4EZOA

Crystal structure of the substrate binding domain of e.coli dnak in complex with pr-39 (residues 1 to 15)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
211
structure length
211
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
total genus 61
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezoA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezoA01
4JWEA 2V7YA 3C7NA 5TKYA 4EZNA 3DOBA 7HSCA 3L3OM 3DQGA 4R5IA 4F00A 4B9QA 3T49A 4F01A 2WINM 4EZVA 4EZXA 4WV5A 2BPRA 4EZSA 4JN4A 3T48A 4R5JA 4E81A 4EZUA 4EZYA 4EZOA 2QXLA 1BPRA 1DG4A 3D2EA 4JWDA 1DKZA 4EZQA 3C7NB 3N8EA 3D2FA 2OP6A 3QNJA 4EZZA 2KHOA 1U00A 3DPOA 4JWIA 3H0XA 4FL9A 3T47A 1DKXA 4EZPA 4JNFA 3T46A 1CKRA 4R5LA 4HYBA 1Q5LA 4R5KA 4PO2A 4JWCA 3T4AG 3DPQA 4H6HA 4EZWA 2QFFA 3DPPA 4R5GA 4EZTA 4EZRA 4WV7A 4HY9A 4H6IA 5E84A 1YUWA 3OHXM 1DKYA 4JNEA
chains in the Genus database with same CATH superfamily
3DX0A 4IM3A 3BLBA 4ILHB 1I4TA 2O0I1 2WINM 3BUIA 1JQKA 2YLLA 3D2EA 4JWDA 2OW6A 4HR1B 4AVMA 3DX3A 2FICA 4R5LA 4JWCA 1I4LA 4EZTA 4AZ6A 1GNTA 2PY6A 3BVVA 3RPMA 2PMRA 1UPXA 3EJUA 4F00A 3HAHA 2Z8YA 3CVRA 3ERCC 1QWUA 1TQVA 1ZWWA 4E81A 2FYVA 3BUBA 2OZNB 4JL9A 3DX2A 3D4YA 3CKDA 1OAOA 4JNFA 3D51A 3EJPA 1E9VA 2X5CA 3Q84A 5E84A 4IWPA 3VKHA 1SU8A 3O3OB 3KAWA 2YL5A 3DQGA 2YI8A 3OWGA 3BUPA 4R5JA 4EZYA 1DG4A 1MJGA 3CZNA 3DDGA 2WYIA 3T47A 2C08A 2QKWA 2Q13A 4IM0A 1PS3A 2YIVX 4DCNC 4HY9A 1DKYA 1HWWA 1Y2OA 3BVTA 2GA9D 4EZUA 1R5EA 3RV1A 1DKXA 3HAJA 2JNKA 3QNIA 3BUDA 4EZRA 3B51X 2GAFD 3OHXM 4WV7A 1LQ7A 4ATMA 1TQTA 1HXKA 4EZSA 2EFKA 2YL8A 5FLEX 3VEBA 4HYBA 2ALWA 2ELBA 4PO2A 2QFFA 3BUQA 2JNSA 2RAJA 3F7WA 4FZPA 2YI9A 2Z0OA 4IWOA 2F7RA 4HR1A 1R33A 4KIKB 2F1BA 1O7DC 1E2UA 3LMFA 4R5GA 1R34A 2MI7A 2OBMA 3DOBA 4I1QA 1GNLA 2YIBA 4NQIA 2X3XA 2F7PA 1SUFA 3EJRA 3QE6A 1Q5LA 1TQUA 2YL9A 2EX3B 2YLAA 3EJQA 2D1LA 3I2WA 4AZCB 1ZYLA 4EZQA 1DKZA 4M0MA 4I43A 5C5BB 4FZSA 3ZEFA 4AZBA 2LXYA 3B52X 2YL6A 2EFLA 4H6IA 4WPCA 3RV0A 4AZIA 3LLLA 