4ILIA

Crystal structure of an aar2p s253e phosphomimetic mutant protein
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
304
structure length
290
Chain Sequence
NTVPFTSAPIEVTIGIDQYSFNVKENQPFHGIKDIPIGHVHVIHFQHADNSSMRYGYWFDCRMGNFYIQYDPKDGLYKMMEERDGAKFENIVHNFKERQMMVSYPKIDEDDTWYNLTEFVQMDKIRKIVRKDENQFSYVDSSMTTVQENELSSSSSDPAHSLNYTVINFKSDKSYYLNTVMLQGIFKNSSNYFGELQFAFLNAMFFGNYGSSLQWHAMIELICSEATVPKHMLDKLDEILYYQIKTLPEQYSDILLNERVWNICLYSSFQKNSLHNTEKIMENKYPELLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for dual roles of Aar2p in U5 snRNP assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Splicing
molecule keywords A1 cistron-splicing factor AAR2
total genus 75
structure length 290
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.550 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4iliA02
2.60.34.20 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4iliA01
4I43A 4ILGA 3SBTB 3SBSA 4ILHB 3ZEFA 4ILIA
chains in the Genus database with same CATH superfamily
3VTYA 5EKQD 4LNGA 4I1MA 3EHNA 3TWWA 3VTXA 3JXJA 4DJAA 4GZ6A 1N11A 4Q69A 5KJKA 1BD8A 2L9BA 1O1SA 3SFXA 3RU0A 3LKUA 4BT9A 3PREA 1V55E 5CEDB 5JMND 4OVVA 3AJIA 4BTAA 2HYZA 2DZNA 3SO8A 3ASNE 3DRAA 4BEPA 1TEZA 4CZ2D 4CGWA 2A4ZA 4KVOA 3TJPA 2CG2A 1HU3A 4APFA 3B7RL 1IHBA 4DX1A 2Y1LE 3FTUA 5CERB 5JJ7A 5FJYA 3FUDA 2BF0X 3V79K 2WM9A 3PH0C 1SA5A 4WNGA 2R03A 4XIFA 3ASHA 3D9PA 3R7QA 3L22A 4RSYA 3HXFA 3WG7E 1ELKA 1INZA 4EZWA 2PM6A 1MJ0A 3PNLB 5ITZF 1UOHA 4C48B 4HVBA 3Q4AB 3AG1E 4DUIA 4WWNA 5LOZA 3CK7A 3BU8A 3L17A 3QWVA 4EPZA 4Z68A 4I9EA 2GRRB 3UXGA 3UIOC 1IQUA 3GZSA 4J8EA 2ZGDA 3PRZA 4KZCA 4V3IA 2F8YA 1NFIE 3UINC 4J6IA 1OCRE 2P2CP 5D2MC 3TG5A 4AP2A 3FTYA 3ZNGA 3OTNA 4CT0A 4G26A 3NOGD 2DVWA 2RKKA 2XRYA 4FLHA 4GTQA 1LF8A 4J8YA 5IY5E 4L2YA 3ABKE 3SD5A 4A63B 1UJKA 4AY6A 4ANVA 2M63A 4R5JA 2H6IA 3QC1A 2VGXA 3OXGA 2CHZA 2F0YA 1ZU2A 5G05J 4ANWA 3EDTB 5KNGA 4I43A 1TNYA 3QWWA 3IXEA 1SQMA 3ZXSA 4GTMA 3SFZA 3JYSA 2IF4A 3MA5A 4BESA 4O1OA 4LCTA 1KZPA 2DZOA 3ZYQA 4YDWA 4ATZD 3G2VA 2VGXB 5D66A 5CRUA 4J7WA 4CDRA 1H19A 2LNIA 4HOSA 1HE8A 4GYYA 2XRZA 2R02A 3MYVA 3FY4A 4B8AA 4A1SA 1IQRA 3IV0A 5HKPA 2QXLA 2V8SE 4O6FA 5D0OD 5FWQA 4FC8A 3LDZA 3L13A 3HRAA 4ACLA 3C3QA 5JHBA 4EBAG 4NIKA 2VTBA 3V30A 3FTWA 2VSNA 4IN3B 1Y6IA 3ZVVA 4DK5A 2GW1A 4TUUA 4EZRA 3JUIA 4D10C 1NZNA 3TWTA 5HQ8A 3PZ4A 5EDSA 4WUYA 1TN8A 4U95D 4DX7D 3AS5A 3CGHA 4OVUA 2R17C 4UWKA 5AIJA 1V54E 2IY0C 3IBEA 4PS8A 3C3OA 3V31A 3NZUA 4JVSA 2KBXA 4FULA 3CLJA 4NURA 3E4BA 3NBNB 1X5BA 3U3WA 2PQRA 2YINA 2I1KA 4JEHA 1QNFA 1QZ2A 4GPKA 4JHKA 2DYSE 1ZB1A 2OV8A 3OAWA 4B89A 3Q47B 3MKQA 1JUQA 1EPUA 4XKBA 1XNFA 1FCHA 3U64A 4M3OA 4CDNA 1DNPA 3TWSA 1N0RA 4LEUA 2NSZA 2OOEA 3J5PA 1FVHA 2AW6A 4GZCA 4A55A 3VLFA 3TWUA 5LFAA 2JABA 4GYWA 4JWDA 4FADA 2WB2A 3E37A 1HG2A 2WXJA 3ULEG 4LNUD 5AENA 3Q7FA 3ZKJA 3PZ2A 4R5LA 3OXFA 1JCQA 4FHJA 4F7AA 4RLYA 2R5SA 2R2LA 4EZOA 1D9SA 2WXLA 4TUMA 4GTOA 4HS2A 2BUGA 4WWPA 3ZXPA 2MOWA 3S7BA 5J08A 5EIBE 4U8VD 5AYWD 2PZIA 1HFAA 4TRQA 2R05A 3DQGA 1K3ZD 3FTZA 3JQ0A 3RO2A 3PVLA 4OYSA 3TG4A 1RW2A 1N95A 5FQ8A 2WXPA 3ZHEA 3S7JA 3BG1B 3S7DA 2XPIA 4YDYA 4UI9J 1U3DA 3ESKA 5AQAA 5FZRA 3HIZA 3Q9NC 2C2LA 2V5FA 1HX8A 2PNNA 2XCCA 3UPVA 3CK8A 1DG4A 3UT4A 1TNBA 3DWLG 5FZQA 1BPOA 4NRHB 2ILRA 3LEWA 4LNBA 1MHQA 3BEEA 2PL2A 3HYMB 4X8QA 5FINA 4N39A 3AS8A 3UKRG 1FVFA 2E0IA 4GZDA 2QY7A 3PE3A 3DSVA 4J0UA 3CQCB 3C7NB 3S2AA 3I4RB 2PQNA 4K5BA 4EBAA 2P9PG 1WG0A 4GYOA 4K03A 3L9TA 1EDUA 2GRPB 5CCLA 3UM1A 1TYQG 4HOQA 4UI9C 1KZOA 5AAOA 2A5UA 4KMOA 3HG0D 4HORA 3R9MA 5CBOA 1N4SA 3C5RA 2B6CA 3CVNA 3LVRE 4Y6CA 1YMPA 2XENA 3T9KA 4YDOA 4J8SA 1OCCE 5BV0A 3Q49B 1HS6A 3LCAA 2WQ6A 4HOTA 2HO1A 4EZUA 2WXIA 4A3VA 4DI3A 3UQ3A 3DEPA 3AG4E 4C0MA 5FT9A 2VTBB 3LS8A 3C3RA 3L82A 4K5CA 3D9JA 1H6OA 1D8EA 3ZFWA 2DCPA 3D9OA 5JJTA 1DKXA 4DX2A 4GMJA 5ENTD 4EZXA 5BNWA 4PH4B 1Z5SC 3R9AB 2P9UG 2BTDA 3GZ1A 5EYPF 2J07A 2AXVA 3JUEA 3Q75A 3URZA 5FQ7A 1NA3A 4URKA 4N5QA 1AWCB 3T5XA 3AG2E 3DXMG 1U00A 3NAWA 1N4RA 1JCSA 4C0EA 3L08A 1PAQA 4FU3A 4ZFHA 1Q5LA 3SQVA 3PEUB 4YDEA 2J4BA 4AJWA 1JWFA 5KJNA 4GCOA 3SFYA 4BETA 4UWLA 4UWHA 4BT8A 3TWRA 4N5CA 5BV1A 5ANRA 3FEXA 3B13A 1VDYA 2ZGGA 5CRVA 1DC2A 3L54A 1OWLA 3NZSA 4W9RA 1NL4A 1LD7A 2HR2A 4AEZC 5J90A 3UM2A 4CEMA 4P29A 5ENQD 1W3BA 3APDA 4GZ5A 3ESLA 3TAXA 3PZ1A 2V5QC 3LVQE 4L9PA 4TV3A 2XEVA 4KXKB 3G2TA 3LYAA 3QJZA 2QYJA 4XKCA 4AM9A 4G8KA 2WQ7A 2OVFA 1IKND 4U0SA 3E34A 4HNAD 3UM0A 3FU6A 4R7LA 2HM8A 2IOSA 4GTRA 1S64A 4TXQA 3OXLA 2CG3A 1TN6A 1CKRA 1BLXB 4DLQA 2ETAA 4EZSA 2CHXA 4EZZA 4UQYA 3FWVA 5H7PA 4EZPA 4UUCA 3T5VA 2FEZA 3ZYLA 4GMRA 2CFZA 4BX9A 1FT2A 2KZTB 4JNEA 3ASFA 1MX6A 4TXRA 4G2VA 3SF4A 4J8DA 4JN4A 2Y0BG 5EIDA 2KCLA 3ULYA 4FHKA 2BEDA 2LXLA 3BUAA 3HDXA 4AOFA 3TL5A 3MGBA 5CCMA 4LRZA 3CK9A 5CEAA 2VSXE 3B7UX 3CVYA 3T8MA 5AJDA 3SHFA 3TXMA 4JWCA 3FP3A 1XGWA 3ULQA 3D9HA 2X6HA 1N94A 2L6JA 3F6QA 4GTPA 1IXVA 3IHVA 3PUJA 4OAUC 3B7TA 4BY6A 1H2TC 2IO2C 3CSTA 4K5AB 3SZ7A 3HXDA 2X38A 4E85A 2YQ8A 3UKUG 4JXTA 2XPYA 2J08A 3LXUX 