4EZOA

Crystal structure of the substrate binding domain of e.coli dnak in complex with pr-39 (residues 1 to 15)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
211
structure length
211
Chain Sequence
b'VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
total genus 61
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezoA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezoA01
4HYBA 4JWEA 1DKXA 1Q5LA 2KHOA 4EZWA 4EZOA 4PO2A 4EZSA 3DPPA 3T4AG 4WV5A 3L3OM 4R5KA 4EZYA 3QNJA 4FL9A 4JNEA 4EZUA 4R5GA 2QFFA 3D2FA 3DPOA 3T49A 4F00A 1YUWA 2WINM 3C7NA 1U00A 1DG4A 4EZQA 1BPRA 4EZZA 3T47A 2V7YA 3DOBA 4H6HA 3N8EA 4H6IA 4WV7A 4EZPA 1DKZA 4JNFA 4JN4A 3T48A 3DQGA 3H0XA 4EZVA 2QXLA 4EZXA 2OP6A 1CKRA 7HSCA 5E84A 4EZNA 3C7NB 4R5IA 4B9QA 3DPQA 4JWIA 3D2EA 2BPRA 4JWDA 4R5JA 4F01A 4R5LA 4HY9A 4EZTA 4EZRA 3OHXM 4JWCA 5TKYA 1DKYA 4E81A 3T46A
chains in the Genus database with same CATH superfamily
1X03A 2EWFA 2X5CA 2ZXQA 4EZYA 2ND1A 3EJTA 2RAJA 3I04A 1DKZA 4JN4A 1R33A 2QKWA 3VEAA 5KBPA 4UDYX 1YWMA 4AZCB 2F18A 3A98A 4ILGA 2YIBA 3BVUA 4E81A 4ATMA 2WYIA 4HYBA 4WPCA 4PO2A 3D50A 1JQKA 4IW0A 1U00A 4JL9A 3DOBA 3D4ZA 3UITA 3SBTB 2X3VA 3EJUA 1HWWA 3FD9A 3BVXA 4FL9A 2PMRA 4R5GA 3ZEFA 3T47A 2OW7A 3F7WA 2QXLA 4R5IA 4AZGA 2F1AA 4ILHB 2WYHA 4KIKA 1X04A 3G9GA 3EJRA 2QFFA 3D2FA 3M3WA 1E1DA 4EZQA 3DYTA 4AZCA 2EFKA 2OBMA 2MI7A 3BUPA 3SYVA 2C08A 4R5LA 3CKDA 2GF4A 5TKYA 5C5BA 3LVTA 3KDRA 4EZOA 4EZWA 3BLBA 3SBSA 4FZSA 1YUWA 2YL8A 1R34A 1I49A 1PS3A 2YL5A 1Y2OA 2OP6A 2N3KA 2BPRA 4R5JA 3BUQA 4JLCA 2O0I1 3ABHA 3ACOA 3DPPA 1ZWWA 2GAFD 3BVVA 1TQTA 3DX1A 4HR1A 3DX2A 3BUDA 4EZZA 3KAVA 2RAIA 2PY6A 3RPMA 3D2EA 3DX4A 4F01A 3O3OB 4JWEA 1DKXA 5FLEX 1OA0A 4NSWA 3BUIA 4JNEA 4IM3A 2V7YA 3D52A 1LQ7A 4AVMA 2X3XA 4AZ7A 1OAOA 4FZOA 4EZRA 2F7RA 4AZBA 3CZNA 3DDGA 3B52X 1I4TA 3O3NB 3T4AG 2Q13A 4JNFA 4MQDA 3DDFA 3I01A 1R5EA 1O7DB 4HY9A 1QX1A 4FZPA 3BVTA 1GNLA 4DCNC 1URUA 3QWEA 3RV1A 4AKVA 2OO2A 1I4DA 4WV7A 7HSCA 2ELBA 