2OP6A

Peptide-binding domain of heat shock 70 kda protein d precursor from c.elegans
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
ADVNPLTLGIETVGGVMTKLIGRNTVIPTKKSQVFSTAADSQSAVSIVIYEGERPMVMDNHKLGNFDVTGIPPAPRGVPQIEVTFEIDVNGILHVSAEDKGTGNKNKLTITNDHNRLSPEDIERMINDADKFAADDQAQKEKVESRNELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock 70 kDa protein D
publication title X-ray structure of peptide-binding domain of Heat shock 70 kDa protein D precursor from C.elegans
rcsb
source organism Caenorhabditis elegans
molecule tags Peptide binding protein
total genus 38
structure length 150
sequence length 150
ec nomenclature ec 3.6.4.10: Non-chaperonin molecular chaperone ATPase.
pdb deposition date 2007-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 2op6A00
4E81A 4EZPA 1DKZA 4R5LA 3D2FA 4EZUA 4EZOA 1CKRA 4EZWA 2QXLA 4F00A 3DQGA 4F01A 4EZQA 3D2EA 1U00A 3N8EA 4JWIA 4WV7A 4B9QA 4EZNA 4EZTA 1DKXA 4EZZA 1DKYA 2V7YA 4JNEA 4EZVA 7HSCA 1BPRA 3C7NB 4JWCA 3H0XA 3DPQA 4WV5A 1DG4A 3DPOA 3QNJA 4R5GA 1YUWA 5E84A 4R5JA 3C7NA 4HYBA 4R5KA 5TKYA 3DOBA 4EZXA 4EZRA 4PO2A 1Q5LA 4HY9A 4EZYA 2KHOA 4FL9A 4R5IA 4JWDA 4JN4A 4JWEA 2OP6A 2BPRA 4JNFA 4EZSA 3DPPA
chains in the Genus database with same CATH superfamily
4E81A 3ZEFA 4EZPA 1DKZA 4R5LA 3D2FA 3SBSA 4EZUA 4EZOA 4MQDA 4EZWA 1CKRA 2QXLA 4F00A 3DQGA 4F01A 4EZQA 3D2EA 1U00A 3N8EA 4ILIA 4JWIA 4WV7A 4B9QA 4EZNA 1DKXA 4EZTA 1DKYA 2V7YA 4JNEA 4EZVA 4EZZA 4EZSA 1BPRA 3C7NB 4JWCA 3H0XA 3DPQA 4WV5A 7HSCA 1DG4A 3DPOA 3QNJA 3SBTB 4I43A 4R5GA 1YUWA 5E84A 4R5JA 4ILHB 3C7NA 4HYBA 4R5KA 5TKYA 3DOBA 4EZXA 4EZRA 4PO2A 1Q5LA 4HY9A 4EZYA 2KHOA 4FL9A 4R5IA 4JWDA 4JN4A 4JWEA 2OP6A 2BPRA 4JNFA 4ILGA 3DPPA
chains in the Genus database with same CATH topology
4E81A 3ZEFA 4EZPA 1DKZA 4R5LA 3D2FA 3SBSA 4EZUA 4EZOA 4MQDA 4EZWA 1CKRA 2QXLA 4F00A 3DQGA 4F01A 4EZQA 3D2EA 1U00A 3N8EA 4ILIA 4JWIA 4WV7A 4B9QA 4EZNA 1DKXA 4EZTA 1DKYA 2V7YA 4JNEA 4EZVA 4EZZA 4EZSA 1BPRA 3C7NB 4JWCA 3H0XA 3DPQA 4WV5A 7HSCA 1DG4A 3DPOA 3QNJA 3SBTB 4I43A 4R5GA 1YUWA 5E84A 4R5JA 4ILHB 3C7NA 4HYBA 4R5KA 5TKYA 3DOBA 4EZXA 4EZRA 4PO2A 1Q5LA 4HY9A 4EZYA 2KHOA 4FL9A 4R5IA 4JWDA 4JN4A 4JWEA 2OP6A 