2WXGA 2I2OA 2VJ8A 3GYZA 2LO6A 2FO1E 1K1BA 3HXBA 5T4YA 4KT6B 3ZEFA 4E6HA 2B0OE 4GAAA 3NQPA 4GTTA 3RSEG 3VLDA 3O48A 4GB9A 5FIOA 4MLPA 2YHEA 3DSWA 4FJZA 4EZTA 5DIZA 1OWNA 3L16A 3EU9A 2HE0A 1N54A 3AG3E 4F1PA 1SA4A 2AJAA 4B9QA 2WXMA 4Q94A 3LY8A 2J9QA 3MX3A 1TN7A 1UG3A 4WNEA 3CHQA 2XPZA 1UN8A 5DBKA 1TR4A 1WDYA 4E81A 3GZ2A 3ENEA 2IO3C 1TNZA 3W9FA 4NACA 4B94A 5ENOD 4O60A 3FUKA 2DIWA 4HI9A 3MZLB 3E33A 5LCWC 5LCWJ 1OWPA 3JQ1A 3HVEA 3ABME 2ZIRA 4U0ZA 4I6GA 3ZIMA 2C0MA 1ELRA 2I6HA 3ONKA 1JCRA 3SBSA 1L5JA 3ZRHA 2PM7A 4I9CA 1NI1A 4FJYA 3SBTB 2ETBA 2XGMA 5ENSD 4EZYA 1QBQA 5JHAA 3LY9A 4KZ0A 2V4HC 4N2SA 3ISMC 4EZQA 4KBQA 3D9NA 5EN5D 3KSQA 4F6RD 4FA6A 1KT0A 4JNFA 1E90A 5CHEE 2J8SD 2V0PA 1WY6A 4KYOB 1DVPA 3ZYMA 2NYJA 4GTSA 3DSUA 5EX0A 3ZN3A 3DPYA 2XEEA 3PS6A 5AQBA 3E32A 2ZISA 2P58C 1BI8B 5LP0A 2WXHA 3MCXA 3Q9UC 2EIKE 1PC2A 1HF8A 4RG6A 5G04C 3FUNA 2WMOA 3IHYA 3UMVA 5A23A 1N4QA 2QFCA 4H7XA 3FUHA 2L0IA 2OEWA 1E7VA 3HXEA 2EIME 5M72A 4ANUA 1E96B 2H6HA 3DSSA 3ASDA 2UWJG 4ME2A 5JJ6A 2J4DA 3SY2A 4A1GA 1B89A 1TNUA 4JZYA 3T8KA 1H6KA 3O4ZA 4Y6WA 2KHOA 3DPOA 4CDMA 4I1AA 2XGSA 4I6EA 3JCKC 3QWPA 1E7UA 4HRLA 3PZ3A 4MKTA 5ANLA 5A6CA 1NP7A 3Q78A 3AAAC 4U63A 5C2YA 1UJJA 3TXNA 5AN8A 1JPLA 2V7YA 2XZTG 3D2FA 3HXCA 4IYPA 4HYBA 4GA1A 4EZJA 2FBNA 3PEVB 2Y3AA 3TWQA 2YNQA 1HO8A 3NB2A 3D9LA 1HZ4A 3N8EA 5E84A 1MX2A 5FTPA 4Q96A 3FTSA 3GW4A 3EJNA 4CRWA 2LSUA 3APFA 1MX4A 3PNTB 4U8YD 2JEKA 3FUJA 2I9CA 4F53A 4CGVA 3CHRA 4LSZE 5AARA 1O1RA 3SGHA 5E76A 2C0LA 2LAIA 3ML9A 3I4GA 3CQGB 2IOLA 1HH8A 2X3MA 3L6AA 4F1SA 4U8HA 4MQDA 2DWZA 2BPRA 2OVBA 2MHKA 4JB8P 4G1TA 3ZPJA 3TWVA 1Q2ZA 5EILA 4IULA 4GMLA 2QYUA 5KNHD 5ARFA 3WXXA 3CVLA 3FTVA 3ZUVB 4XI0A 4ILHB 3RAUA 3SI5A 4ACKA 3AS4A 5G05C 5B1BE 4GZ3A 5AQ7A 2P9KG 2E2EA 4L2LA 4ILGA 3UX4A 4G8LA 4AVXA 1LD8A 4NQ0A 4AIFA 5CECB 4HXIA 1Y8MA 4YNDA 1G3NB 3C7NA 3FH5A 3CVUA 4GPMA 2Y4UA 3C98A 5ENNA 4XZ4A 2YHCA 4EHMA 4B8CB 1H2UA 4GU5A 3EU5A 3P1UA 1YUWA 2ZXWE 3B7BA 2EILE 3Q73A 4L1BA 3UI2A 3IKOB 1HXIA 3FEYA 2L0TB 5A7DB 2BKGA 1O1TA 4BSZB 5B1AE 3D2EA 1A17A 1D8DA 3MV2B 4R5IA 5BXUA 3CVPA 2IU1A 3RKVA 3FUMA 3CVWA 4BWRA 1WAO1 3QK0A 2Y4TA 3ZHEB 3U66A 3KAEA 5B3SE 4C9BB 3G2UA 1IYGA 4WWOA 3X2QE 3HHMA 3DEOA 5KBAA 5HI7A 4CT4A 3DSXA 3QKYA 4JW1A 1N4PA 4HQDA 1DKYA 1QYMA 2LUHA 4LERA 4LUNU 3DPPA 4G23A 4ILIA 5HS0A 5G2NA 5E75A 4I2ZA 5KJMA 4JL0A 5KCMA 1RZ4A 3UT8A 3FU5A 1S0PA 2LSVA 4PDXA 5AQ9A 4F00A 3LY7A 3N71A 3CHOA 5ENPD 2DYRE 3U4TA 1EF1C 4B0ZA 2ZU6B 3LPZA 1MQSA 2WXFA 3DBSA 2KM4A 4I6JA 4I2WA 2ONDA 1FPPA 2FO7A 4UI9K 5T8IA 1KT1A 3MKRA 2VYIA 2P9IG 4AXHA 4KVMA 3UM3A 2FI7A 2WVIA 1TJCA 3E30A 2KZTA 4GA2A 3ZYKA 1ELWA 1N0QA 4DLOA 2J49A 1YA0A 2IJGX 2VGYA 3FUIA 1UN9A 5KJLA 4HRNA 5G55A 4HLEA 2V4LA 4O1PA 1MZCA 1Z6TA 3RRUA 3AU5A 2JLBA 4BSXA 3ZGQA 4JHJA 3QARA 2AXZA 1SVXA 1BI7B 2EIJE 2RFMA 2OCCE 4U96D 1GW6A 4N3BA 2KATA 3LJNA 4WV7A 2RD0A 4FLBA 1OY3D 2WPVA 4MBGA 2RFAA 1E8XA 2OEVA 2NXPA 4TXPA 4MS6A 1K1AA 2A5EA 1OCOE 3TWXA 1E8WA 3ML8A 3RRNB 5D0QD 5FQ4A 3FDHA 4G24A 3D3MA 4PS7A 3D9MA 4WAFA 3CEQA 4JWIA 4GCNA 1X81A 1A5EA 3KEAA 4ATGA 4HY9A 4JEUA 1O5MA 3DSTA 2UY1A 1OT8A 1YCSB 4HBDA 4ZHBA 3QNJA 4ABNA 3S7FA 1DCEA 3TGOA 4F3VA 4L7TA 1PY1A 2LXMA 3R7RA 3FFLA 4L23A 2XHEA 3D9IA 3CV0A 2WXRA 5FQ6A 2F8XK 4G25A 4MRUA 3IEGA 4ANXA 4EQFA 2NC9A 2Q7FA 2I1JA 1K8KG 3CHMA 4JC8A 1FT1A 3FU0A 2FF4A 1DCQA 4JPSA 3QOUA 1JWGA 3KD7A 3KSLA 3DXKG 3RK6A 3KEZA 3MEKA 5BT1A 2CFUA 2MYOA 1H6PA 3ZU7B 3PZDA 3VLEA 3CR3A 2WQHA 4RVBA 3SNXA 4B93B 3CKCA 2VSYA 1S63A 2GRQB 2CHWA 3QAQA 4FP7A 4QFVA 3D9KA 3FH7A 4PUCA 3FULA 4N2QA 4DX6D 2XZDG 1BPRA 1KPSB 3EIQC 4HB5A 4UQZA 4RQIA 1SZ9A 3I5PA 2IONA 2XCBA 3U9WA 2WXOA 2XQ0A 1H2VC 4XX5A 2VQ2A 1N52A 3ASGA 4JD2G 3ASOE 4R5KA 2XS8A 3K9IA 3P2BA 1E8YA 2P9SG 3QNKA 5CMYA 1OWMA 4HLLA 4XI9A 4IRUA 3ZW3A 3CHSA 2VGEA 4EECA 2DBAA 4RG9A 4U04A 3BG0B 3UTMA 1WM5A 5KWDA 1MYOA 2H6GA 2XEHA 3Q79A 4APOA 3EHQA 1LTXA 4JWEA 2RG8A 4HRMB 4EZVA 1NA0A 2BKKB 2X6JA 7HSCA 4DPRA 3DPDA 4M7CA 4AY5A 3W9GA 1OCZE 3EHRA 3LJ3A 1AP7A 3APCA 3FU3A 2QZAA 2EINE 5CMWA 5EYLA 1ZBPA 1U2VG 3EUVA 4XEIG 3RO3A 1QQEA 3KS2A 3Q5MA 5CBNA 2WXQA 4N3AA 4HI8A 4PO2A 2QC9A 1HG5A 2AXUA 3MJWA 3QDNA 3DOBA 4WNDA 4EZLA 2KXPC 2IQCA 4CYMD 4BX8A 2GRLA 2IFUA 3Q15A 3ABLE 2WMNA 4HOUA 3C72A 2R59A 3RIBA 3V2OA 4QQIA 5AJLA 4JHRA 4BTBA 3FH8A 2KCKA 5EX3A 2VSOE 4EZKA 4UWFA 2X6KA 3Q7AA 2F37A 4GA0A 3NOCD 4UWGA 3B7SA 3CKBA 2J09A 4F01A 2KC7A 4DX5D 2AVPA 5C1DA 4U0UA 2IEJA 1S70B 3DPQA 3CVVA 4G11A 1IHGA 2LAHA 3RJVA 3G2SA 3MV3B 4WNFA 5T3RA 1Z3YA 2KCVA 4A3TA 3FTXA 5BUZA 5ENRD 4I17A 4R5GA 2ETCA 4AV7A 3BQOA 5JA4D 3G2WA 1SZAA 1OUVA 2P9LG 5TKYA 3JXIA 2Y69E 2X6FA 5LX8A 1TJFA 2MRIA 3CHPA 4XE0A 3CIAA 4JA9A 4OAVB 1U3CA 3QB2A 3MKQB 3HVEB 3NF1A 5ARGA 2XGOA 2UY1B 2L6BA 3PDNA 2GRNB 3UT7A 1UW4B 4JA7A 4I1OB 1BU9A 2GROB 1TNOA 3PE4A 2WXNA 5BXOA 3I3NA 3EIJA 4K0RA 1YYHA 3FUEA 3RRMB 4UQXA 3CSFA 3FHEA 4PS3A 4EZNA 1H0AA 4BERA 3FUFA 1EYHA 1KLXA 4YVOA 4GTVA 3B95A 5FZSA 5G04J 4J8FA 1DKZA 2GGFA 3J5QB 4FL9A 3ONLA 3PUKA 2AWIA 4WV5A 1OWOA 2WXKA 2P9NG 3CVQA 3UIPC 3CVXA 4N3CA 4H7YA 3H0XA 5HRYA 4DI4A 4HFGA 5BW8C 4BFRA 2X6IA 4LG6A 2GRMA 5BPPA 3UUXA 4YVQC 4CCAA 3V2XA 1Z3XA 2OP6A 1P5QA 1N9AA 2XS1A 3AU4A 1OXJA 4DRXE 1SW6A 2EQXA 4U07A 2H6FA 2FULA 4U7EB 1E8ZA 3EHMA
