A;  3PE3 A;  5A7D B;  3MYV A;  3SNX A;  3QWV A;  4HFG A;  5FT9 A;  3RJV A;  4KMO A;  3FUL A;  4I6E A;  4E81 A;  4U0Z A;  4GA1 A;  3E4B A;  4C0M A;  2WVI A;  1S0P A;  1H19 A;  2IFU A;  2CG2 A;  3FH5 A;  3I4R B;  4BFR A;  4R7L A;  5FQ6 A;  5HQ8 A;  4Y6C A;  2I1K A;  3IV0 A;  3FTW A;  5FWQ A;  2XRZ A;  2XCC A;  3ML9 A;  4I9E A;  4J8S A;  4QFV A;  2KZT B;  3Q4A B;  2LSV A;  2BF0 X;  4PS7 A;  3APD A;  3AS5 A;  4JWC A;  4EPZ A;  2J49 A;  1OWP A;  5JJT A;  3HVE B;  1HU3 A;  1HO8 A;  1E96 B;  3D9M A;  4N3B A;  3FH8 A;  3EHN A;  3AU5 A;  3LS8 A;  4DLQ A;  3CVV A;  3L08 A;  5C1D A;  4GAA A;  4ME2 A;  5G55 A;  1XNF A;  3LPZ A;  4GA2 A;  2C2L A;  4GMJ A;  4EZW A;  1H2U A;  1HS6 A;  3ZFW A;  5ANL A;  2C0L A;  2FBN A;  4JW1 A;  3U66 A;  4ILH B;  4AOF A;  1N52 A;  2FO7 A;  2IOL A;  2DBA A;  2WXR A;  3CSF A;  4EZX A;  1CKR A;  2YHC A;  3I3N A;  5EKQ D;  3BG1 B;  4GZ3 A;  3RRM B;  4KXK B;  2ION A;  5D0O D;  4HOT A;  3FH7 A;  3BEE A;  1EYH A;  4O6F A;  3SD5 A;  3ULQ A;  1FCH A;  3B7S A;  3CKB A;  3D9O A;  4HLE A;  3QC1 A;  5FZQ A;  4WWP A;  2NSZ A;  4FU3 A;  4WWO A;  4DLO A;  2QFC A;  4DI3 A;  1KT1 A;  1OWL A;  2VSO E;  3ASG A;  3FUH A;  3CLJ A;  1HE8 A;  2V7Y A;  3TXM A;  2NXP A;  4M3O A;  4CRW A;  4G25 A;  3PNL B;  4G26 A;  1EPU A;  4K03 A;  4BY6 A;  3MEK A;  4ACL A;  4EZK A;  4HY9 A;  3GZ1 A;  4B9Q A;  4WNF A;  4IUL A;  4I9C A;  1E8X A;  1TJC A;  3I4G A;  3QOU A;  3ZEF A;  4LRZ A;  4L1B A;  2J08 A;  3OXL A;  1E90 A;  2PQN A;  4JEU A;  2RD0 A;  3FUK A;  4P29 A;  3FUJ A;  5EX3 A;  5G04 C;  1Y6I A;  4BSX A;  3BG0 B;  4ILG A;  4ACK A;  2J07 A;  3IEG A;  4OVV A;  1WAO 1;  2A5U A;  3ASF A;  3LY7 A;  3SHF A;  2XCB A;  3UT7 A;  4N39 A;  3QNJ A;  2HM8 A;  7HSC A;  5E75 A;  3NZS A;  4DI4 A;  2L6J A;  4DPR A;  4EZO A;  4F7A A;  4EZS A;  4PDX A;  4XE0 A;  1W3B A;  1SQM A;  2XGO A;  3FTS A;  3ZW3 A;  2XGS A;  3DPO A;  3D9L A;  4CGW A;  4B0Z A;  3ZXS A;  2WXH A;  4J8F A;  1NP7 A;  3CR3 A;  2KCV A;  4CGV A;  4GZ6 A;  3N71 A;  4Q94 A;  2EQX A;  3LY8 A;  3D2F A;  3CIA A;  