1TQSA 7HSCA 3KDRA 4NPHA 2X3VA 2YIAA 1X04A 5KBPA 2OP6A 4EZZA 4AZGA 3EJSA 4UDXX 3D4ZA 3SBSA 1GN9A 1X03A 1I49A 1OA1A 4JWEA 3M3WA 3CAZA 4FZOA 1WDZA 3O3MB 4AZHA 4EZVA 1BPRA 3T48A 3QA8A 3HAIA 4JWIA 3T46A 4H8SA 4MQDA 2YKTA 1I4DA 2Z0NA 2LM0A 4KIKA 4WPEA 4EZNA 5TKYA 3Q0KA 1QX1A 3OK8A 1O7DB 4JN4A 3FD9A 3QNJA 2N3KA 2KHOA 4UDYX 3H0XA 4FL9A 3DPQA 3UITA 1TQWA 3CZSA 4JNEA 2RT6A 3ABHA 3C7NA 3L3OM 4R5IA 4EZXA 3QWEA 3GI7A 3C7NB 3KAVA 4R5KA 4H6HA 2F7OA 4AZCA 3PLTA 2ND1A 2V7YA 3D50A 4BNEA 3T49A 2D4CA 4G6QA 5C5BA 3N8EA 3D2FA 2V0OA 3I04A 3DPOA 1U00A 4EZPA 4E3CA 2RAKA 3ER9B 4IWQA 1YWMA 4DYLA 4FM3A 3I01A 3D52A 2Q12A 3DX4A 3SOGA 2OW7A 4IM2A 4AKVA 4ILIA 2F7QA 3I39X 2NCZA 4AZ7A 4EZOA 2QXLA 1SU6A 3DDFA 4D8JA 2F1AA 3ACOA 2ZXQA 4NSWA 4EZWA 3ZEDA 3DPPA 3G9GA 1YUWA 1E1DA 2OO2A 2Z0VA 4B9QA 4AZ5A 3BVUA 4WV5A 2BPRA 2WYHA 4ILGA 3LVTA 3SBTB 1CKRA 2X3WA 2EWFA 3BVWA 3L3PA 3A98A 5FIGA 3EJTA 4IW0A 2RAIA 1HTYA 3CV5A 3SYVA 3DYTA 2F18A 1SU7A 2GF4A 4F01A 1QWNA 4JLCA 3VEAA 3B53X 3DX1A 1URUA 2ND0A 2OBLA 1OA0A 3ER8C 3T4AG 3O3NB 1W9MA 3BVXA
chains in the Genus database with same CATH topology
2ND1A 2V7YA 7HSCA 4IM3A 3KDRA 4NPHA 4ILHB 3T49A 2YIAA 4G6QA 2WINM 1JQKA 4EZSA 3D2EA 4JWDA 3N8EA 3D2FA 2OP6A 3I04A 4EZZA 3DPOA 1U00A 4HR1B 5FLEX 4E3CA 4EZPA 3ER9B 3VEBA 4R5LA 4HYBA 4IWQA 4PO2A 4UDXX 4JWCA 3SBSA 1GN9A 2QFFA 4FM3A 4EZTA 3I01A 2JNSA 3F7WA 1GNTA 2YI9A 2PY6A 1OA1A 4JWEA 1UPXA 4IWOA 4IM2A 4F00A 3O3MB 4HR1A 2Z8YA 3ERCC 4ILIA 4EZVA 3I39X 2NCZA 1BPRA 4KIKB 3T48A 4E81A 4EZOA 2QXLA 3QA8A 4JL9A 1SU6A 4JWIA 4D8JA 1OAOA 4JNFA 3T46A 1E2UA 4MQDA 3LMFA 1E9VA 4EZWA 2X5CA 3ZEDA 3DPPA 5E84A 4IWPA 1YUWA 4R5GA 1E1DA 3VKHA 2LM0A 1SU8A 3O3OB 2OBMA 4KIKA 3KAWA 4EZNA 5TKYA 3DOBA 3DQGA 1GNLA 2YIBA 2YI8A 4B9QA 3OWGA 4WV5A 2BPRA 4JN4A 4R5JA 4EZYA 1DG4A 4ILGA 1MJGA 3FD9A 3QNJA 2N3KA 1SUFA 2KHOA 4UDYX 3SBTB 3H0XA 4FL9A 3T47A 1CKRA 1Q5LA 4IM0A 2EWFA 3A98A 5FIGA 2YIVX 3DPQA 4IW0A 3UITA 2EX3B 4HY9A 1DKYA 4JNEA 2RT6A 3C7NA 1SU7A 3L3OM 4R5IA 