chains in the Genus database with same CATH topology
3VTYA 4FJYA 3SBTB 5EKQD 2ILRA 3LEWA 3FDHA 1MHQA 4I1MA 3BEEA 3EHNA 2PL2A 4G24A 2XGMA 3D3MA 3HYMB 4EZYA 3VTXA 4DJAA 4GZ6A 4PS7A 5JHAA 3D9MA 4WAFA 4Q69A 5KJKA 3LY9A 2L9BA 4KZ0A 3CEQA 4JWIA 4N39A 3RU0A 4N2SA 3LKUA 4BT9A 3PREA 4GCNA 4EZQA 4KBQA 3D9NA 3AS8A 1FVFA 2E0IA 4GZDA 4FA6A 4ATGA 4HY9A 4JEUA 2QY7A 1KT0A 4OVVA 3PE3A 4JNFA 4BTAA 2HYZA 2UY1A 1E90A 5CHEE 4J0UA 3CQCB 3C7NB 2V0PA 1WY6A 4KYOB 3S2AA 3QNJA 1DVPA 2PQNA 3I4RB 4ABNA 4EBAA 3S7FA 3ZYMA 1TEZA 4CGWA 5EX0A 2A4ZA 4GYOA 4K03A 4KVOA 3TJPA 3ZN3A 1EDUA 2CG2A 3TGOA 4F3VA 5CCLA 1HU3A 3PS6A 4HOQA 4L7TA 4UI9C 1PY1A 4APFA 3B7RL 3R7RA 2P58C 3FFLA 5LP0A 2WXHA 2A5UA 4KMOA 4L23A 2XHEA 4HORA 3D9IA 3MCXA 3CV0A 1PC2A 2WXRA 3FTUA 5JJ7A 5FJYA 5FQ6A 3FUDA 1HF8A 2BF0X 4RG6A 5G04C 3FUNA 4G25A 3CVNA 3LVRE 4MRUA 2WM9A 3IEGA 4Y6CA 2WMOA 3IHYA 3UMVA 5A23A 2QFCA 4H7XA 3FUHA 4ANXA 2L0IA 3PH0C 4WNGA 4EQFA 2NC9A 1E7VA 2Q7FA 4J8SA 5M72A 2I1JA 4ANUA 3CHMA 4XIFA 1E96B 5BV0A 3Q49B 1HS6A 3LCAA 4JC8A 3ASDA 2UWJG 4ME2A 5JJ6A 3ASHA 3D9PA 3R7QA 2J4DA 2WQ6A 4A1GA 4HOTA 3FU0A 2HO1A 3L22A 4EZUA 4RSYA 2FF4A 1B89A 4JZYA 2WXIA 4A3VA 1H6KA 4JPSA 3QOUA 4DI3A 3UQ3A 1JWGA 3KD7A 3O4ZA 4Y6WA 2KHOA 1ELKA 4C0MA 3DPOA 5FT9A 4CDMA 1INZA 4EZWA 2VTBB 2PM6A 3RK6A 3KEZA 3MEKA 3LS8A 4I1AA 5BT1A 2CFUA 3PNLB 2XGSA 3D9JA 3PZDA 4I6EA 3VLEA 3CR3A 2WQHA 3JCKC 4RVBA 3QWPA 1E7UA 3SNXA 4HVBA 3Q4AB 4MKTA 3CKCA 3ZFWA 2VSYA 2DCPA 3D9OA 4WWNA 5LOZA 5ANLA 5A6CA 5JJTA 2CHWA 3QAQA 1DKXA 4FP7A 3CK7A 1NP7A 4QFVA 4GMJA 4EZXA 3D9KA 5BNWA 3FH7A 4PUCA 4U63A 5C2YA 4PH4B 1UJJA 3FULA 3R9AB 3TXNA 2BTDA 4N2QA 3L17A 3QWVA 4EPZA 3GZ1A 4I9EA 2J07A 2AXVA 3URZA 1JPLA 2V7YA 1BPRA 3D2FA 1IQUA 3GZSA 4J8EA 3EIQC 3PRZA 4IYPA 4KZCA 4HYBA 4GA1A 4EZJA 4V3IA 2FBNA 5FQ7A 4UQZA 3PEVB 2Y3AA 1NA3A 4J6IA 2YNQA 4URKA 1HO8A 1SZ9A 3D9LA 3I5PA 2IONA 3TG5A 1HZ4A 3N8EA 2XCBA 4AP2A 3FTYA 3U9WA 2WXOA 5E84A 2XQ0A 1H2VC 4XX5A 2VQ2A 5FTPA 3OTNA 4Q96A 3T5XA 4CT0A 3FTSA 3GW4A 4G26A 1U00A 1N52A 3ASGA 4C0EA 2XRYA 4FLHA 3L08A 1PAQA 3EJNA 1LF8A 4R5KA 4FU3A 1Q5LA 4CRWA 4L2YA 2LSUA 3APFA 3SD5A 3PNTB 2JEKA 1UJKA 3FUJA 3PEUB 3K9IA 4AY6A 3P2BA 2I9CA 4ANVA 4F53A 1E8YA 4CGVA 2M63A 3CHRA 2J4BA 4R5JA 3QC1A 3QNKA 4AJWA 1JWFA 3SGHA 5E76A 5CMYA 2C0LA 2VGXA 1OWMA 2LAIA 3ML9A 3OXGA 5KJNA 3I4GA 2CHZA 3CQGB 1ZU2A 2IOLA 4GCOA 4XI9A 4UWLA 5G05J 1HH8A 4UWHA 4ANWA 4BT8A 3EDTB 4IRUA 2X3MA 3L6AA 4F1SA 4U8HA 3ZW3A 3CHSA 4I43A 4EECA 4N5CA 4MQDA 5BV1A 2BPRA 2OVBA 2DBAA 4RG9A 3QWWA 2MHKA 4U04A 3BG0B 1SQMA 1WM5A 5ANRA 4G1TA 3ZPJA 3FEXA 3ZXSA 3SFZA 3JYSA 4IULA 2IF4A 3B13A 1VDYA 3MA5A 4APOA 3L54A 1OWLA 4LCTA 4JWEA 3ZYQA 3NZSA 4W9RA 4GMLA 3G2VA 2RG8A 4EZVA 2VGXB 1NA0A 2HR2A 5ARFA 4AEZC 3WXXA 2X6JA 1H19A 5FQ4A 4CDRA 7HSCA 5J90A 2LNIA 3CVLA 4DPRA 4HOSA 3DPDA 3FTVA 4P29A 4CEMA 4AY5A 1W3BA 4XI0A 3APDA 4GZ5A 1HE8A 4ILHB 3LJ3A 4GYYA 3APCA 3FU3A 3ESLA 3SI5A 4ACKA 5CMWA 2XRZA 3TAXA 3AS4A 3MYVA 5G05C 1ZBPA 3FY4A 4B8AA 3LVQE 4GZ3A 2E2EA 4TV3A 2XEVA 4L2LA 3RO3A 4ILGA 3UX4A 4A1SA 1IQRA 4AVXA 4KXKB 3IV0A 4AIFA 4NQ0A 1QQEA 3KS2A 3Q5MA 1Y8MA 3G2TA 4HXIA 3LYAA 2QXLA 3QJZA 2WXQA 4N3AA 4YNDA 2V8SE 4O6FA 4PO2A 5D0OD 1HG5A 5FWQA 3C7NA 3FH5A 4FC8A 3LDZA 4XKCA 4AM9A 3L13A 2WQ7A 2AXUA 3MJWA 3QDNA 2OVFA 3CVUA 4ACLA 3DOBA 5JHBA 2Y4UA 4WNDA 4EBAG 3C98A 4U0SA 4EZLA 5ENNA 2VTBA 2IQCA 3FU6A 3FTWA 4R7LA 2HM8A 4BX8A 2GRLA 4XZ4A 2IOSA 2IFUA 2VSNA 2YHCA 3Q15A 4IN3B 1Y6IA 4B8CB 3ZVVA 1H2UA 4DK5A 2WMNA 2GW1A 4HOUA 4TUUA 3OXLA 2R59A 2CG3A 4GU5A 3RIBA 4EZRA 3JUIA 3P1UA 5AJLA 1NZNA 4D10C 1YUWA 4JHRA 4DLQA 1CKRA 4BTBA 5HQ8A 3FH8A 4EZSA 2CHXA 2KCKA 5EDSA 4UQYA 3FWVA 4EZZA 4EZPA 4WUYA 2VSOE 5EX3A 4L1BA 4EZKA 2FEZA 3ZYLA 3T5VA 3AS5A 2X6KA 3IKOB 4UWFA 3CGHA 1HXIA 4OVUA 4GA0A 2R17C 2CFZA 4BX9A 3FEYA 4UWGA 2KZTB 2L0TB 3B7SA 4UWKA 3CKBA 5A7DB 5AIJA 4JNEA 3ASFA 4G2VA 2J09A 4J8DA 3SF4A 4JN4A 4F01A 3IBEA 2KC7A 3D2EA 4PS8A 2KCLA 1A17A 4FHKA 3MV2B 4R5IA 2AVPA 3CVPA 5C1DA 3HDXA 4U0UA 3NZUA 4JVSA 2IU1A 3RKVA 4AOFA 3FUMA 3TL5A 4BWRA 1WAO1 3CVWA 3QK0A 3DPQA 2Y4TA 4FULA 3ZHEB 3CLJA 4NURA 3U66A 3KAEA 3CVVA 4C9BB 3E4BA 3MGBA 4G11A 3G2UA 5CCMA 1IHGA 1IYGA 4LRZA 3CK9A 4WWOA 1X5BA 3U3WA 2VSXE 2LAHA 3RJVA 2PQRA 3HHMA 2YINA 3G2SA 3MV3B 2I1KA 4JEHA 3B7UX 1QNFA 1QZ2A 4WNFA 4GPKA 5T3RA 4JHKA 5HI7A 4CT4A 3CVYA 1Z3YA 3T8MA 5AJDA 3SHFA 3TXMA 4JWCA 3QKYA 2KCVA 2OV8A 3OAWA 3FP3A 4A3TA 1XGWA 3FTXA 4B89A 3Q47B 3MKQA 1JUQA 3ULQA 4JW1A 1EPUA 5BUZA 4I17A 2X6HA 4XKBA 4R5GA 1XNFA 2L6JA 1FCHA 4AV7A 3U64A 4M3OA 1DKYA 3IHVA 3PUJA 3G2WA 4CDNA 1DNPA 4LERA 1SZAA 1OUVA 4LUNU 3DPPA 4G23A 4ILIA 5TKYA 3B7TA 5G2NA 4LEUA 2X6FA 5E75A 5LX8A 4I2ZA 5KJMA 1TJFA 2NSZA 4BY6A 1H2TC 2OOEA 2MRIA 1FVHA 3CSTA 4JL0A 3CHPA 4XE0A 3CIAA 4JA9A 5KCMA 3SZ7A 1U3CA 2AW6A 2X38A 3QB2A 2YQ8A 4GZCA 3MKQB 4E85A 3HVEB 4JXTA 4A55A 2XPYA 3NF1A 2J08A 5ARGA 2XGOA 