2BPRA 4JNFA 4ILGA 3DPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E81 A;  4EZP A;  1DKZ A;  4R5L A;  3D2F A;  4EZU A;  4EZO A;  1CKR A;  4EZW A;  2QXL A;  4F00 A;  3DQG A;  4F01 A;  4EZQ A;  3D2E A;  1U00 A;  3N8E A;  4JWI A;  4WV7 A;  4B9Q A;  4EZN A;  4EZT A;  1DKX A;  4EZZ A;  1DKY A;  2V7Y A;  4JNE A;  4EZV A;  7HSC A;  1BPR A;  3C7N B;  4JWC A;  3H0X A;  3DPQ A;  4WV5 A;  1DG4 A;  3DPO A;  3QNJ A;  4R5G A;  1YUW A;  5E84 A;  4R5J A;  3C7N A;  4HYB A;  4R5K A;  5TKY A;  3DOB A;  4EZX A;  4EZR A;  4PO2 A;  1Q5L A;  4HY9 A;  4EZY A;  2KHO A;  4FL9 A;  4R5I A;  4JWD A;  4JN4 A;  4JWE A;  2OP6 A;  2BPR A;  4JNF A;  4EZS A;  3DPP A; 
#chains in the Genus database with same CATH topology
 4E81 A;  3ZEF A;  4EZP A;  1DKZ A;  4R5L A;  3D2F A;  3SBS A;  4EZU A;  4EZO A;  4MQD A;  4EZW A;  1CKR A;  2QXL A;  4F00 A;  3DQG A;  4F01 A;  4EZQ A;  3D2E A;  1U00 A;  3N8E A;  4ILI A;  4JWI A;  4WV7 A;  4B9Q A;  4EZN A;  1DKX A;  4EZT A;  1DKY A;  2V7Y A;  4JNE A;  4EZV A;  4EZZ A;  4EZS A;  1BPR A;  3C7N B;  4JWC A;  3H0X A;  3DPQ A;  4WV5 A;  7HSC A;  1DG4 A;  3DPO A;  3QNJ A;  3SBT B;  4I43 A;  4R5G A;  1YUW A;  5E84 A;  4R5J A;  4ILH B;  3C7N A;  4HYB A;  4R5K A;  5TKY A;  3DOB A;  4EZX A;  4EZR A;  4PO2 A;  1Q5L A;  4HY9 A;  4EZY A;  2KHO A;  4FL9 A;  4R5I A;  4JWD A;  4JN4 A;  4JWE A;  2OP6 A;  2BPR A;  4JNF A;  4ILG A;  3DPP A; 
#chains in the Genus database with same CATH homology
 4E81 A;  3ZEF A;  4EZP A;  1DKZ A;  4R5L A;  3D2F A;  3SBS A;  4EZU A;  4EZO A;  4MQD A;  4EZW A;  1CKR A;  2QXL A;  4F00 A;  3DQG A;  4F01 A;  4EZQ A;  3D2E A;  1U00 A;  3N8E A;  4ILI A;  4JWI A;  4WV7 A;  4B9Q A;  4EZN A;  1DKX A;  4EZT A;  1DKY A;  2V7Y A;  4JNE A;  4EZV A;  4EZZ A;  4EZS A;  1BPR A;  3C7N B;  4JWC A;  3H0X A;  3DPQ A;  4WV5 A;  7HSC A;  1DG4 A;  3DPO A;  3QNJ A;  3SBT B;  4I43 A;  4R5G A;  1YUW A;  5E84 A;  4R5J A;  4ILH B;  3C7N A;  4HYB A;  4R5K A;  5TKY A;  3DOB A;  4EZX A;  4EZR A;  4PO2 A;  1Q5L A;  4HY9 A;  4EZY A;  2KHO A;  4FL9 A;  4R5I A;  4JWD A;  4JN4 A;  4JWE A;  2OP6 A;  2BPR A;  4JNF A;  4ILG A;  3DPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...