2F7QA 4JWDA 1I4LA 4E3CA 1ZYLA 4EZTA 3ZEDA 3EJQA 3DX0A 1UPXA 1W9MA 3ER9B 3KAWA 4FM3A 1O7DC 2GA9D 3N8EA 4H6IA 4NPHA 3ERCC 3T48A 4H8SA 4EZXA 3QA8A 4EZNA 2OW6A 2YL9A 2V0OA 2F7PA 4IM2A 3Q84A 4D8JA 4ILIA 1Q5LA 2RAKA 3HAJA 4EZUA 4IWOA 4F00A 3EJSA 3H0XA 1TQVA 2F7OA 2YI9A 3C7NB 4B9QA 3DX3A 4UDXX 2D4CA 4IM0A 3HAIA 4AZ6A 3PLTA 4IWQA 2LXYA 3LLLA 1SU8A 2RT6A 3L3OM 2OBLA 2X3WA 3GI7A 4KIKB 2YLLA 2Z0OA 1TQUA 3Q0KA 3DQGA 1QWNA 2Z0VA 4AZIA 3QE6A 3O3MB 4JWIA 3CV5A 3B51X 3VEBA 1SUFA 3D51A 3OHXM 3OK8A 4WPEA 2JNKA 3CAZA 2KHOA 1SU6A 2F1BA 5C5BB 1E2UA 3SOGA 2D1LA 2WINM 3I39X 3ER8C 1OA1A 2YL6A 4EZVA 5E84A 3EJPA 2JNSA 5FIGA 1TQWA 1HXKA 2ALWA 2FICA 2NCZA 4AZHA 2YKTA 4EZSA 1GNTA 3B53X 3QNIA 3QNJA 4I43A 3DPOA 1E9VA 3VKHA 3C7NA 1BPRA 4IWPA 2Q12A 2YLAA 4HR1B 4NQIA 4EZPA 1CKRA 3RV0A 4I1QA 1SU7A 1QWUA 2EX3B 4WV5A 3I2WA 2Z8YA 3LMFA 4H6HA 3L3PA 2ND0A 4G6QA 2YIAA 2FYVA 3BVWA 3DPQA 1MJGA 2EFLA 3D4YA 1DKYA 4M0MA 3T46A 3CVRA 4AZ5A 1TQSA 4R5KA 4DYLA 3T49A 2LM0A 4BNEA 2Z0NA 3HAHA 1DG4A 1HTYA 1WDZA 1GN9A 2YI8A 2YIVX 4JWCA 3BUBA 3OWGA 2OZNB 3CZSA
chains in the Genus database with same CATH topology
3KDRA 2KHOA 1GNLA 2EWFA 2X5CA 4EZWA 4EZOA 1SU6A 3RV1A 3SBSA 1E2UA 4EZYA 2ND1A 3N8EA 1YUWA 2WINM 3I39X 3ER8C 1OA1A 3I04A 4WV7A 1DKZA 4JN4A 4EZVA 2OP6A 2N3KA 5E84A 7HSCA 2JNSA 3VEAA 4JWDA 2BPRA 4R5JA 4UDYX 4E3CA 5FIGA 1ZYLA 4EZTA 2NCZA 3ZEDA 3A98A 4ILGA 2YIBA 4E81A 4HYBA 4JLCA 4PO2A 4EZSA 1UPXA 1GNTA 1W9MA 3B53X 3DPPA 3ER9B 3KAWA 4IW0A 2GAFD 3QNJA 4FM3A 4I43A 3DPOA 4HR1A 1E9VA 3VKHA 3C7NA 1U00A 1BPRA 4EZZA 2GA9D 3KAVA 4JL9A 4IWPA 3DOBA 4H6IA 4NPHA 4HR1B 4EZPA 3ERCC 3T48A 3UITA 3SBTB 4EZXA 2PY6A 1CKRA 3QA8A 4EZNA 3RV0A 3D2EA 4F01A 1SU7A 3O3OB 4IM2A 2EX3B 4JWEA 4D8JA 4ILIA 1DKXA 1Q5LA 5FLEX 1OA0A 3FD9A 4WV5A 4FL9A 4JNEA 4EZUA 2Z8YA 4IWOA 4R5GA 4F00A 3ZEFA 4IM3A 3LMFA 2V7YA 3T47A 4H6HA 3H0XA 3F7WA 2ND0A 2QXLA 4G6QA 2YIAA 2YI9A 4R5IA 3C7NB 4B9QA 3DPQA 1MJGA 1OAOA 4UDXX 4IM0A 4EZRA 4IWQA 1DKYA 4M0MA 3T46A 1SU8A 3B52X 3O3NB 