3UT8A 3FU5A 3LXUX 3VLFA 1S0PA 2UY1B 2WXGA 2I2OA 2LSVA 3PDNA 4PDXA 3UT7A 1UW4B 3LY7A 4F00A 3N71A 5LFAA 2VJ8A 4JA7A 3CHOA 4GYWA 4I1OB 4JWDA 4FADA 3U4TA 1EF1C 4B0ZA 2WB2A 2ZU6B 3GYZA 3PE4A 2LO6A 2WXNA 3LPZA 1HG2A 1MQSA 2WXJA 3I3NA 3EIJA 4K0RA 2WXFA 3DBSA 2KM4A 5AENA 3FUEA 3RRMB 4I6JA 4UQXA 3CSFA 4KT6B 5T4YA 3ZEFA 3OXFA 3FHEA 4R5LA 4FHJA 4E6HA 4PS3A 4F7AA 4I2WA 4EZNA 4GAAA 2ONDA 3NQPA 2R5SA 4EZOA 1H0AA 2FO7A 2WXLA 4UI9K 3O48A 4GB9A 3VLDA 4HS2A 2BUGA 1KT1A 4MLPA 4WWPA 5T8IA 3FUFA 3MKRA 2YHEA 2MOWA 2VYIA 1EYHA 1KLXA 4YVOA 4FJZA 4EZTA 5DIZA 4AXHA 1OWNA 4KVMA 3S7BA 5FZSA 5G04J 3L16A 5J08A 4J8FA 1DKZA 5AYWD 2FI7A 1N54A 2PZIA 1HFAA 2WVIA 4TRQA 1TJCA 2GGFA 2KZTA 4FL9A 4GA2A 3ZYKA 1ELWA 3DQGA 4DLOA 2WXMA 3FTZA 4B9QA 2J49A 1YA0A 2IJGX 2VGYA 3FUIA 3JQ0A 4Q94A 1UN9A 5KJLA 5G55A 3LY8A 4HLEA 2V4LA 3ONLA 2J9QA 3RO2A 3PUKA 2AWIA 3MX3A 3PVLA 1Z6TA 3RRUA 4WV5A 1OWOA 3AU5A 4OYSA 2WXKA 1UG3A 3TG4A 3CVQA 4WNEA 3CHQA 3CVXA 2JLBA 1UN8A 2WXPA 2XPZA 4N3CA 5DBKA 5FQ8A 4BSXA 4H7YA 3ZHEA 3H0XA 3ZGQA 3S7JA 4JHJA 3QARA 2AXZA 3BG1B 3GZ2A 3ENEA 3S7DA 2XPIA 4DI4A 4E81A 4HFGA 4UI9J 5BW8C 1U3DA 3ESKA 4BFRA 2X6IA 4NACA 5FZRA 2GRMA 3HIZA 5BPPA 2C2LA 3UUXA 1GW6A 2V5FA 2KATA 1HX8A 4N3BA 4YVQC 4B94A 4CCAA 3FUKA 4WV7A 2DIWA 2RD0A 1Z3XA 2XCCA 2OP6A 3MZLB 1P5QA 4FLBA 5LCWC 5LCWJ 1OWPA 2WPVA 3JQ1A 3UPVA 3CK8A 3HVEA 1DG4A 3AU4A 1E8XA 4U0ZA 3UT4A 4I6GA 2NXPA 3ZIMA 2C0MA 1ELRA 4MS6A 5FZQA 2I6HA 3ONKA 1BPOA 2EQXA 4NRHB 4U07A 1E8WA 2FULA 3ML8A 3RRNB 1L5JA 3SBSA 3ZRHA 5D0QD 1E8ZA 2PM7A 3EHMA 4I9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I43 A;  4ILG A;  3SBT B;  3SBS A;  4ILH B;  3ZEF A;  4ILI A; 
#chains in the Genus database with same CATH topology
 3VTY A;  5EKQ D;  4LNG A;  4I1M A;  3EHN A;  3TWW A;  3VTX A;  3JXJ A;  4DJA A;  4GZ6 A;  1N11 A;  4Q69 A;  5KJK A;  1BD8 A;  2L9B A;  1O1S A;  3SFX A;  3RU0 A;  3LKU A;  4BT9 A;  3PRE A;  1V55 E;  5CED B;  5JMN D;  4OVV A;  3AJI A;  4BTA A;  2HYZ A;  2DZN A;  3SO8 A;  3ASN E;  3DRA A;  4BEP A;  1TEZ A;  4CZ2 D;  4CGW A;  2A4Z A;  4KVO A;  3TJP A;  2CG2 A;  1HU3 A;  4APF A;  3B7R L;  1IHB A;  4DX1 A;  2Y1L E;  3FTU A;  5CER B;  5JJ7 A;  5FJY A;  3FUD A;  2BF0 X;  3V79 K;  2WM9 A;  3PH0 C;  1SA5 A;  4WNG A;  2R03 A;  4XIF A;  3ASH A;  3D9P A;  3R7Q A;  3L22 A;  4RSY A;  3HXF A;  3WG7 E;  1ELK A;  1INZ A;  4EZW A;  2PM6 A;  1MJ0 A;  3PNL B;  5ITZ F;  1UOH A;  4C48 B;  4HVB A;  3Q4A B;  3AG1 E;  4DUI A;  4WWN A;  5LOZ A;  3CK7 A;  3BU8 A;  3L17 A;  3QWV A;  4EPZ A;  4Z68 A;  4I9E A;  2GRR B;  3UXG A;  3UIO C;  1IQU A;  3GZS A;  4J8E A;  2ZGD A;  3PRZ A;  4KZC A;  4V3I A;  2F8Y A;  1NFI E;  3UIN C;  4J6I A;  1OCR E;  2P2C P;  5D2M C;  3TG5 A;  4AP2 A;  3FTY A;  3ZNG A;  3OTN A;  4CT0 A;  4G26 A;  3NOG D;  2DVW A;  2RKK A;  2XRY A;  4FLH A;  4GTQ A;  1LF8 A;  4J8Y A;  5IY5 E;  4L2Y A;  3ABK E;  3SD5 A;  4A63 B;  1UJK A;  4AY6 A;  4ANV A;  2M63 A;  4R5J A;  2H6I A;  3QC1 A;  2VGX A;  3OXG A;  2CHZ A;  2F0Y A;  1ZU2 A;  5G05 J;  4ANW A;  3EDT B;  5KNG A;  4I43 A;  1TNY A;  3QWW A;  3IXE A;  1SQM A;  3ZXS A;  4GTM A;  3SFZ A;  3JYS A;  2IF4 A;  3MA5 A;  4BES A;  4O1O A;  4LCT A;  1KZP A;  2DZO A;  3ZYQ A;  4YDW A;  4ATZ D;  3G2V A;  2VGX B;  5D66 A;  5CRU A;  4J7W A;  4CDR A;  1H19 A;  2LNI A;  4HOS A;  1HE8 A;  4GYY A;  2XRZ A;  2R02 A;  3MYV A;  3FY4 A;  4B8A A;  4A1S A;  1IQR A;  3IV0 A;  5HKP A;  2QXL A;  2V8S E;  4O6F A;  5D0O D;  5FWQ A;  4FC8 A;  3LDZ A;  3L13 A;  3HRA A;  4ACL A;  3C3Q A;  5JHB A;  4EBA G;  4NIK A;  2VTB A;  3V30 A;  3FTW A;  2VSN A;  4IN3 B;  1Y6I A;  3ZVV A;  4DK5 A;  2GW1 A;  4TUU A;  4EZR A;  3JUI A;  4D10 C;  1NZN A;  3TWT A;  5HQ8 A;  3PZ4 A;  5EDS A;  4WUY A;  1TN8 A;  4U95 D;  4DX7 D;  3AS5 A;  3CGH A;  4OVU A;  2R17 C;  4UWK A;  5AIJ A;  1V54 E;  2IY0 C;  3IBE A;  4PS8 A;  3C3O A;  3V31 A;  3NZU A;  4JVS A;  2KBX A;  4FUL A;  3CLJ A;  4NUR A;  3E4B A;  3NBN B;  1X5B A;  3U3W A;  2PQR A;  2YIN A;  2I1K A;  4JEH A;  1QNF A;  1QZ2 A;  4GPK A;  4JHK A;  2DYS E;  1ZB1 A;  2OV8 A;  3OAW A;  4B89 A;  3Q47 B;  3MKQ A;  1JUQ A;  1EPU A;  4XKB A;  1XNF A;  1FCH A;  3U64 A;  4M3O A;  4CDN A;  1DNP A;  3TWS A;  1N0R A;  4LEU A;  2NSZ A;  2OOE A;  3J5P A;  1FVH A;  2AW6 A;  4GZC A;  4A55 A;  3VLF A;  3TWU A;  5LFA A;  2JAB A;  4GYW A;  4JWD A;  4FAD A;  2WB2 A;  3E37 A;  1HG2 A;  2WXJ A;  3ULE G;  4LNU D;  5AEN A;  3Q7F A;  3ZKJ A;  3PZ2 A;  4R5L A;  3OXF A;  1JCQ A;  4FHJ A;  4F7A A;  4RLY A;  2R5S A;  2R2L A;  4EZO A;  1D9S A;  2WXL A;  4TUM A;  4GTO A;  4HS2 A;  2BUG A;  4WWP A;  3ZXP A;  2MOW A;  3S7B A;  5J08 A;  5EIB E;  4U8V D;  5AYW D;  2PZI A;  1HFA A;  4TRQ A;  2R05 A;  3DQG A;  1K3Z D;  3FTZ A;  3JQ0 A;  3RO2 A;  3PVL A;  4OYS A;  3TG4 A;  1RW2 A;  1N95 A;  5FQ8 A;  2WXP A;  3ZHE A;  3S7J A;  3BG1 B;  3S7D A;  2XPI A;  4YDY A;  4UI9 J;  1U3D A;  3ESK A;  5AQA A;  5FZR A;  3HIZ A;  3Q9N C;  2C2L A;  2V5F A;  1HX8 A;  2PNN A;  2XCC A;  3UPV A;  3CK8 A;  