4F01 A;  2VYI A;  5LOZ A;  3RKV A;  4KZ0 A;  4YND A;  1HG2 A;  5BW8 C;  2HO1 A;  2WM9 A;  3G2U A;  1EF1 C;  3L6A A;  3QNK A;  4Q96 A;  3FEY A;  2AXZ A;  5FQ8 A;  3N8E A;  4N3C A;  1GW6 A;  2VJ8 A;  3RO2 A;  3MCX A;  2VSY A;  4I6G A;  3PRE A;  1UN9 A;  1UJK A;  4CDN A;  4FP7 A;  4G1T A;  4AY5 A;  3KD7 A;  3IBE A;  4LEU A;  2V4L A;  4MRU A;  2YNQ A;  4JA7 A;  4AP2 A;  4XZ4 A;  4PH4 B;  3QK0 A;  3VTX A;  4JXT A;  3TG5 A;  4EEC A;  3EDT B;  2HYZ A;  3ZYQ A;  2DIW A;  4V3I A;  3MV2 B;  4FAD A;  4U0S A;  1YUW A;  1PAQ A;  2CG3 A;  4JC8 A;  3FUE A;  4N5C A;  5LCW C;  3DOB A;  4EZN A;  3FU3 A;  3TAX A;  1E8Y A;  4U63 A;  4FL9 A;  3KS2 A;  2XGM A;  1HX8 A;  3PH0 C;  5T8I A;  4XI9 A;  3R7Q A;  1H2V C;  3U64 A;  3UMV A;  3CKC A;  2XPI A;  2A4Z A;  1UJJ A;  2I1J A;  3GYZ A;  4PUC A;  5C2Y A;  4N2Q A;  4JNF A;  1SZA A;  3G2W A;  4I2W A;  4H7X A;  4AY6 A;  4GYO A;  3MA5 A;  1UG3 A;  4JVS A;  3D9J A;  1PC2 A;  2CFZ A;  3FU5 A;  4R5L A;  3B7R L;  4J8D A;  5LFA A;  4R5J A;  2ZU6 B;  3L54 A;  3O4Z A;  2UY1 B;  3T8M A;  4YVO A;  4BT9 A;  5G04 J;  3G2T A;  4UQZ A;  3CGH A;  5KJM A;  3RRN B;  4R5K A;  4LUN U;  3VLE A;  4R5G A;  3L13 A;  2DCP A;  2V0P A;  3ENE A;  3GZS A;  3LJ3 A;  4LCT A;  5FTP A;  4AV7 A;  4EBA A;  2M63 A;  3CHS A;  4GML A;  1QNF A;  3HVE A;  2IU1 A;  4BTB A;  3PUJ A;  1N54 A;  3CEQ A;  2CHZ A;  3LKU A;  4ILI A;  4KVM A;  5JHA A;  2WQH A;  2VGX B;  5FZR A;  3O48 A;  3ASD A;  5ANR A;  3CHO A;  2JLB A;  3CK9 A;  3EHM A;  2WXG A;  3MGB A;  5G05 C;  5JJ6 A;  4BX8 A;  4W9R A;  4G2V A;  3LVQ E;  4MS6 A;  3TGO A;  3P2B A;  4XIF A;  3FWV A;  2GRL A;  2Q7F A;  2GGF A;  3CQC B;  3FUD A;  2R5S A;  2IQC A;  3FU6 A;  3TL5 A;  4WAF A;  2WXI A;  4BWR A;  3KEZ A;  4EZR A;  4NRH B;  3Q15 A;  4WNE A;  5J08 A;  4JHJ A;  3NF1 A;  4EZY A;  3PE4 A;  4EZP A;  2VGY A;  4RG6 A;  4EZU A;  2IOS A;  1XGW A;  3B13 A;  4KZC A;  5J90 A;  3IHV A;  4JEH A;  5KCM A;  1INZ A;  4U0U A;  5ARG A;  3MKR A;  4CT0 A;  2KCK A;  4H7Y A;  1E8Z A;  4MLP A;  3GW4 A;  1WY6 A;  3UUX A;  2VQ2 