4EZOA

Crystal structure of the substrate binding domain of e.coli dnak in complex with pr-39 (residues 1 to 15)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
211
structure length
211
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
total genus 61
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezoA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezoA01
3L3OM 4H6HA 2QFFA 1U00A 4E81A 3OHXM 4EZVA 1DKZA 4EZNA 1Q5LA 4EZXA 3N8EA 1CKRA 4EZOA 1BPRA 4R5GA 3DPPA 2V7YA 3D2EA 3DQGA 3T49A 4EZZA 4JWDA 5E84A 4PO2A 3T46A 4JNFA 4EZTA 4H6IA 4FL9A 4HY9A 3D2FA 4JN4A 4F00A 3DPQA 4JWIA 3QNJA 3T48A 2KHOA 4EZYA 4R5LA 4R5IA 2BPRA 4WV5A 4WV7A 2OP6A 3C7NA 4JWEA 3T47A 3T4AG 4EZQA 4EZRA 1DG4A 4F01A 4JWCA 1DKYA 2WINM 4R5KA 3DPOA 3DOBA 4EZWA 4EZSA 3H0XA 1YUWA 7HSCA 5TKYA 4R5JA 4HYBA 4EZUA 4EZPA 4JNEA 3C7NB 4B9QA 2QXLA 1DKXA
chains in the Genus database with same CATH superfamily
2ELBA 1TQVA 3VKHA 1URUA 3OHXM 1Y2OA 3DX2A 2F1BA 1W9MA 3ERCC 3RV1A 4AZIA 4JNFA 4IM2A 4UDXX 1GNLA 4WV5A 1E1DA 3I04A 2FICA 4AKVA 3EJTA 4FM3A 3ACOA 4ATMA 4AZBA 1YUWA 4EZPA 4EZXA 1R34A 3EJUA 4ILIA 1I4TA 2V7YA 2GA9D 5E84A 3D2FA 1YWMA 2X3WA 3QNJA 2YLLA 2WYHA 4WPEA 2RT6A 3DX1A 4EZSA 4IM3A 3O3NB 1TQSA 3DDGA 2NCZA 4IWQA 4M0MA 4IWPA 3EJSA 2RAKA 3B51X 4EZOA 3KAWA 3I2WA 3F7WA 3HAIA 3PLTA 3BUIA 3L3PA 2OO2A 3T48A 4UDYX 4FZOA 4IWOA 3D4ZA 2RAIA 3BLBA 4NSWA 4AZHA 4HYBA 2FYVA 4ILHB 2ZXQA 4H6HA 2QFFA 2OBLA 3ER9B 3N8EA 3LMFA 3CZSA 3QA8A 3T49A 3VEAA 3T46A 4H6IA 3B53X 2YLAA 3M3WA 3CVRA 2EX3B 4F01A 3DX3A 2YL8A 1QWNA 2Z0NA 4DCNC 4BNEA 3BUDA 4IM0A 4I1QA 5KBPA 2YKTA 4I43A 4DYLA 3KAVA 1E2UA 4WV7A 3T4AG 4AZCA 2YIVX 2LXYA 1HWWA 2X3XA 2QXLA 4AZGA 2Q13A 4FZPA 3BVVA 3DDFA 2YIBA 4IW0A 3RV0A 3LLLA 2Z0OA 2D1LA 3EJRA 1X04A 2GF4A 3D4YA 2JNSA 4AZ6A 1Q5LA 4EZVA 2N3KA 3BVXA 4JL9A 1BPRA 1SU8A 3D2EA 4JWDA 1OA1A 3DX0A 2ALWA 3EJPA 5C5BA 2ND1A 2Z0VA 3CV5A 4EZUA 4AZ5A 1HTYA 3Q84A 4E3CA 3BVWA 1MJGA 3BUPA 4R5GA 2O0I1 4PO2A 4NQIA 4ILGA 3QWEA 4KIKB 2YL9A 1GNTA 2OP6A 4FZSA 3C7NA 2PY6A 2OW6A 3UITA 3SOGA 4B9QA 2OZNB 3D52A 3RPMA 3EJQA 4HR1B 3SYVA 2YI8A 3LVTA 3G9GA 1UPXA 1ZWWA 3QE6A 1R5EA 4JN4A 2KHOA 4EZYA 3ZEDA 3Q0KA 3HAJA 3BVUA 4AVMA 2Q12A 2Z8YA 7HSCA 4MQDA 4G6QA 4R5JA 2YL5A 3GI7A 5FIGA 3D50A 4F00A 4R5IA 2BPRA 1DG4A 4AZ7A 3BUBA 1OAOA 3ZEFA 1LQ7A 1SU6A 3OWGA 2F7RA 4WPCA 4EZZA 3SBTB 1SUFA 3FD9A 2JNKA 1I4LA 3CAZA 4R5KA 2YI9A 2F1AA 2OW7A 1I49A 1O7DB 4EZNA 3DPPA 1O7DC 4FL9A 2F7QA 3T47A 2LM0A 1ZYLA 2GAFD 