1DG4 A;  3UT4 A;  1TNB A;  3DWL G;  5FZQ A;  1BPO A;  4NRH B;  2ILR A;  3LEW A;  4LNB A;  1MHQ A;  3BEE A;  2PL2 A;  3HYM B;  4X8Q A;  5FIN A;  4N39 A;  3AS8 A;  3UKR G;  1FVF A;  2E0I A;  4GZD A;  2QY7 A;  3PE3 A;  3DSV A;  4J0U A;  3CQC B;  3C7N B;  3S2A A;  3I4R B;  2PQN A;  4K5B A;  4EBA A;  2P9P G;  1WG0 A;  4GYO A;  4K03 A;  3L9T A;  1EDU A;  2GRP B;  5CCL A;  3UM1 A;  1TYQ G;  4HOQ A;  4UI9 C;  1KZO A;  5AAO A;  2A5U A;  4KMO A;  3HG0 D;  4HOR A;  3R9M A;  5CBO A;  1N4S A;  3C5R A;  2B6C A;  3CVN A;  3LVR E;  4Y6C A;  1YMP A;  2XEN A;  3T9K A;  4YDO A;  4J8S A;  1OCC E;  5BV0 A;  3Q49 B;  1HS6 A;  3LCA A;  2WQ6 A;  4HOT A;  2HO1 A;  4EZU A;  2WXI A;  4A3V A;  4DI3 A;  3UQ3 A;  3DEP A;  3AG4 E;  4C0M A;  5FT9 A;  2VTB B;  3LS8 A;  3C3R A;  3L82 A;  4K5C A;  3D9J A;  1H6O A;  1D8E A;  3ZFW A;  2DCP A;  3D9O A;  5JJT A;  1DKX A;  4DX2 A;  4GMJ A;  5ENT D;  4EZX A;  5BNW A;  4PH4 B;  1Z5S C;  3R9A B;  2P9U G;  2BTD A;  3GZ1 A;  5EYP F;  2J07 A;  2AXV A;  3JUE A;  3Q75 A;  3URZ A;  5FQ7 A;  1NA3 A;  4URK A;  4N5Q A;  1AWC B;  3T5X A;  3AG2 E;  3DXM G;  1U00 A;  3NAW A;  1N4R A;  1JCS A;  4C0E A;  3L08 A;  1PAQ A;  4FU3 A;  4ZFH A;  1Q5L A;  3SQV A;  3PEU B;  4YDE A;  2J4B A;  4AJW A;  1JWF A;  5KJN A;  4GCO A;  3SFY A;  4BET A;  4UWL A;  4UWH A;  4BT8 A;  3TWR A;  4N5C A;  5BV1 A;  5ANR A;  3FEX A;  3B13 A;  1VDY A;  2ZGG A;  5CRV A;  1DC2 A;  3L54 A;  1OWL A;  3NZS A;  4W9R A;  1NL4 A;  1LD7 A;  2HR2 A;  4AEZ C;  5J90 A;  3UM2 A;  4CEM A;  4P29 A;  5ENQ D;  1W3B A;  3APD A;  4GZ5 A;  3ESL A;  3TAX A;  3PZ1 A;  2V5Q C;  3LVQ E;  4L9P A;  4TV3 A;  2XEV A;  4KXK B;  3G2T A;  3LYA A;  3QJZ A;  2QYJ A;  4XKC A;  4AM9 A;  4G8K A;  2WQ7 A;  2OVF A;  1IKN D;  4U0S A;  3E34 A;  4HNA D;  3UM0 A;  3FU6 A;  4R7L A;  2HM8 A;  2IOS A;  4GTR A;  1S64 A;  4TXQ A;  3OXL A;  2CG3 A;  1TN6 A;  1CKR A;  1BLX B;  4DLQ A;  2ETA A;  4EZS A;  2CHX A;  4EZZ A;  4UQY A;  3FWV A;  5H7P A;  4EZP A;  4UUC A;  3T5V A;  2FEZ A;  3ZYL A;  4GMR A;  2CFZ A;  4BX9 A;  1FT2 A;  2KZT B;  4JNE A;  3ASF A;  1MX6 A;  4TXR A;  4G2V A;  3SF4 A;  4J8D A;  4JN4 A;  2Y0B G;  5EID A;  2KCL A;  3ULY A;  4FHK A;  2BED A;  2LXL A;  3BUA A;  3HDX A;  4AOF A;  3TL5 A;  3MGB A;  5CCM A;  4LRZ A;  3CK9 A;  5CEA A;  2VSX E;  3B7U X;  3CVY A;  3T8M A;  5AJD A;  3SHF A;  3TXM A;  4JWC A;  3FP3 A;  1XGW A;  3ULQ A;  3D9H A;  2X6H A;  1N94 A;  2L6J A;  3F6Q A;  4GTP A;  1IXV A;  3IHV A;  3PUJ A;  4OAU C;  3B7T A;  4BY6 A;  1H2T C;  2IO2 C;  3CST A;  4K5A B;  3SZ7 A;  3HXD A;  2X38 A;  4E85 A;  2YQ8 A;  3UKU G;  4JXT A;  2XPY A;  2J08 A;  3LXU X;  2WXG A;  2I2O A;  2VJ8 A;  3GYZ A;  2LO6 A;  2FO1 E;  1K1B A;  3HXB A;  5T4Y A;  4KT6 B;  3ZEF A;  4E6H A;  2B0O E;  4GAA A;  3NQP A;  4GTT A;  3RSE G;  3VLD A;  3O48 A;  4GB9 A;  5FIO A;  4MLP A;  2YHE A;  3DSW A;  4FJZ A;  4EZT A;  5DIZ A;  1OWN A;  3L16 A;  3EU9 A;  2HE0 A;  1N54 A;  3AG3 E;  4F1P A;  1SA4 A;  2AJA A;  4B9Q A;  2WXM A;  4Q94 A;  3LY8 A;  2J9Q A;  3MX3 A;  1TN7 A;  1UG3 A;  4WNE A;  3CHQ A;  2XPZ A;  1UN8 A;  5DBK A;  1TR4 A;  1WDY A;  4E81 A;  3GZ2 A;  3ENE A;  2IO3 C;  1TNZ A;  3W9F A;  4NAC A;  4B94 A;  5ENO D;  4O60 A;  3FUK A;  2DIW A;  4HI9 A;  3MZL B;  3E33 A;  5LCW C;  5LCW J;  1OWP A;  3JQ1 A;  3HVE A;  3ABM E;  2ZIR A;  4U0Z A;  4I6G A;  3ZIM A;  2C0M A;  1ELR A;  2I6H A;  3ONK A;  1JCR A;  3SBS A;  1L5J A;  3ZRH A;  2PM7 A;  4I9C A;  1NI1 A;  4FJY A;  3SBT B;  2ETB A;  2XGM A;  5ENS D;  4EZY A;  1QBQ A;  5JHA A;  3LY9 A;  4KZ0 A;  2V4H C;  4N2S A;  3ISM C;  4EZQ A;  4KBQ A;  3D9N A;  5EN5 D;  3KSQ A;  4F6R D;  4FA6 A;  1KT0 A;  4JNF A;  1E90 A;  5CHE E;  2J8S D;  2V0P A;  1WY6 A;  4KYO B;  1DVP A;  3ZYM A;  2NYJ A;  4GTS A;  3DSU A;  5EX0 A;  3ZN3 A;  3DPY A;  2XEE A;  3PS6 A;  5AQB A;  3E32 A;  2ZIS A;  2P58 C;  1BI8 B;  5LP0 A;  2WXH A;  3MCX A;  3Q9U C;  2EIK E;  1PC2 A;  1HF8 A;  4RG6 A;  5G04 C;  3FUN A;  2WMO A;  3IHY A;  3UMV A;  5A23 A;  1N4Q A;  2QFC A;  4H7X A;  3FUH A;  2L0I A;  2OEW A;  1E7V A;  3HXE A;  2EIM E;  5M72 A;  4ANU A;  1E96 B;  2H6H A;  3DSS A;  3ASD A;  2UWJ G;  4ME2 A;  5JJ6 A;  2J4D A;  3SY2 A;  4A1G A;  1B89 A;  1TNU A;  4JZY A;  3T8K A;  1H6K A;  3O4Z A;  4Y6W A;  2KHO A;  3DPO A;  4CDM A;  4I1A A;  2XGS A;  4I6E A;  3JCK C;  3QWP A;  1E7U A;  4HRL A;  3PZ3 A;  4MKT A;  5ANL A;  5A6C A;  1NP7 A;  3Q78 A;  3AAA C;  4U63 A;  5C2Y A;  1UJJ A;  3TXN A;  5AN8 A;  1JPL A;  2V7Y A;  2XZT G;  3D2F A;  3HXC A;  4IYP A;  4HYB A;  4GA1 A;  4EZJ A;  2FBN A;  3PEV B;  2Y3A A;  3TWQ A;  2YNQ A;  1HO8 A;  3NB2 A;  3D9L A;  1HZ4 A;  3N8E A;  5E84 A;  1MX2 A;  5FTP A;  4Q96 A;  3FTS A;  3GW4 A;  3EJN A;  4CRW A;  2LSU A;  3APF A;  1MX4 A;  3PNT B;  4U8Y D;  2JEK A;  3FUJ A;  2I9C A;  4F53 A;  4CGV A;  3CHR A;  4LSZ E;  5AAR A;  1O1R A;  3SGH A;  5E76 A;  2C0L A;  2LAI A;  3ML9 A;  3I4G A;  3CQG B;  2IOL A;  1HH8 A;  2X3M A;  3L6A A;  4F1S A;  4U8H