4F01A 4JLCA 4EZXA 3VEAA 2GA9D 3B53X 4EZUA 3GI7A 1ZYLA 4EZQA 1DKZA 3C7NB 4M0MA 3KAVA 3RV1A 4I43A 2ND0A 1DKXA 1OA0A 2OBLA 3ZEFA 3ER8C 4R5KA 3T4AG 4H6HA 3B52X 3O3NB 1W9MA 4EZRA 3B51X 2GAFD 4H6IA 3OHXM 4WV7A 3RV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWE A;  2V7Y A;  3C7N A;  5TKY A;  4EZN A;  3DOB A;  7HSC A;  3L3O M;  3DQG A;  4R5I A;  4F00 A;  4B9Q A;  3T49 A;  4F01 A;  2WIN M;  4EZV A;  4EZX A;  4WV5 A;  2BPR A;  4EZS A;  4JN4 A;  3T48 A;  4R5J A;  4E81 A;  4EZU A;  4EZY A;  4EZO A;  2QXL A;  1BPR A;  1DG4 A;  3D2E A;  4JWD A;  1DKZ A;  4EZQ A;  3C7N B;  3N8E A;  3D2F A;  2OP6 A;  3QNJ A;  4EZZ A;  2KHO A;  1U00 A;  3DPO A;  4JWI A;  3H0X A;  4FL9 A;  3T47 A;  1DKX A;  4EZP A;  4JNF A;  3T46 A;  1CKR A;  4R5L A;  4HYB A;  1Q5L A;  4R5K A;  4PO2 A;  4JWC A;  3T4A G;  3DPQ A;  4H6H A;  4EZW A;  2QFF A;  3DPP A;  4R5G A;  4EZT A;  4EZR A;  4WV7 A;  4HY9 A;  4H6I A;  5E84 A;  1YUW A;  3OHX M;  1DKY A;  4JNE A; 
#chains in the Genus database with same CATH topology
 3DX0 A;  4IM3 A;  3BLB A;  4ILH B;  1I4T A;  2O0I 1;  2WIN M;  3BUI A;  1JQK A;  2YLL A;  3D2E A;  4JWD A;  2OW6 A;  4HR1 B;  4AVM A;  3DX3 A;  2FIC A;  4R5L A;  4JWC A;  1I4L A;  4EZT A;  4AZ6 A;  1GNT A;  2PY6 A;  3BVV A;  3RPM A;  2PMR A;  1UPX A;  3EJU A;  4F00 A;  3HAH A;  2Z8Y A;  3CVR A;  3ERC C;  1QWU A;  1TQV A;  1ZWW A;  4E81 A;  2FYV A;  3BUB A;  2OZN B;  4JL9 A;  3DX2 A;  3D4Y A;  3CKD A;  1OAO A;  4JNF A;  3D51 A;  3EJP A;  1E9V A;  2X5C A;  3Q84 A;  5E84 A;  4IWP A;  3VKH A;  1SU8 A;  3O3O B;  3KAW A;  2YL5 A;  3DQG A;  2YI8 A;  3OWG A;  3BUP A;  4R5J A;  4EZY A;  1DG4 A;  1MJG A;  3CZN A;  3DDG A;  2WYI A;  3T47 A;  2C08 A;  2QKW A;  2Q13 A;  4IM0 A;  1PS3 A;  2YIV X;  4DCN C;  4HY9 A;  1DKY A;  1HWW A;  1Y2O A;  3BVT A;  2GA9 D;  4EZU A;  1R5E A;  3RV1 A;  1DKX A;  3HAJ A;  2JNK A;  3QNI A;  3BUD A;  4EZR A;  3B51 X;  2GAF D;  3OHX M;  4WV7 A;  1LQ7 A;  4ATM A;  1TQT A;  1HXK A;  