A;  3DQG A;  5TKY A;  4NAC A;  3ML8 A;  1FVH A;  2FUL A;  3CK7 A;  2BPR A;  1ZBP A;  4GYW A;  4UWG A;  4JL0 A;  4NQ0 A;  5G2N A;  5E76 A;  4R5I A;  3URZ A;  3C98 A;  4E85 A;  4GPK A;  3L17 A;  1PY1 A;  5LCW J;  3UT4 A;  3CHP A;  3ZYM A;  3B7U X;  2NC9 A;  4AJW A;  3ZVV A;  2I6H A;  5A23 A;  2X6J A;  4ABN A;  4JWD A;  4A3V A;  4E6H A;  1B89 A;  1E8W A;  2R17 C;  1IQU A;  1OWO A;  4PO2 A;  5KJK A;  3VLD A;  3VLF A;  4HOS A;  3FTV A;  2WXK A;  4EZJ A;  4RSY A;  3ZIM A;  3I5P A;  4I1O B;  4U04 A;  2YIN A;  4UWH A;  1IQR A;  4GZC A;  4CDR A;  4C9B B;  5CCM A;  5LP0 A;  3FTX A;  4FA6 A;  3APC A;  3Q49 B;  3SFZ A;  1HXI A;  4GZD A;  4J8E A;  4TRQ A;  4WWN A;  3APF A;  2WB2 A;  2BUG A;  5FJY A;  4I2Z A;  3ZHE A;  3QWP A;  2UWJ G;  4HXI A;  2RG8 A;  2FI7 A;  3MV3 B;  3C7N A;  2KC7 A;  3FTZ A;  4DK5 A;  4IN3 B;  2CHX A;  3CST A;  4A55 A;  2Y3A A;  3ZN3 A;  4B94 A;  3DPP A;  2OND A;  2J9Q A;  5AYW D;  4L2L A;  3LY9 A;  3TXN A;  4AM9 A;  5G05 J;  4GB9 A;  2XRY A;  1IYG A;  2L9B A;  3SZ7 A;  4JHK A;  5FZS A;  3CHR A;  3LDZ A;  3PVL A;  3U4T A;  2VTB A;  3QKY A;  3CVL A;  4ANW A;  3ESK A;  3PNT B;  3CVQ A;  1H0A A;  1BPR A;  1ZU2 A;  1DKX A;  4A3T A;  3CQG B;  3FTY A;  3ZPJ A;  4URK A;  4ANU A;  3FUM A;  3JYS A;  1LF8 A;  4D10 C;  5T3R A;  5KJL A;  2LSU A;  3D9K A;  3TJP A;  1JUQ A;  2WMN A;  4APF A;  2XPZ A;  2X3M A;  3Q47 B;  4FHJ A;  5CCL A;  3OTN A;  1OWM A;  4BT8 A;  2WQ6 A;  4MKT A;  4GA0 A;  4UWK A;  4UI9 C;  4F1S A;  4F53 A;  3ASH A;  4ATG A;  3RK6 A;  4RVB A;  3UX4 A;  2R59 A;  3L16 A;  4AXH A;  4CDM A;  2AXU A;  3G2V A;  3QWW A;  4AVX A;  1DNP A;  3OXG A;  5BV1 A;  2GRM A;  3SGH A;  4K0R A;  5EX0 A;  2PZI A;  1NZN A;  2LAH A;  4GZ5 A;  2V8S E;  1H2T C;  3S7F A;  3SF4 A;  4HVB A;  2VSX E;  1TJF A;  4C0E A;  1EDU A;  3PS6 A;  3DBS A;  4G23 A;  4U07 A;  3AS8 A;  3EIQ C;  3FEX A;  2XPY A;  3ZGQ A;  3FHE A;  2XHE A;  2AW6 A;  4A1G A;  3QJZ A;  2WXL A;  3P1U A;  2FF4 A;  2KZT A;  3PDN A;  5AJD A;  2KHO A;  3D9I A;  2Y4U A;  4KT6 B;  3EIJ A;  1OUV A;  