A;  4MQD A;  2DWZ A;  2BPR A;  2OVB A;  2MHK A;  4JB8 P;  4G1T A;  3ZPJ A;  3TWV A;  1Q2Z A;  5EIL A;  4IUL A;  4GML A;  2QYU A;  5KNH D;  5ARF A;  3WXX A;  3CVL A;  3FTV A;  3ZUV B;  4XI0 A;  4ILH B;  3RAU A;  3SI5 A;  4ACK A;  3AS4 A;  5G05 C;  5B1B E;  4GZ3 A;  5AQ7 A;  2P9K G;  2E2E A;  4L2L A;  4ILG A;  3UX4 A;  4G8L A;  4AVX A;  1LD8 A;  4NQ0 A;  4AIF A;  5CEC B;  4HXI A;  1Y8M A;  4YND A;  1G3N B;  3C7N A;  3FH5 A;  3CVU A;  4GPM A;  2Y4U A;  3C98 A;  5ENN A;  4XZ4 A;  2YHC A;  4EHM A;  4B8C B;  1H2U A;  4GU5 A;  3EU5 A;  3P1U A;  1YUW A;  2ZXW E;  3B7B A;  2EIL E;  3Q73 A;  4L1B A;  3UI2 A;  3IKO B;  1HXI A;  3FEY A;  2L0T B;  5A7D B;  2BKG A;  1O1T A;  4BSZ B;  5B1A E;  3D2E A;  1A17 A;  1D8D A;  3MV2 B;  4R5I A;  5BXU A;  3CVP A;  2IU1 A;  3RKV A;  3FUM A;  3CVW A;  4BWR A;  1WAO 1;  3QK0 A;  2Y4T A;  3ZHE B;  3U66 A;  3KAE A;  5B3S E;  4C9B B;  3G2U A;  1IYG A;  4WWO A;  3X2Q E;  3HHM A;  3DEO A;  5KBA A;  5HI7 A;  4CT4 A;  3DSX A;  3QKY A;  4JW1 A;  1N4P A;  4HQD A;  1DKY A;  1QYM A;  2LUH A;  4LER A;  4LUN U;  3DPP A;  4G23 A;  4ILI A;  5HS0 A;  5G2N A;  5E75 A;  4I2Z A;  5KJM A;  4JL0 A;  5KCM A;  1RZ4 A;  3UT8 A;  3FU5 A;  1S0P A;  2LSV A;  4PDX A;  5AQ9 A;  4F00 A;  3LY7 A;  3N71 A;  3CHO A;  5ENP D;  2DYR E;  3U4T A;  1EF1 C;  4B0Z A;  2ZU6 B;  3LPZ A;  1MQS A;  2WXF A;  3DBS A;  2KM4 A;  4I6J A;  4I2W A;  2OND A;  1FPP A;  2FO7 A;  4UI9 K;  5T8I A;  1KT1 A;  3MKR A;  2VYI A;  2P9I G;  4AXH A;  4KVM A;  3UM3 A;  2FI7 A;  2WVI A;  1TJC A;  3E30 A;  2KZT A;  4GA2 A;  3ZYK A;  1ELW A;  1N0Q A;  4DLO A;  2J49 A;  1YA0 A;  2IJG X;  2VGY A;  3FUI A;  1UN9 A;  5KJL A;  4HRN A;  5G55 A;  4HLE A;  2V4L A;  4O1P A;  1MZC A;  1Z6T A;  3RRU A;  3AU5 A;  2JLB A;  4BSX A;  3ZGQ A;  4JHJ A;  3QAR A;  2AXZ A;  1SVX A;  1BI7 B;  2EIJ E;  2RFM A;  2OCC E;  4U96 D;  1GW6 A;  4N3B A;  2KAT A;  3LJN A;  4WV7 A;  2RD0 A;  4FLB A;  1OY3 D;  2WPV A;  4MBG A;  2RFA A;  1E8X A;  2OEV A;  2NXP A;  4TXP A;  4MS6 A;  1K1A A;  2A5E A;  1OCO E;  3TWX A;  1E8W A;  3ML8 A;  3RRN B;  5D0Q D;  5FQ4 A;  3FDH A;  4G24 A;  3D3M A;  4PS7 A;  3D9M A;  4WAF A;  3CEQ A;  4JWI A;  4GCN A;  1X81 A;  1A5E A;  3KEA A;  4ATG A;  4HY9 A;  4JEU A;  1O5M A;  3DST A;  2UY1 A;  1OT8 A;  1YCS B;  4HBD A;  4ZHB A;  3QNJ A;  4ABN A;  3S7F A;  1DCE A;  3TGO A;  4F3V A;  4L7T A;  1PY1 A;  2LXM A;  3R7R A;  3FFL A;  4L23 A;  2XHE A;  3D9I A;  3CV0 A;  2WXR A;  5FQ6 A;  2F8X K;  4G25 A;  4MRU A;  3IEG A;  4ANX A;  4EQF A;  2NC9 A;  2Q7F A;  2I1J A;  1K8K G;  3CHM A;  4JC8 A;  1FT1 A;  3FU0 A;  2FF4 A;  1DCQ A;  4JPS A;  3QOU A;  1JWG A;  3KD7 A;  3KSL A;  3DXK G;  3RK6 A;  3KEZ A;  3MEK A;  5BT1 A;  2CFU A;  2MYO A;  1H6P A;  3ZU7 B;  3PZD A;  3VLE A;  3CR3 A;  2WQH A;  4RVB A;  3SNX A;  4B93 B;  3CKC A;  2VSY A;  1S63 A;  2GRQ B;  2CHW A;  3QAQ A;  4FP7 A;  4QFV A;  3D9K A;  3FH7 A;  4PUC A;  3FUL A;  4N2Q A;  4DX6 D;  2XZD G;  1BPR A;  1KPS B;  3EIQ C;  4HB5 A;  4UQZ A;  4RQI A;  1SZ9 A;  3I5P A;  2ION A;  2XCB A;  3U9W A;  2WXO A;  2XQ0 A;  1H2V C;  4XX5 A;  2VQ2 A;  1N52 A;  3ASG A;  4JD2 G;  3ASO E;  4R5K A;  2XS8 A;  3K9I A;  3P2B A;  1E8Y A;  2P9S G;  3QNK A;  5CMY A;  1OWM A;  4HLL A;  4XI9 A;  4IRU A;  3ZW3 A;  3CHS A;  2VGE A;  4EEC A;  2DBA A;  4RG9 A;  4U04 A;  3BG0 B;  3UTM A;  1WM5 A;  5KWD A;  1MYO A;  2H6G A;  2XEH A;  3Q79 A;  4APO A;  3EHQ A;  1LTX A;  4JWE A;  2RG8 A;  4HRM B;  4EZV A;  1NA0 A;  2BKK B;  2X6J A;  7HSC A;  4DPR A;  3DPD A;  4M7C A;  4AY5 A;  3W9G A;  1OCZ E;  3EHR A;  3LJ3 A;  1AP7 A;  3APC A;  3FU3 A;  2QZA A;  2EIN E;  5CMW A;  5EYL A;  1ZBP A;  1U2V G;  3EUV A;  4XEI G;  3RO3 A;  1QQE A;  3KS2 A;  3Q5M A;  5CBN A;  2WXQ A;  4N3A A;  4HI8 A;  4PO2 A;  2QC9 A;  1HG5 A;  2AXU A;  3MJW A;  3QDN A;  3DOB A;  4WND A;  4EZL A;  2KXP C;  2IQC A;  4CYM D;  4BX8 A;  2GRL A;  2IFU A;  3Q15 A;  3ABL E;  2WMN A;  4HOU A;  3C72 A;  2R59 A;  3RIB A;  3V2O A;  4QQI A;  5AJL A;  4JHR A;  4BTB A;  3FH8 A;  2KCK A;  5EX3 A;  2VSO E;  4EZK A;  4UWF A;  2X6K A;  3Q7A A;  2F37 A;  4GA0 A;  3NOC D;  4UWG A;  3B7S A;  3CKB A;  2J09 A;  4F01 A;  2KC7 A;  4DX5 D;  2AVP A;  5C1D A;  4U0U A;  2IEJ A;  1S70 B;  3DPQ A;  3CVV A;  4G11 A;  1IHG A;  2LAH A;  3RJV A;  3G2S A;  3MV3 B;  4WNF A;  5T3R A;  1Z3Y A;  2KCV A;  4A3T A;  3FTX A;  5BUZ A;  5ENR D;  4I17 A;  4R5G A;  2ETC A;  4AV7 A;  3BQO A;  5JA4 D;  3G2W A;  1SZA A;  1OUV A;  2P9L G;  5TKY A;  3JXI A;  2Y69 E;  2X6F A;  5LX8 A;  1TJF A;  2MRI A;  3CHP A;  4XE0 A;  3CIA A;  4JA9 A;  4OAV B;  1U3C A;  3QB2 A;  3MKQ B;  3HVE B;  3NF1 A;  5ARG A;  2XGO A;  2UY1 B;  2L6B A;  3PDN A;  2GRN B;  3UT7 A;  1UW4 B;  4JA7 A;  4I1O B;  1BU9 A;  2GRO B;  1TNO A;  3PE4 A;  2WXN A;  5BXO A;  3I3N A;  3EIJ A;  4K0R A;  1YYH A;  3FUE A;  3RRM B;  4UQX A;  3CSF A;  3FHE A;  4PS3 A;  4EZN A;  1H0A A;  4BER A;  3FUF A;  1EYH A;  1KLX A;  4YVO A;  4GTV A;  3B95 A;  5FZS A;  5G04 J;  4J8F A;  1DKZ A;  2GGF A;  3J5Q B;  4FL9 A;  3ONL A;  3PUK A;  2AWI A;  4WV5 A;  1OWO A;  2WXK A;  2P9N G;  3CVQ A;  3UIP C;  3CVX A;  4N3C A;  4H7Y A;  3H0X A;  5HRY A;  4DI4 A;  4HFG A;  5BW8 C;  4BFR A;  2X6I A;  4LG6 A;  2GRM A;  5BPP A;  3UUX A;  4YVQ C;  4CCA A;  3V2X A;  1Z3X A;  2OP6 A;  1P5Q A;  1N9A A;  2XS1 A;  3AU4 A;  1OXJ A;  4DRX E;  1SW6 A;  2EQX A;  4U07 A;  2H6F A;  2FUL A;  4U7E B;  1E8Z A;  3EHM A; 
