4EZOA

Crystal structure of the substrate binding domain of e.coli dnak in complex with pr-39 (residues 1 to 15)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
211
structure length
211
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone/peptide binding protein
molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
total genus 61
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezoA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezoA01
1CKRA 4H6HA 1DG4A 2KHOA 3DPPA 4E81A 5E84A 2OP6A 4JNFA 4EZYA 3T48A 4R5IA 4EZXA 4JWIA 4R5JA 1DKXA 3T47A 4R5GA 1DKYA 4EZOA 4F01A 2V7YA 4JN4A 2QFFA 4EZPA 1BPRA 3C7NB 7HSCA 2WINM 4EZSA 4R5LA 4JWCA 4R5KA 1Q5LA 3DPOA 4HYBA 4H6IA 3QNJA 4EZQA 3C7NA 2BPRA 3DQGA 4EZZA 4EZWA 4F00A 4B9QA 3H0XA 5TKYA 4EZNA 4WV7A 3T49A 4EZRA 3DOBA 3T46A 3D2FA 4EZVA 3N8EA 3D2EA 4JWEA 4FL9A 4WV5A 1DKZA 4PO2A 3T4AG 1U00A 4JNEA 4EZTA 2QXLA 3OHXM 4JWDA 3L3OM 4HY9A 3DPQA 1YUWA 4EZUA
chains in the Genus database with same CATH superfamily
4H6HA 2GAFD 1QWUA 2D4CA 3VEBA 4JWIA 4WPEA 3L3PA 1HWWA 4E3CA 3RV1A 2WINM 3I01A 4IWQA 4EZSA 3O3MB 3H0XA 4UDXX 3CAZA 3D2EA 4FL9A 3G9GA 1GN9A 2Z0OA 2GA9D 4AZCA 1TQVA 2RAIA 4ATMA 2N3KA 3DPQA 3I04A 3ER8C 3CZSA 3KAWA 4JL9A 3HAIA 3T47A 1LQ7A 3QNIA 1YWMA 1I4DA 1SUFA 3DPOA 4EZQA 1R33A 1Y2OA 3EJRA 2Z0VA 3VEAA 1YUWA 2V0OA 1X04A 4JNFA 1ZWWA 4H8SA 4D8JA 1JQKA 4R5KA 4JWCA 3DX0A 2F1AA 3LMFA 2F7OA 4AZGA 2ALWA 3RPMA 3T4AG 3DX2A 2F7QA 3I39X 5C5BB 5E84A 3BVXA 4IWOA 3C7NA 3BVUA 4EZWA 4NSWA 5TKYA 4EZRA 1QX1A 2YIAA 2X3WA 1TQSA 3QE6A 2ELBA 2LM0A 2OP6A 2QKWA 1OAOA 2YI8A 4R5GA 4F01A 4NQIA 1DG4A 3Q84A 3KDRA 2O0I1 4EZTA 4G6QA 2OW6A 2RT6A 3RV0A 3D52A 4EZYA 4AZ7A 3LLLA 3CZNA 3BUDA 2RAKA 3BVVA 3QNJA 1WDZA 3ERCC 4WV7A 2WYHA 3BVWA 1OA0A 3OHXM 4HR1A 3F7WA 3EJPA 3B51X 3BLBA 1O7DB 4M0MA 4EZOA 1DKYA 2OBMA 2MI7A 1UPXA 3EJQA 3PLTA 1GNLA 1TQWA 2QXLA 3BUQA 3ZEFA 3SBTB 2LXYA 2F7RA 4ILIA 4KIKB 3FD9A 1DKXA 2RAJA 3I2WA 3ZEDA 3DX4A 2JNKA 2YLAA 3DDGA 7HSCA 2OO2A 4FZSA 3KAVA 