2RT6A 4ILHB 4KIKA 3T4AG 3L3OM 4R5KA 2OBLA 3T49A 2LM0A 2QFFA 3D2FA 3GI7A 1E1DA 4KIKB 1DG4A 4EZQA 4JNFA 3DQGA 4MQDA 3I01A 2OBMA 3O3MB 1GN9A 2YI8A 2YIVX 4JWIA 3B51X 3VEBA 1SUFA 4R5LA 4HY9A 3OHXM 4JWCA 3OWGA 5TKYA 1JQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HYB A;  4JWE A;  1DKX A;  1Q5L A;  2KHO A;  4EZW A;  4EZO A;  4PO2 A;  4EZS A;  3DPP A;  3T4A G;  4WV5 A;  3L3O M;  4R5K A;  4EZY A;  3QNJ A;  4FL9 A;  4JNE A;  4EZU A;  4R5G A;  2QFF A;  3D2F A;  3DPO A;  3T49 A;  4F00 A;  1YUW A;  2WIN M;  3C7N A;  1U00 A;  1DG4 A;  4EZQ A;  1BPR A;  4EZZ A;  3T47 A;  2V7Y A;  3DOB A;  4H6H A;  3N8E A;  4H6I A;  4WV7 A;  4EZP A;  1DKZ A;  4JNF A;  4JN4 A;  3T48 A;  3DQG A;  3H0X A;  4EZV A;  2QXL A;  4EZX A;  2OP6 A;  1CKR A;  7HSC A;  5E84 A;  4EZN A;  3C7N B;  4R5I A;  4B9Q A;  3DPQ A;  4JWI A;  3D2E A;  2BPR A;  4JWD A;  4R5J A;  4F01 A;  4R5L A;  4HY9 A;  4EZT A;  4EZR A;  3OHX M;  4JWC A;  5TKY A;  1DKY A;  4E81 A;  3T46 A; 
#chains in the Genus database with same CATH topology
 1X03 A;  2EWF A;  2X5C A;  2ZXQ A;  4EZY A;  2ND1 A;  3EJT A;  2RAJ A;  3I04 A;  1DKZ A;  4JN4 A;  1R33 A;  2QKW A;  3VEA A;  5KBP A;  4UDY X;  1YWM A;  4AZC B;  2F18 A;  3A98 A;  4ILG A;  2YIB A;  3BVU A;  4E81 A;  4ATM A;  2WYI A;  4HYB A;  4WPC A;  4PO2 A;  3D50 A;  1JQK A;  4IW0 A;  1U00 A;  4JL9 A;  3DOB A;  3D4Z A;  3UIT A;  3SBT B;  2X3V A;  3EJU A;  1HWW A;  3FD9 A;  3BVX A;  4FL9 A;  2PMR A;  4R5G A;  3ZEF A;  3T47 A;  2OW7 A;  3F7W A;  2QXL A;  4R5I A;  4AZG A;  2F1A A;  4ILH B;  2WYH A;  4KIK A;  1X04 A;  3G9G A;  3EJR A;  2QFF A;  3D2F A;  3M3W A;  1E1D A;  4EZQ A;  3DYT A;  4AZC A;  2EFK A;  2OBM A;  2MI7 A;  3BUP A;  3SYV A;  2C08 A;  4R5L A;  3CKD A;  2GF4 A;  5TKY A;  5C5B A;  3LVT A;  3KDR A;  4EZO A;  4EZW A;  3BLB A;  3SBS A;  4FZS A;  1YUW A;  2YL8 A;  1R34 A;  1I49 A;  1PS3 A;  2YL5 A;  1Y2O A;  2OP6 A;  2N3K A;  2BPR A;  4R5J A;  3BUQ A;  4JLC A;  2O0I 1;  3ABH A;  