#chains in the Genus database with same CATH homology
 3VTY A;  4FJY A;  3SBT B;  5EKQ D;  2ILR A;  3LEW A;  3FDH A;  1MHQ A;  4I1M A;  3BEE A;  3EHN A;  2PL2 A;  4G24 A;  2XGM A;  3D3M A;  3HYM B;  4EZY A;  3VTX A;  4DJA A;  4GZ6 A;  4PS7 A;  5JHA A;  3D9M A;  4WAF A;  4Q69 A;  5KJK A;  3LY9 A;  2L9B A;  4KZ0 A;  3CEQ A;  4JWI A;  4N39 A;  3RU0 A;  4N2S A;  3LKU A;  4BT9 A;  3PRE A;  4GCN A;  4EZQ A;  4KBQ A;  3D9N A;  3AS8 A;  1FVF A;  2E0I A;  4GZD A;  4FA6 A;  4ATG A;  4HY9 A;  4JEU A;  2QY7 A;  1KT0 A;  4OVV A;  3PE3 A;  4JNF A;  4BTA A;  2HYZ A;  2UY1 A;  1E90 A;  5CHE E;  4J0U A;  3CQC B;  3C7N B;  2V0P A;  1WY6 A;  4KYO B;  3S2A A;  3QNJ A;  1DVP A;  2PQN A;  3I4R B;  4ABN A;  4EBA A;  3S7F A;  3ZYM A;  1TEZ A;  4CGW A;  5EX0 A;  2A4Z A;  4GYO A;  4K03 A;  4KVO A;  3TJP A;  3ZN3 A;  1EDU A;  2CG2 A;  3TGO A;  4F3V A;  5CCL A;  1HU3 A;  3PS6 A;  4HOQ A;  4L7T A;  4UI9 C;  1PY1 A;  4APF A;  3B7R L;  3R7R A;  2P58 C;  3FFL A;  5LP0 A;  2WXH A;  2A5U A;  4KMO A;  4L23 A;  2XHE A;  4HOR A;  3D9I A;  3MCX A;  3CV0 A;  1PC2 A;  2WXR A;  3FTU A;  5JJ7 A;  5FJY A;  5FQ6 A;  3FUD A;  1HF8 A;  2BF0 X;  4RG6 A;  5G04 C;  3FUN A;  4G25 A;  3CVN A;  3LVR E;  4MRU A;  2WM9 A;  3IEG A;  4Y6C A;  2WMO A;  3IHY A;  3UMV A;  5A23 A;  2QFC A;  4H7X A;  3FUH A;  4ANX A;  2L0I A;  3PH0 C;  4WNG A;  4EQF A;  2NC9 A;  1E7V A;  2Q7F A;  4J8S A;  5M72 A;  2I1J A;  4ANU A;  3CHM A;  4XIF A;  1E96 B;  5BV0 A;  3Q49 B;  1HS6 A;  3LCA A;  4JC8 A;  3ASD A;  2UWJ G;  4ME2 A;  5JJ6 A;  3ASH A;  3D9P A;  3R7Q A;  2J4D A;  2WQ6 A;  4A1G A;  4HOT A;  3FU0 A;  2HO1 A;  3L22 A;  4EZU A;  4RSY A;  2FF4 A;  1B89 A;  4JZY A;  2WXI A;  4A3V A;  1H6K A;  4JPS A;  3QOU A;  4DI3 A;  3UQ3 A;  1JWG A;  3KD7 A;  3O4Z A;  4Y6W A;  2KHO A;  1ELK A;  4C0M A;  3DPO A;  5FT9 A;  4CDM A;  1INZ A;  4EZW A;  2VTB B;  2PM6 A;  3RK6 A;  3KEZ A;  3MEK A;  3LS8 A;  4I1A A;  5BT1 A;  2CFU A;  3PNL B;  2XGS A;  3D9J A;  3PZD A;  4I6E A;  3VLE A;  3CR3 A;  2WQH A;  3JCK C;  4RVB A;  3QWP A;  1E7U A;  3SNX A;  4HVB A;  3Q4A B;  4MKT A;  3CKC A;  3ZFW A;  2VSY A;  2DCP A;  3D9O A;  4WWN A;  5LOZ A;  5ANL A;  5A6C A;  5JJT A;  2CHW A;  3QAQ A;  1DKX A;  4FP7 A;  3CK7 A;  1NP7 A;  4QFV A;  4GMJ A;  4EZX A;  3D9K A;  5BNW A;  3FH7 A;  4PUC A;  4U63 A;  5C2Y A;  4PH4 B;  1UJJ A;  3FUL A;  3R9A B;  3TXN A;  2BTD A;  4N2Q A;  3L17 A;  3QWV A;  4EPZ A;  3GZ1 A;  4I9E A;  2J07 A;  2AXV A;  3URZ A;  1JPL A;  2V7Y A;  1BPR A;  3D2F A;  1IQU A;  3GZS A;  4J8E A;  3EIQ C;  3PRZ A;  4IYP A;  4KZC A;  4HYB A;  4GA1 A;  4EZJ A;  4V3I A;  2FBN A;  5FQ7 A;  4UQZ A;  3PEV B;  2Y3A A;  1NA3 A;  4J6I A;  2YNQ A;  4URK A;  1HO8 A;  1SZ9 A;  3D9L A;  3I5P A;  2ION A;  3TG5 A;  1HZ4 A;  3N8E A;  2XCB A;  4AP2 A;  3FTY A;  3U9W A;  2WXO A;  5E84 A;  2XQ0 A;  1H2V C;  4XX5 A;  2VQ2 A;  5FTP A;  3OTN A;  4Q96 A;  3T5X A;  4CT0 A;  3FTS A;  3GW4 A;  4G26 A;  1U00 A;  1N52 A;  3ASG A;  4C0E A;  2XRY A;  4FLH A;  3L08 A;  1PAQ A;  3EJN A;  1LF8 A;  4R5K A;  4FU3 A;  1Q5L A;  4CRW A;  4L2Y A;  2LSU A;  3APF A;  3SD5 A;  3PNT B;  2JEK A;  1UJK A;  3FUJ A;  3PEU B;  3K9I A;  4AY6 A;  3P2B A;  2I9C A;  4ANV A;  4F53 A;  1E8Y A;  4CGV A;  2M63 A;  3CHR A;  2J4B A;  4R5J A;  3QC1 A;  3QNK A;  4AJW A;  1JWF A;  3SGH A;  5E76 A;  5CMY A;  2C0L A;  2VGX A;  1OWM A;  2LAI A;  3ML9 A;  3OXG A;  5KJN A;  3I4G A;  2CHZ A;  3CQG B;  1ZU2 A;  2IOL A;  4GCO A;  4XI9 A;  4UWL A;  5G05 J;  1HH8 A;  4UWH A;  4ANW A;  4BT8 A;  3EDT B;  4IRU A;  2X3M A;  3L6A A;  4F1S A;  4U8H A;  3ZW3 A;  3CHS A;  4I43 A;  4EEC A;  4N5C A;  4MQD A;  5BV1 A;  2BPR A;  2OVB A;  2DBA A;  4RG9 A;  3QWW A;  2MHK A;  4U04 A;  3BG0 B;  1SQM A;  1WM5 A;  5ANR A;  4G1T A;  3ZPJ A;  3FEX A;  3ZXS A;  3SFZ A;  3JYS A;  4IUL A;  2IF4 A;  3B13 A;  1VDY A;  3MA5 A;  4APO A;  3L54 A;  1OWL A;  4LCT A;  4JWE A;  3ZYQ A;  3NZS A;  4W9R A;  4GML A;  3G2V A;  2RG8 A;  4EZV A;  2VGX B;  1NA0 A;  2HR2 A;  5ARF A;  4AEZ C;  3WXX A;  2X6J A;  1H19 A;  5FQ4 A;  4CDR A;  7HSC A;  5J90 A;  2LNI A;  3CVL A;  4DPR A;  4HOS A;  3DPD A;  3FTV A;  4P29 A;  4CEM A;  4AY5 A;  1W3B A;  4XI0 A;  3APD A;  4GZ5 A;  1HE8 A;  4ILH B;  3LJ3 A;  4GYY A;  3APC A;  3FU3 A;  3ESL A;  3SI5 A;  4ACK A;  5CMW A;  2XRZ A;  3TAX A;  3AS4 A;  3MYV A;  5G05 C;  1ZBP A;  3FY4 A;  4B8A A;  3LVQ E;  4GZ3 A;  2E2E A;  4TV3 A;  2XEV A;  4L2L A;  3RO3 A;  4ILG A;  3UX4 A;  4A1S A;  1IQR A;  4AVX A;  4KXK B;  3IV0 A;  4AIF A;  4NQ0 A;  