3BUPA 3ABHA 2Q12A 4AZIA 2EFKA 2PY6A 1X03A 2PMRA 3T48A 4EZXA 3D51A 3ACOA 4HYBA 2F18A 4WV5A 4AVMA 4B9QA 4EZNA 3T49A 3D50A 1W9MA 2YLLA 3DYTA 4HY9A 2F7PA 3O3NB 4UDYX 5C5BA 2ZXQA 3OK8A 3D4YA 4EZZA 4IWPA 4JWEA 3Q0KA 3BUIA 1I4TA 3SBSA 2X3VA 3VKHA 1O7DC 4BNEA 4IM2A 4AZ6A 3CKDA 4EZUA 3SOGA 1SU6A 2NCZA 3DX1A 3A98A 2YL9A 3SYVA 4IM0A 1Q5LA 3GI7A 3BUBA 3M3WA 4AZCB 1GNTA 2D1LA 1MJGA 1TQTA 4R5JA 1CKRA 2EX3B 2YI9A 1SU8A 1TQUA 1E2UA 4R5LA 5KBPA 2BPRA 4AZBA 4AZHA 4I1QA 3EJUA 4EZVA 4IW0A 1I49A 3ER9B 4JWDA 4MQDA 2EFLA 2OW7A 2FICA 1E1DA 2KHOA 2F1BA 2EWFA 4AZ5A 3EJSA 2ND0A 1R34A 4DCNC 3HAHA 4EZPA 1BPRA 4ILGA 3B53X 3QWEA 3DOBA 4H6IA 2X5CA 3B52X 1E9VA 4DYLA 3O3OB 2YKTA 2FYVA 2Z0NA 4ILHB 3D4ZA 4KIKA 3OWGA 2YL8A 3C7NB 3LVTA 1PS3A 2C08A 2WYIA 4NPHA 4AKVA 3DQGA 1I4LA 1URUA 3T46A 2YL6A 1ZYLA 3CV5A 1DKZA 2ND1A 1SU7A 4FZOA 4FM3A 4FZPA 2YIBA 3DPPA 3HAJA 4WPCA 4R5IA 3CVRA 2QFFA 3DX3A 4IM3A 3N8EA 2OBLA 5FIGA 4PO2A 2OZNB 4JNEA 1QWNA 3L3OM 3BVTA 3UITA 3EJTA 3DDFA 4E81A 1OA1A 1HTYA 1HXKA 2V7YA 4JLCA 3QA8A 1R5EA 2GF4A 2Q13A 4F00A 2YIVX 2YL5A 3D2FA 2JNSA 2Z8YA 4HR1B 4I43A 2X3XA 1U00A 5FLEX 4JN4A
chains in the Genus database with same CATH topology
2LM0A 2PY6A 1E1DA 4H6HA 2KHOA 2OP6A 2GAFD 2EWFA 3T48A 4EZXA 3VEBA 4JWIA 4E3CA 2ND0A 1OAOA 2YI8A 4R5GA 4F01A 3RV1A 4EZPA 4ILGA 1BPRA 2WINM 3I01A 4IWQA 3B53X 4EZSA 3DOBA 4HYBA 4H6IA 3O3MB 3H0XA 2X5CA 3B52X 4WV5A 1DG4A 1E9VA 4B9QA 4UDXX 4EZNA 3T49A 3D2EA 3O3OB 4FL9A 1GN9A 2GA9D 1W9MA 3KDRA 4EZTA 4G6QA 2N3KA 4HY9A 3DPQA 3I04A 2RT6A 3ER8C 3RV0A 4ILHB 3O3NB 4EZYA 4KIKA 4UDYX 3OWGA 3KAWA 4JL9A 3T47A 3C7NB 4NPHA 1SUFA 3DPOA 4EZQA 3QNJA 3DQGA 3ERCC 4EZZA 4IWPA 4WV7A 1OA0A 3T46A 1ZYLA 4JWEA 1DKZA 2ND1A 3SBSA 3VKHA 3OHXM 4HR1A 3F7WA 4IM2A 3VEAA 1SU7A 1YUWA 4FM3A 4EZUA 2YIBA 3B51X 3DPPA 4JNFA 4R5IA 1SU6A 4M0MA 2NCZA 4D8JA 3A98A 4EZOA 1DKYA 2OBMA 2QFFA 4IM0A 1JQKA 4R5KA 4JWCA 3GI7A 1Q5LA 4IM3A 1UPXA 3LMFA 3N8EA 1GNLA 1GNTA 2OBLA 5FIGA 4PO2A 1MJGA 3T4AG 4JNEA 2QXLA 3ZEFA 3L3OM 3UITA 3SBTB 