1OA0A 3D51A 3I01A 1QX1A 4JNEA 3L3OM 3O3MB 1PS3A 1E9VA 1U00A 1WDZA 3O3OB 4E81A 1DKZA 1JQKA 2PMRA 2F18A 1SU7A 1TQTA 4HY9A 4JWEA 2WINM 3BVTA 1I4DA 1TQWA 2V0OA 3I39X 1DKXA 3CKDA 4AZCB 2EWFA 2YL6A 3QNIA 3VEBA 4EZQA 4EZRA 4JWCA 1DKYA 2QKWA 3DOBA 4NPHA 3DYTA 5FLEX 1CKRA 1X03A 2F7PA 3B52X 3BUQA 3OK8A 2EFLA 2YIAA 3A98A 1QWUA 4EZTA 2F7OA 4JLCA 2WYIA 2D4CA 2X3VA 4D8JA 1R33A 3KDRA 3ABHA 2EFKA 1TQUA 2RAJA 4H8SA 3DQGA 5C5BB 2X5CA 2MI7A 1GN9A 4KIKA 2C08A 3HAHA 3ER8C 2OBMA 3DPQA 4JWIA 3DX4A 4R5LA 3CZNA 4HR1A 3DPOA 3H0XA 1HXKA 5TKYA 2ND0A 3SBSA 3C7NB 4EZWA
chains in the Genus database with same CATH topology
3L3OM 3O3MB 3VKHA 4HR1B 1E9VA 1U00A 3O3OB 4E81A 2YI8A 3OHXM 1DKZA 4IM0A 1W9MA 3ERCC 3RV1A 1JQKA 1UPXA 4JNFA 1SU7A 4HY9A 4IM2A 4JN4A 4UDXX 4I43A 1GNLA 2KHOA 3KAVA 4EZYA 4WV5A 1E2UA 4WV7A 3ZEDA 1E1DA 3I04A 4JWEA 3T4AG 2WINM 4FM3A 1YUWA 2Z8YA 7HSCA 4MQDA 4G6QA 4R5JA 4EZPA 2YIVX 3I39X 4EZXA 2QXLA 1DKXA 4ILIA 3GI7A 2V7YA 2GA9D 5FIGA 2YIBA 5E84A 4IW0A 2EWFA 3RV0A 3D2FA 4F00A 3QNJA 4R5IA 2BPRA 3VEBA 4EZQA 1DG4A 4EZRA 4JWCA 1DKYA 2RT6A 3DOBA 4EZSA 4IM3A 3O3NB 2NCZA 1OAOA 2JNSA 4NPHA 3ZEFA 4IWQA 4M0MA 5FLEX 1Q5LA 2N3KA 4JL9A 4IWPA 4EZVA 1SU6A 3B51X 3B52X 3OWGA 4EZOA 1CKRA 3KAWA 1BPRA 3F7WA 1SU8A 2YIAA 3D2EA 4EZZA 4JWDA 1OA1A 3A98A 4EZTA 4JLCA 3SBTB 1SUFA 3T48A 3FD9A 4D8JA 3KDRA 4UDYX 4IWOA 2ND1A 4R5KA 2YI9A 4EZUA 4HYBA 3DQGA 4ILHB 4H6HA 2X5CA 2QFFA 4E3CA 2OBLA 1GN9A 4EZNA 3ER9B 3N8EA 1MJGA 3SBSA 3LMFA 4KIKA 4R5GA 3DPPA 3QA8A 3T49A 3ER8C 4PO2A 2OBMA 3VEAA 3T46A 4H6IA 3B53X 4FL9A 4ILGA 4KIKB 3DPQA 4JWIA 4R5LA 1GNTA 2OP6A 3C7NA 3T47A 2LM0A 2EX3B 1ZYLA 2PY6A 4F01A 2GAFD 4HR1A 1OA0A 3I01A 3DPOA 3H0XA 3UITA 5TKYA 2ND0A 4JNEA 3C7NB 4B9QA 4EZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L3O M;  4H6H A;  2QFF A;  1U00 A;  4E81 A;  3OHX M;  4EZV A;  1DKZ A;  4EZN A;  1Q5L A;  4EZX A;  3N8E A;  1CKR A;  4EZO A;  1BPR A;  4R5G A;  3DPP A;  2V7Y A;  3D2E A;  3DQG A;  3T49 A;  4EZZ A;  4JWD A;  5E84 A;  4PO2 A;  3T46 A;  4JNF A;  4EZT A;  4H6I A;  4FL9 A;  4HY9 A;  3D2F A;  4JN4 A;  4F00 A;  3DPQ A;  4JWI A;  3QNJ A;  3T48 A;  2KHO A;  4EZY A;  4R5L A;  4R5I A;  2BPR A;  4WV5 A;  4WV7 A;  2OP6 A;  3C7N A;  4JWE A;  3T47 A;  3T4A G;  4EZQ A;  4EZR A;  1DG4 A;  4F01 A;  4JWC A;  1DKY A;  2WIN M;  4R5K A;  3DPO A;  3DOB A;  4EZW A;  4EZS A;  3H0X A;  1YUW A;  7HSC A;  5TKY A;  4R5J A;  4HYB A;  4EZU A;  4EZP A;  4JNE A;  3C7N B;  4B9Q A;  2QXL A;  1DKX A; 