4EZS A;  2EFK A;  2YL8 A;  5FLE X;  3VEB A;  4HYB A;  2ALW A;  2ELB A;  4PO2 A;  2QFF A;  3BUQ A;  2JNS A;  2RAJ A;  3F7W A;  4FZP A;  2YI9 A;  2Z0O A;  4IWO A;  2F7R A;  4HR1 A;  1R33 A;  4KIK B;  2F1B A;  1O7D C;  1E2U A;  3LMF A;  4R5G A;  1R34 A;  2MI7 A;  2OBM A;  3DOB A;  4I1Q A;  1GNL A;  2YIB A;  4NQI A;  2X3X A;  2F7P A;  1SUF A;  3EJR A;  3QE6 A;  1Q5L A;  1TQU A;  2YL9 A;  2EX3 B;  2YLA A;  3EJQ A;  2D1L A;  3I2W A;  4AZC B;  1ZYL A;  4EZQ A;  1DKZ A;  4M0M A;  4I43 A;  5C5B B;  4FZS A;  3ZEF A;  4AZB A;  2LXY A;  3B52 X;  2YL6 A;  2EFL A;  4H6I A;  4WPC A;  3RV0 A;  4AZI A;  3LLL A;  1TQS A;  7HSC A;  3KDR A;  4NPH A;  2X3V A;  2YIA A;  1X04 A;  5KBP A;  2OP6 A;  4EZZ A;  4AZG A;  3EJS A;  4UDX X;  3D4Z A;  3SBS A;  1GN9 A;  1X03 A;  1I49 A;  1OA1 A;  4JWE A;  3M3W A;  3CAZ A;  4FZO A;  1WDZ A;  3O3M B;  4AZH A;  4EZV A;  1BPR A;  3T48 A;  3QA8 A;  3HAI A;  4JWI A;  3T46 A;  4H8S A;  4MQD A;  2YKT A;  1I4D A;  2Z0N A;  2LM0 A;  4KIK A;  4WPE A;  4EZN A;  5TKY A;  3Q0K A;  1QX1 A;  3OK8 A;  1O7D B;  4JN4 A;  3FD9 A;  3QNJ A;  2N3K A;  2KHO A;  4UDY X;  3H0X A;  4FL9 A;  3DPQ A;  3UIT A;  1TQW A;  3CZS A;  4JNE A;  2RT6 A;  3ABH A;  3C7N A;  3L3O M;  4R5I A;  4EZX A;  3QWE A;  3GI7 A;  3C7N B;  3KAV A;  4R5K A;  4H6H A;  2F7O A;  4AZC A;  3PLT A;  2ND1 A;  2V7Y A;  3D50 A;  4BNE A;  3T49 A;  2D4C A;  4G6Q A;  5C5B A;  3N8E A;  3D2F A;  2V0O A;  3I04 A;  3DPO A;  1U00 A;  4EZP A;  4E3C A;  2RAK A;  3ER9 B;  4IWQ A;  1YWM A;  4DYL A;  4FM3 A;  3I01 A;  3D52 A;  2Q12 A;  3DX4 A;  3SOG A;  2OW7 A;  4IM2 A;  4AKV A;  4ILI A;  2F7Q A;  3I39 X;  2NCZ A;  4AZ7 A;  4EZO A;  2QXL A;  1SU6 A;  3DDF A;  4D8J A;  2F1A A;  3ACO A;  2ZXQ A;  4NSW A;  4EZW A;  3ZED A;  3DPP A;  3G9G A;  1YUW A;  1E1D A;  2OO2 A;  2Z0V A;  4B9Q A;  4AZ5 A;  3BVU A;  4WV5 A;  2BPR A;  2WYH A;  4ILG A;  3LVT A;  3SBT B;  1CKR A;  2X3W A;  2EWF A;  3BVW A;  3L3P A;  3A98 A;  5FIG A;  3EJT A;  4IW0 A;  2RAI A;  1HTY A;  3CV5 A;  3SYV A;  3DYT A;  2F18 A;  1SU7 A;  2GF4 A;  4F01 A;  1QWN A;  4JLC A;  3VEA A;  3B53 X;  3DX1 A;  1URU A;  2ND0 A;  2OBL A;  1OA0 A;  3ER8 C;  3T4A G;  3O3N B;  1W9M A;  3BVX A; 