3I39X 4ILIA 4R5JA 4KIKB 1CKRA 2EX3B 1OA1A 2YI9A 5E84A 4E81A 3FD9A 1SU8A 1DKXA 4IWOA 3ZEDA 2V7YA 4JLCA 7HSCA 1E2UA 3QA8A 4R5LA 3C7NA 2BPRA 4F00A 2YIVX 3KAVA 4EZWA 5TKYA 4EZRA 3D2FA 4EZVA 2JNSA 2Z8YA 2YIAA 4HR1B 4I43A 4IW0A 1U00A 3ER9B 4JWDA 4MQDA 5FLEX 4JN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CKR A;  4H6H A;  1DG4 A;  2KHO A;  3DPP A;  4E81 A;  5E84 A;  2OP6 A;  4JNF A;  4EZY A;  3T48 A;  4R5I A;  4EZX A;  4JWI A;  4R5J A;  1DKX A;  3T47 A;  4R5G A;  1DKY A;  4EZO A;  4F01 A;  2V7Y A;  4JN4 A;  2QFF A;  4EZP A;  1BPR A;  3C7N B;  7HSC A;  2WIN M;  4EZS A;  4R5L A;  4JWC A;  4R5K A;  1Q5L A;  3DPO A;  4HYB A;  4H6I A;  3QNJ A;  4EZQ A;  3C7N A;  2BPR A;  3DQG A;  4EZZ A;  4EZW A;  4F00 A;  4B9Q A;  3H0X A;  5TKY A;  4EZN A;  4WV7 A;  3T49 A;  4EZR A;  3DOB A;  3T46 A;  3D2F A;  4EZV A;  3N8E A;  3D2E A;  4JWE A;  4FL9 A;  4WV5 A;  1DKZ A;  4PO2 A;  3T4A G;  1U00 A;  4JNE A;  4EZT A;  2QXL A;  3OHX M;  4JWD A;  3L3O M;  4HY9 A;  3DPQ A;  1YUW A;  4EZU A; 
#chains in the Genus database with same CATH topology
 4H6H A;  2GAF D;  1QWU A;  2D4C A;  3VEB A;  4JWI A;  4WPE A;  3L3P A;  1HWW A;  4E3C A;  3RV1 A;  2WIN M;  3I01 A;  4IWQ A;  4EZS A;  3O3M B;  3H0X A;  4UDX X;  3CAZ A;  3D2E A;  4FL9 A;  3G9G A;  1GN9 A;  2Z0O A;  2GA9 D;  4AZC A;  1TQV A;  2RAI A;  4ATM A;  2N3K A;  3DPQ A;  3I04 A;  3ER8 C;  3CZS A;  3KAW A;  4JL9 A;  3HAI A;  3T47 A;  1LQ7 A;  3QNI A;  1YWM A;  1I4D A;  1SUF A;  3DPO A;  4EZQ A;  1R33 A;  1Y2O A;  3EJR A;  2Z0V A;  3VEA A;  1YUW A;  2V0O A;  1X04 A;  4JNF A;  1ZWW A;  4H8S A;  4D8J A;  1JQK A;  4R5K A;  4JWC A;  3DX0 A;  2F1A A;  3LMF A;  2F7O A;  4AZG A;  2ALW A;  3RPM A;  3T4A G;  3DX2 A;  2F7Q A;  3I39 X;  5C5B B;  5E84 A;  3BVX A;  4IWO A;  3C7N A;  3BVU A;  4EZW A;  4NSW A;  5TKY A;  4EZR A;  1QX1 A;  2YIA A;  2X3W A;  1TQS A;  3QE6 A;  2ELB A;  2LM0 A;  2OP6 A;  2QKW A;  1OAO A;  2YI8 A;  4R5G A;  4F01 A;  4NQI A;  1DG4 A;  3Q84 A;  