3ACO A;  3DPP A;  1ZWW A;  2GAF D;  3BVV A;  1TQT A;  3DX1 A;  4HR1 A;  3DX2 A;  3BUD A;  4EZZ A;  3KAV A;  2RAI A;  2PY6 A;  3RPM A;  3D2E A;  3DX4 A;  4F01 A;  3O3O B;  4JWE A;  1DKX A;  5FLE X;  1OA0 A;  4NSW A;  3BUI A;  4JNE A;  4IM3 A;  2V7Y A;  3D52 A;  1LQ7 A;  4AVM A;  2X3X A;  4AZ7 A;  1OAO A;  4FZO A;  4EZR A;  2F7R A;  4AZB A;  3CZN A;  3DDG A;  3B52 X;  1I4T A;  3O3N B;  3T4A G;  2Q13 A;  4JNF A;  4MQD A;  3DDF A;  3I01 A;  1R5E A;  1O7D B;  4HY9 A;  1QX1 A;  4FZP A;  3BVT A;  1GNL A;  4DCN C;  1URU A;  3QWE A;  3RV1 A;  4AKV A;  2OO2 A;  1I4D A;  4WV7 A;  7HSC A;  2ELB A;  2F7Q A;  4JWD A;  1I4L A;  4E3C A;  1ZYL A;  4EZT A;  3ZED A;  3EJQ A;  3DX0 A;  1UPX A;  1W9M A;  3ER9 B;  3KAW A;  4FM3 A;  1O7D C;  2GA9 D;  3N8E A;  4H6I A;  4NPH A;  3ERC C;  3T48 A;  4H8S A;  4EZX A;  3QA8 A;  4EZN A;  2OW6 A;  2YL9 A;  2V0O A;  2F7P A;  4IM2 A;  3Q84 A;  4D8J A;  4ILI A;  1Q5L A;  2RAK A;  3HAJ A;  4EZU A;  4IWO A;  4F00 A;  3EJS A;  3H0X A;  1TQV A;  2F7O A;  2YI9 A;  3C7N B;  4B9Q A;  3DX3 A;  4UDX X;  2D4C A;  4IM0 A;  3HAI A;  4AZ6 A;  3PLT A;  4IWQ A;  2LXY A;  3LLL A;  1SU8 A;  2RT6 A;  3L3O M;  2OBL A;  2X3W A;  3GI7 A;  4KIK B;  2YLL A;  2Z0O A;  1TQU A;  3Q0K A;  3DQG A;  1QWN A;  2Z0V A;  4AZI A;  3QE6 A;  3O3M B;  4JWI A;  3CV5 A;  3B51 X;  3VEB A;  1SUF A;  3D51 A;  3OHX M;  3OK8 A;  4WPE A;  2JNK A;  3CAZ A;  2KHO A;  1SU6 A;  2F1B A;  5C5B B;  1E2U A;  3SOG A;  2D1L A;  2WIN M;  3I39 X;  3ER8 C;  1OA1 A;  2YL6 A;  4EZV A;  5E84 A;  3EJP A;  2JNS A;  5FIG A;  1TQW A;  1HXK A;  2ALW A;  2FIC A;  2NCZ A;  4AZH A;  2YKT A;  4EZS A;  1GNT A;  3B53 X;  3QNI A;  3QNJ A;  4I43 A;  3DPO A;  1E9V A;  3VKH A;  3C7N A;  1BPR A;  4IWP A;  2Q12 A;  2YLA A;  4HR1 B;  4NQI A;  4EZP A;  1CKR A;  3RV0 A;  4I1Q A;  1SU7 A;  1QWU A;  2EX3 B;  4WV5 A;  3I2W A;  2Z8Y A;  3LMF A;  4H6H A;  3L3P A;  2ND0 A;  4G6Q A;  2YIA A;  2FYV A;  3BVW A;  3DPQ A;  1MJG A;  2EFL A;  3D4Y A;  1DKY A;  4M0M A;  3T46 A;  3CVR A;  4AZ5 A;  1TQS A;  4R5K A;  4DYL A;  3T49 A;  2LM0 A;  4BNE A;  2Z0N A;  3HAH A;  1DG4 A;  1HTY A;  1WDZ A;  1GN9 A;  2YI8 A;  2YIV X;  4JWC A;  3BUB A;  3OWG A;  2OZN B;  3CZS A; 