#chains in the Genus database with same CATH homology
 2ND1 A;  2V7Y A;  7HSC A;  4IM3 A;  3KDR A;  4NPH A;  4ILH B;  3T49 A;  2YIA A;  4G6Q A;  2WIN M;  1JQK A;  4EZS A;  3D2E A;  4JWD A;  3N8E A;  3D2F A;  2OP6 A;  3I04 A;  4EZZ A;  3DPO A;  1U00 A;  4HR1 B;  5FLE X;  4E3C A;  4EZP A;  3ER9 B;  3VEB A;  4R5L A;  4HYB A;  4IWQ A;  4PO2 A;  4UDX X;  4JWC A;  3SBS A;  1GN9 A;  2QFF A;  4FM3 A;  4EZT A;  3I01 A;  2JNS A;  3F7W A;  1GNT A;  2YI9 A;  2PY6 A;  1OA1 A;  4JWE A;  1UPX A;  4IWO A;  4IM2 A;  4F00 A;  3O3M B;  4HR1 A;  2Z8Y A;  3ERC C;  4ILI A;  4EZV A;  3I39 X;  2NCZ A;  1BPR A;  4KIK B;  3T48 A;  4E81 A;  4EZO A;  2QXL A;  3QA8 A;  4JL9 A;  1SU6 A;  4JWI A;  4D8J A;  1OAO A;  4JNF A;  3T46 A;  1E2U A;  4MQD A;  3LMF A;  1E9V A;  4EZW A;  2X5C A;  3ZED A;  3DPP A;  5E84 A;  4IWP A;  1YUW A;  4R5G A;  1E1D A;  3VKH A;  2LM0 A;  1SU8 A;  3O3O B;  2OBM A;  4KIK A;  3KAW A;  4EZN A;  5TKY A;  3DOB A;  3DQG A;  1GNL A;  2YIB A;  2YI8 A;  4B9Q A;  3OWG A;  4WV5 A;  2BPR A;  4JN4 A;  4R5J A;  4EZY A;  1DG4 A;  4ILG A;  1MJG A;  3FD9 A;  3QNJ A;  2N3K A;  1SUF A;  2KHO A;  4UDY X;  3SBT B;  3H0X A;  4FL9 A;  3T47 A;  1CKR A;  1Q5L A;  4IM0 A;  2EWF A;  3A98 A;  5FIG A;  2YIV X;  3DPQ A;  4IW0 A;  3UIT A;  2EX3 B;  4HY9 A;  1DKY A;  4JNE A;  2RT6 A;  3C7N A;  1SU7 A;  3L3O M;  4R5I A;  4F01 A;  4JLC A;  4EZX A;  3VEA A;  2GA9 D;  3B53 X;  4EZU A;  3GI7 A;  1ZYL A;  4EZQ A;  1DKZ A;  3C7N B;  4M0M A;  3KAV A;  3RV1 A;  4I43 A;  2ND0 A;  1DKX A;  1OA0 A;  2OBL A;  3ZEF A;  3ER8 C;  4R5K A;  3T4A G;  4H6H A;  3B52 X;  3O3N B;  1W9M A;  4EZR A;  3B51 X;  2GAF D;  4H6I A;  3OHX M;  4WV7 A;  3RV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...