3KDR A;  2O0I 1;  4EZT A;  4G6Q A;  2OW6 A;  2RT6 A;  3RV0 A;  3D52 A;  4EZY A;  4AZ7 A;  3LLL A;  3CZN A;  3BUD A;  2RAK A;  3BVV A;  3QNJ A;  1WDZ A;  3ERC C;  4WV7 A;  2WYH A;  3BVW A;  1OA0 A;  3OHX M;  4HR1 A;  3F7W A;  3EJP A;  3B51 X;  3BLB A;  1O7D B;  4M0M A;  4EZO A;  1DKY A;  2OBM A;  2MI7 A;  1UPX A;  3EJQ A;  3PLT A;  1GNL A;  1TQW A;  2QXL A;  3BUQ A;  3ZEF A;  3SBT B;  2LXY A;  2F7R A;  4ILI A;  4KIK B;  3FD9 A;  1DKX A;  2RAJ A;  3I2W A;  3ZED A;  3DX4 A;  2JNK A;  2YLA A;  3DDG A;  7HSC A;  2OO2 A;  4FZS A;  3KAV A;  3BUP A;  3ABH A;  2Q12 A;  4AZI A;  2EFK A;  2PY6 A;  1X03 A;  2PMR A;  3T48 A;  4EZX A;  3D51 A;  3ACO A;  4HYB A;  2F18 A;  4WV5 A;  4AVM A;  4B9Q A;  4EZN A;  3T49 A;  3D50 A;  1W9M A;  2YLL A;  3DYT A;  4HY9 A;  2F7P A;  3O3N B;  4UDY X;  5C5B A;  2ZXQ A;  3OK8 A;  3D4Y A;  4EZZ A;  4IWP A;  4JWE A;  3Q0K A;  3BUI A;  1I4T A;  3SBS A;  2X3V A;  3VKH A;  1O7D C;  4BNE A;  4IM2 A;  4AZ6 A;  3CKD A;  4EZU A;  3SOG A;  1SU6 A;  2NCZ A;  3DX1 A;  3A98 A;  2YL9 A;  3SYV A;  4IM0 A;  1Q5L A;  3GI7 A;  3BUB A;  3M3W A;  4AZC B;  1GNT A;  2D1L A;  1MJG A;  1TQT A;  4R5J A;  1CKR A;  2EX3 B;  2YI9 A;  1SU8 A;  1TQU A;  1E2U A;  4R5L A;  5KBP A;  2BPR A;  4AZB A;  4AZH A;  4I1Q A;  3EJU A;  4EZV A;  4IW0 A;  1I49 A;  3ER9 B;  4JWD A;  4MQD A;  2EFL A;  2OW7 A;  2FIC A;  1E1D A;  2KHO A;  2F1B A;  2EWF A;  4AZ5 A;  3EJS A;  2ND0 A;  1R34 A;  4DCN C;  3HAH A;  4EZP A;  1BPR A;  4ILG A;  3B53 X;  3QWE A;  3DOB A;  4H6I A;  2X5C A;  3B52 X;  1E9V A;  4DYL A;  3O3O B;  2YKT A;  2FYV A;  2Z0N A;  4ILH B;  3D4Z A;  4KIK A;  3OWG A;  2YL8 A;  3C7N B;  3LVT A;  1PS3 A;  2C08 A;  2WYI A;  4NPH A;  4AKV A;  3DQG A;  1I4L A;  1URU A;  3T46 A;  2YL6 A;  1ZYL A;  3CV5 A;  1DKZ A;  2ND1 A;  1SU7 A;  4FZO A;  4FM3 A;  4FZP A;  2YIB A;  3DPP A;  3HAJ A;  4WPC A;  4R5I A;  3CVR A;  2QFF A;  3DX3 A;  4IM3 A;  3N8E A;  2OBL A;  5FIG A;  4PO2 A;  2OZN B;  4JNE A;  1QWN A;  3L3O M;  3BVT A;  3UIT A;  3EJT A;  3DDF A;  4E81 A;  1OA1 A;  1HTY A;  1HXK A;  2V7Y A;  4JLC A;  3QA8 A;  1R5E A;  2GF4 A;  2Q13 A;  4F00 A;  2YIV X;  2YL5 A;  3D2F A;  2JNS A;  2Z8Y A;  4HR1 B;  4I43 A;  2X3X A;  1U00 A;  5FLE X;  4JN4 A; 