#chains in the Genus database with same CATH homology
 3KDR A;  2KHO A;  1GNL A;  2EWF A;  2X5C A;  4EZW A;  4EZO A;  1SU6 A;  3RV1 A;  3SBS A;  1E2U A;  4EZY A;  2ND1 A;  3N8E A;  1YUW A;  2WIN M;  3I39 X;  3ER8 C;  1OA1 A;  3I04 A;  4WV7 A;  1DKZ A;  4JN4 A;  4EZV A;  2OP6 A;  2N3K A;  5E84 A;  7HSC A;  2JNS A;  3VEA A;  4JWD A;  2BPR A;  4R5J A;  4UDY X;  4E3C A;  5FIG A;  1ZYL A;  4EZT A;  2NCZ A;  3ZED A;  3A98 A;  4ILG A;  2YIB A;  4E81 A;  4HYB A;  4JLC A;  4PO2 A;  4EZS A;  1UPX A;  1GNT A;  1W9M A;  3B53 X;  3DPP A;  3ER9 B;  3KAW A;  4IW0 A;  2GAF D;  3QNJ A;  4FM3 A;  4I43 A;  3DPO A;  4HR1 A;  1E9V A;  3VKH A;  3C7N A;  1U00 A;  1BPR A;  4EZZ A;  2GA9 D;  3KAV A;  4JL9 A;  4IWP A;  3DOB A;  4H6I A;  4NPH A;  4HR1 B;  4EZP A;  3ERC C;  3T48 A;  3UIT A;  3SBT B;  4EZX A;  2PY6 A;  1CKR A;  3QA8 A;  4EZN A;  3RV0 A;  3D2E A;  4F01 A;  1SU7 A;  3O3O B;  4IM2 A;  2EX3 B;  4JWE A;  4D8J A;  4ILI A;  1DKX A;  1Q5L A;  5FLE X;  1OA0 A;  3FD9 A;  4WV5 A;  4FL9 A;  4JNE A;  4EZU A;  2Z8Y A;  4IWO A;  4R5G A;  4F00 A;  3ZEF A;  4IM3 A;  3LMF A;  2V7Y A;  3T47 A;  4H6H A;  3H0X A;  3F7W A;  2ND0 A;  2QXL A;  4G6Q A;  2YIA A;  2YI9 A;  4R5I A;  3C7N B;  4B9Q A;  3DPQ A;  1MJG A;  1OAO A;  4UDX X;  4IM0 A;  4EZR A;  4IWQ A;  1DKY A;  4M0M A;  3T46 A;  1SU8 A;  3B52 X;  3O3N B;  2RT6 A;  4ILH B;  4KIK A;  3T4A G;  3L3O M;  4R5K A;  2OBL A;  3T49 A;  2LM0 A;  2QFF A;  3D2F A;  3GI7 A;  1E1D A;  4KIK B;  1DG4 A;  4EZQ A;  4JNF A;  3DQG A;  4MQD A;  3I01 A;  2OBM A;  3O3M B;  1GN9 A;  2YI8 A;  2YIV X;  4JWI A;  3B51 X;  3VEB A;  1SUF A;  4R5L A;  4HY9 A;  3OHX M;  4JWC A;  3OWG A;  5TKY A;  1JQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...