2E0I A;  4EQF A;  3D2E A;  4JN4 A;  4I43 A;  3KAE A;  4IYP A;  2WXO A;  1FVF A;  2MHK A;  3CVP A;  4Q69 A;  4FC8 A;  3QAQ A;  5AEN A;  3D3M A;  5M72 A;  3VTY A;  1HG5 A;  3IHY A;  2MRI A;  4HOR A;  2LNI A;  1QZ2 A;  3K9I A;  4FHK A;  3UQ3 A;  4U8H A;  2CFU A;  3SBT B;  1Z3Y A;  5BV0 A;  3CK8 A;  3FDH A;  4J0U A;  2QXL A;  2GW1 A;  2KCL A;  3MKQ B;  4WUY A;  2L0I A;  2LO6 A;  2C0M A;  4UI9 K;  5FQ7 A;  2YQ8 A;  4JPS A;  2WXN A;  1P5Q A;  3HIZ A;  5BUZ A;  1HZ4 A;  1JPL A;  4JA9 A;  4UWL A;  1YA0 A;  2KAT A;  5AJL A;  4BTA A;  3MZL B;  3TG4 A;  4B89 A;  4BX9 A;  3JQ1 A;  4Y6W A;  3RIB A;  5EDS A;  3CVU A;  4FJZ A;  1OWN A;  3T5V A;  3ONK A;  2I2O A;  3DPQ A;  1MHQ A;  4AEZ C;  4B8C B;  4UQX A;  2LAI A;  4TUU A;  4MQD A;  3RO3 A;  1KLX A;  3HYM B;  2WPV A;  5CHE E;  3RRU A;  4GU5 A;  5CMW A;  4HYB A;  1VDY A;  2OV8 A;  3EJN A;  4NUR A;  3LXU X;  3NZU A;  4UI9 J;  4TV3 A;  2WXF A;  3CHM A;  5KJN A;  4IRU A;  4UQY A;  3AU4 A;  2WMO A;  5DBK A;  1A17 A;  3S7B A;  2OOE A;  4WNG A;  4N2S A;  2AXV A;  3FUF A;  4KYO B;  1IHG A;  3RU0 A;  2VSN A;  4I6J A;  1QQE A;  4GYY A;  4UWF A;  3PZD A;  3ESL A;  3WXX A;  4N3A A;  3LEW A;  4XI0 A;  3H0X A;  1WM5 A;  4EZZ A;  4ANX A;  2OVB A;  1Y8M A;  3FUI A;  3ZRH A;  1DKY A;  4F00 A;  2X38 A;  4B8A A;  4JNE A;  1UN8 A;  4L2Y A;  2E2E A;  3AS4 A;  4XKB A;  1ELK A;  2X6F A;  2PM6 A;  1DVP A;  3PEU B;  5HI7 A;  4FJY A;  4PS3 A;  5LX8 A;  3CVW A;  3U9W A;  1ELR A;  2XEV A;  2BTD A;  1E7V A;  3NQP A;  4HOQ A;  4GCO A;  5BT1 A;  5BNW A;  4RG9 A;  4OYS A;  1Q5L A;  2WQ7 A;  3QAR A;  3FP3 A;  2I9C A;  3FTU A;  5ENN A;  4F3V A;  4APO A;  3PEV B;  2OVF A;  3QB2 A;  4PS8 A;  4CCA A;  2WXJ A;  3IKO B;  4OVU A;  4GCN A;  3R9A B;  4WND A;  2YHE A;  4WV5 A;  1ELW A;  3DPD A;  3B7T A;  3Q5M A;  1NA0 A;  3S7J A;  2ILR A;  3FY4 A;  2X6H A;  2XQ0 A;  2PQR A;  1H6K A;  3OXF A;  1HF8 A;  3MX3 A;  4G11 A;  1JWF A;  2AWI A;  1TEZ A;  2IF4 A;  1U00 A;  5A6C A;  3QDN A;  3CV0 A;  1JWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...