#chains in the Genus database with same CATH homology
 2LM0 A;  2PY6 A;  1E1D A;  4H6H A;  2KHO A;  2OP6 A;  2GAF D;  2EWF A;  3T48 A;  4EZX A;  3VEB A;  4JWI A;  4E3C A;  2ND0 A;  1OAO A;  2YI8 A;  4R5G A;  4F01 A;  3RV1 A;  4EZP A;  4ILG A;  1BPR A;  2WIN M;  3I01 A;  4IWQ A;  3B53 X;  4EZS A;  3DOB A;  4HYB A;  4H6I A;  3O3M B;  3H0X A;  2X5C A;  3B52 X;  4WV5 A;  1DG4 A;  1E9V A;  4B9Q A;  4UDX X;  4EZN A;  3T49 A;  3D2E A;  3O3O B;  4FL9 A;  1GN9 A;  2GA9 D;  1W9M A;  3KDR A;  4EZT A;  4G6Q A;  2N3K A;  4HY9 A;  3DPQ A;  3I04 A;  2RT6 A;  3ER8 C;  3RV0 A;  4ILH B;  3O3N B;  4EZY A;  4KIK A;  4UDY X;  3OWG A;  3KAW A;  4JL9 A;  3T47 A;  3C7N B;  4NPH A;  1SUF A;  3DPO A;  4EZQ A;  3QNJ A;  3DQG A;  3ERC C;  4EZZ A;  4IWP A;  4WV7 A;  1OA0 A;  3T46 A;  1ZYL A;  4JWE A;  1DKZ A;  2ND1 A;  3SBS A;  3VKH A;  3OHX M;  4HR1 A;  3F7W A;  4IM2 A;  3VEA A;  1SU7 A;  1YUW A;  4FM3 A;  4EZU A;  2YIB A;  3B51 X;  3DPP A;  4JNF A;  4R5I A;  1SU6 A;  4M0M A;  2NCZ A;  4D8J A;  3A98 A;  4EZO A;  1DKY A;  2OBM A;  2QFF A;  4IM0 A;  1JQK A;  4R5K A;  4JWC A;  3GI7 A;  1Q5L A;  4IM3 A;  1UPX A;  3LMF A;  3N8E A;  1GNL A;  1GNT A;  2OBL A;  5FIG A;  4PO2 A;  1MJG A;  3T4A G;  4JNE A;  2QXL A;  3ZEF A;  3L3O M;  3UIT A;  3SBT B;  3I39 X;  4ILI A;  4R5J A;  4KIK B;  1CKR A;  2EX3 B;  1OA1 A;  2YI9 A;  5E84 A;  4E81 A;  3FD9 A;  1SU8 A;  1DKX A;  4IWO A;  3ZED A;  2V7Y A;  4JLC A;  7HSC A;  1E2U A;  3QA8 A;  4R5L A;  3C7N A;  2BPR A;  4F00 A;  2YIV X;  3KAV A;  4EZW A;  5TKY A;  4EZR A;  3D2F A;  4EZV A;  2JNS A;  2Z8Y A;  2YIA A;  4HR1 B;  4I43 A;  4IW0 A;  1U00 A;  3ER9 B;  4JWD A;  4MQD A;  5FLE X;  4JN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...