1QQE A;  3KS2 A;  3Q5M A;  1Y8M A;  3G2T A;  4HXI A;  3LYA A;  2QXL A;  3QJZ A;  2WXQ A;  4N3A A;  4YND A;  2V8S E;  4O6F A;  4PO2 A;  5D0O D;  1HG5 A;  5FWQ A;  3C7N A;  3FH5 A;  4FC8 A;  3LDZ A;  4XKC A;  4AM9 A;  3L13 A;  2WQ7 A;  2AXU A;  3MJW A;  3QDN A;  2OVF A;  3CVU A;  4ACL A;  3DOB A;  5JHB A;  2Y4U A;  4WND A;  4EBA G;  3C98 A;  4U0S A;  4EZL A;  5ENN A;  2VTB A;  2IQC A;  3FU6 A;  3FTW A;  4R7L A;  2HM8 A;  4BX8 A;  2GRL A;  4XZ4 A;  2IOS A;  2IFU A;  2VSN A;  2YHC A;  3Q15 A;  4IN3 B;  1Y6I A;  4B8C B;  3ZVV A;  1H2U A;  4DK5 A;  2WMN A;  2GW1 A;  4HOU A;  4TUU A;  3OXL A;  2R59 A;  2CG3 A;  4GU5 A;  3RIB A;  4EZR A;  3JUI A;  3P1U A;  5AJL A;  1NZN A;  4D10 C;  1YUW A;  4JHR A;  4DLQ A;  1CKR A;  4BTB A;  5HQ8 A;  3FH8 A;  4EZS A;  2CHX A;  2KCK A;  5EDS A;  4UQY A;  3FWV A;  4EZZ A;  4EZP A;  4WUY A;  2VSO E;  5EX3 A;  4L1B A;  4EZK A;  2FEZ A;  3ZYL A;  3T5V A;  3AS5 A;  2X6K A;  3IKO B;  4UWF A;  3CGH A;  1HXI A;  4OVU A;  4GA0 A;  2R17 C;  2CFZ A;  4BX9 A;  3FEY A;  4UWG A;  2KZT B;  2L0T B;  3B7S A;  4UWK A;  3CKB A;  5A7D B;  5AIJ A;  4JNE A;  3ASF A;  4G2V A;  2J09 A;  4J8D A;  3SF4 A;  4JN4 A;  4F01 A;  3IBE A;  2KC7 A;  3D2E A;  4PS8 A;  2KCL A;  1A17 A;  4FHK A;  3MV2 B;  4R5I A;  2AVP A;  3CVP A;  5C1D A;  3HDX A;  4U0U A;  3NZU A;  4JVS A;  2IU1 A;  3RKV A;  4AOF A;  3FUM A;  3TL5 A;  4BWR A;  1WAO 1;  3CVW A;  3QK0 A;  3DPQ A;  2Y4T A;  4FUL A;  3ZHE B;  3CLJ A;  4NUR A;  3U66 A;  3KAE A;  3CVV A;  4C9B B;  3E4B A;  3MGB A;  4G11 A;  3G2U A;  5CCM A;  1IHG A;  1IYG A;  4LRZ A;  3CK9 A;  4WWO A;  1X5B A;  3U3W A;  2VSX E;  2LAH A;  3RJV A;  2PQR A;  3HHM A;  2YIN A;  3G2S A;  3MV3 B;  2I1K A;  4JEH A;  3B7U X;  1QNF A;  1QZ2 A;  4WNF A;  4GPK A;  5T3R A;  4JHK A;  5HI7 A;  4CT4 A;  3CVY A;  1Z3Y A;  3T8M A;  5AJD A;  3SHF A;  3TXM A;  4JWC A;  3QKY A;  2KCV A;  2OV8 A;  3OAW A;  3FP3 A;  4A3T A;  1XGW A;  3FTX A;  4B89 A;  3Q47 B;  3MKQ A;  1JUQ A;  3ULQ A;  4JW1 A;  1EPU A;  5BUZ A;  4I17 A;  2X6H A;  4XKB A;  4R5G A;  1XNF A;  2L6J A;  1FCH A;  4AV7 A;  3U64 A;  4M3O A;  1DKY A;  3IHV A;  3PUJ A;  3G2W A;  4CDN A;  1DNP A;  4LER A;  1SZA A;  1OUV A;  4LUN U;  3DPP A;  4G23 A;  4ILI A;  5TKY A;  3B7T A;  5G2N A;  4LEU A;  2X6F A;  5E75 A;  5LX8 A;  4I2Z A;  5KJM A;  1TJF A;  2NSZ A;  4BY6 A;  1H2T C;  2OOE A;  2MRI A;  1FVH A;  3CST A;  4JL0 A;  3CHP A;  4XE0 A;  3CIA A;  4JA9 A;  5KCM A;  3SZ7 A;  1U3C A;  2AW6 A;  2X38 A;  3QB2 A;  2YQ8 A;  4GZC A;  3MKQ B;  4E85 A;  3HVE B;  4JXT A;  4A55 A;  2XPY A;  3NF1 A;  2J08 A;  5ARG A;  2XGO A;  3UT8 A;  3FU5 A;  3LXU X;  3VLF A;  1S0P A;  2UY1 B;  2WXG A;  2I2O A;  2LSV A;  3PDN A;  4PDX A;  3UT7 A;  1UW4 B;  3LY7 A;  4F00 A;  3N71 A;  5LFA A;  2VJ8 A;  4JA7 A;  3CHO A;  4GYW A;  4I1O B;  4JWD A;  4FAD A;  3U4T A;  1EF1 C;  4B0Z A;  2WB2 A;  2ZU6 B;  3GYZ A;  3PE4 A;  2LO6 A;  2WXN A;  3LPZ A;  1HG2 A;  1MQS A;  2WXJ A;  3I3N A;  3EIJ A;  4K0R A;  2WXF A;  3DBS A;  2KM4 A;  5AEN A;  3FUE A;  3RRM B;  4I6J A;  4UQX A;  3CSF A;  4KT6 B;  5T4Y A;  3ZEF A;  3OXF A;  3FHE A;  4R5L A;  4FHJ A;  4E6H A;  4PS3 A;  4F7A A;  4I2W A;  4EZN A;  4GAA A;  2OND A;  3NQP A;  2R5S A;  4EZO A;  1H0A A;  2FO7 A;  2WXL A;  4UI9 K;  3O48 A;  4GB9 A;  3VLD A;  4HS2 A;  2BUG A;  1KT1 A;  4MLP A;  4WWP A;  5T8I A;  3FUF A;  3MKR A;  2YHE A;  2MOW A;  2VYI A;  1EYH A;  1KLX A;  4YVO A;  4FJZ A;  4EZT A;  5DIZ A;  4AXH A;  1OWN A;  4KVM A;  3S7B A;  5FZS A;  5G04 J;  3L16 A;  5J08 A;  4J8F A;  1DKZ A;  5AYW D;  2FI7 A;  1N54 A;  2PZI A;  1HFA A;  2WVI A;  4TRQ A;  1TJC A;  2GGF A;  2KZT A;  4FL9 A;  4GA2 A;  3ZYK A;  1ELW A;  3DQG A;  4DLO A;  2WXM A;  3FTZ A;  4B9Q A;  2J49 A;  1YA0 A;  2IJG X;  2VGY A;  3FUI A;  3JQ0 A;  4Q94 A;  1UN9 A;  5KJL A;  5G55 A;  3LY8 A;  4HLE A;  2V4L A;  3ONL A;  2J9Q A;  3RO2 A;  3PUK A;  2AWI A;  3MX3 A;  3PVL A;  1Z6T A;  3RRU A;  4WV5 A;  1OWO A;  3AU5 A;  4OYS A;  2WXK A;  1UG3 A;  3TG4 A;  3CVQ A;  4WNE A;  3CHQ A;  3CVX A;  2JLB A;  1UN8 A;  2WXP A;  2XPZ A;  4N3C A;  5DBK A;  5FQ8 A;  4BSX A;  4H7Y A;  3ZHE A;  3H0X A;  3ZGQ A;  3S7J A;  4JHJ A;  3QAR A;  2AXZ A;  3BG1 B;  3GZ2 A;  3ENE A;  3S7D A;  2XPI A;  4DI4 A;  4E81 A;  4HFG A;  4UI9 J;  5BW8 C;  1U3D A;  3ESK A;  4BFR A;  2X6I A;  4NAC A;  5FZR A;  2GRM A;  3HIZ A;  5BPP A;  2C2L A;  3UUX A;  1GW6 A;  2V5F A;  2KAT A;  1HX8 A;  4N3B A;  4YVQ C;  4B94 A;  4CCA A;  3FUK A;  4WV7 A;  2DIW A;  2RD0 A;  1Z3X A;  2XCC A;  2OP6 A;  3MZL B;  1P5Q A;  4FLB A;  5LCW C;  5LCW J;  1OWP A;  2WPV A;  3JQ1 A;  3UPV A;  3CK8 A;  3HVE A;  1DG4 A;  3AU4 A;  1E8X A;  4U0Z A;  3UT4 A;  4I6G A;  2NXP A;  3ZIM A;  2C0M A;  1ELR A;  4MS6 A;  5FZQ A;  2I6H A;  3ONK A;  1BPO A;  2EQX A;  4NRH B;  4U07 A;  1E8W A;  2FUL A;  3ML8 A;  3RRN B;  1L5J A;  3SBS A;  3ZRH A;  5D0Q D;  1E8Z A;  2PM7 A;  3EHM A;  4I9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...