#chains in the Genus database with same CATH topology
 2ELB A;  1TQV A;  3VKH A;  1URU A;  3OHX M;  1Y2O A;  3DX2 A;  2F1B A;  1W9M A;  3ERC C;  3RV1 A;  4AZI A;  4JNF A;  4IM2 A;  4UDX X;  1GNL A;  4WV5 A;  1E1D A;  3I04 A;  2FIC A;  4AKV A;  3EJT A;  4FM3 A;  3ACO A;  4ATM A;  4AZB A;  1YUW A;  4EZP A;  4EZX A;  1R34 A;  3EJU A;  4ILI A;  1I4T A;  2V7Y A;  2GA9 D;  5E84 A;  3D2F A;  1YWM A;  2X3W A;  3QNJ A;  2YLL A;  2WYH A;  4WPE A;  2RT6 A;  3DX1 A;  4EZS A;  4IM3 A;  3O3N B;  1TQS A;  3DDG A;  2NCZ A;  4IWQ A;  4M0M A;  4IWP A;  3EJS A;  2RAK A;  3B51 X;  4EZO A;  3KAW A;  3I2W A;  3F7W A;  3HAI A;  3PLT A;  3BUI A;  3L3P A;  2OO2 A;  3T48 A;  4UDY X;  4FZO A;  4IWO A;  3D4Z A;  2RAI A;  3BLB A;  4NSW A;  4AZH A;  4HYB A;  2FYV A;  4ILH B;  2ZXQ A;  4H6H A;  2QFF A;  2OBL A;  3ER9 B;  3N8E A;  3LMF A;  3CZS A;  3QA8 A;  3T49 A;  3VEA A;  3T46 A;  4H6I A;  3B53 X;  2YLA A;  3M3W A;  3CVR A;  2EX3 B;  4F01 A;  3DX3 A;  2YL8 A;  1QWN A;  2Z0N A;  4DCN C;  4BNE A;  3BUD A;  4IM0 A;  4I1Q A;  5KBP A;  2YKT A;  4I43 A;  4DYL A;  3KAV A;  1E2U A;  4WV7 A;  3T4A G;  4AZC A;  2YIV X;  2LXY A;  1HWW A;  2X3X A;  2QXL A;  4AZG A;  2Q13 A;  4FZP A;  3BVV A;  3DDF A;  2YIB A;  4IW0 A;  3RV0 A;  3LLL A;  2Z0O A;  2D1L A;  3EJR A;  1X04 A;  2GF4 A;  3D4Y A;  2JNS A;  4AZ6 A;  1Q5L A;  4EZV A;  2N3K A;  3BVX A;  4JL9 A;  1BPR A;  1SU8 A;  3D2E A;  4JWD A;  1OA1 A;  3DX0 A;  2ALW A;  3EJP A;  5C5B A;  2ND1 A;  2Z0V A;  3CV5 A;  4EZU A;  4AZ5 A;  1HTY A;  3Q84 A;  4E3C A;  3BVW A;  1MJG A;  3BUP A;  4R5G A;  2O0I 1;  4PO2 A;  4NQI A;  4ILG A;  3QWE A;  4KIK B;  2YL9 A;  1GNT A;  2OP6 A;  4FZS A;  3C7N A;  2PY6 A;  2OW6 A;  3UIT A;  3SOG A;  4B9Q A;  2OZN B;  3D52 A;  3RPM A;  3EJQ A;  4HR1 B;  3SYV A;  2YI8 A;  3LVT A;  3G9G A;  1UPX A;  1ZWW A;  3QE6 A;  1R5E A;  4JN4 A;  2KHO A;  4EZY A;  3ZED A;  3Q0K A;  3HAJ A;  3BVU A;  4AVM A;  2Q12 A;  2Z8Y A;  7HSC A;  4MQD A;  4G6Q A;  4R5J A;  2YL5 A;  3GI7 A;  5FIG A;  3D50 A;  4F00 A;  4R5I A;  2BPR A;  1DG4 A;  4AZ7 A;  3BUB A;  1OAO A;  3ZEF A;  1LQ7 A;  1SU6 A;  3OWG A;  2F7R A;  4WPC A;  4EZZ A;  3SBT B;  1SUF A;  3FD9 A;  2JNK A;  1I4L A;  3CAZ A;  4R5K A;  2YI9 A;  2F1A A;  2OW7 A;  1I49 A;  1O7D B;  4EZN A;  3DPP A;  1O7D C;  4FL9 A;  2F7Q A;  3T47 A;  2LM0 A;  1ZYL A;  2GAF D;  1OA0 A;  3D51 A;  3I01 A;  1QX1 A;  4JNE A;  3L3O M;  3O3M B;  1PS3 A;  1E9V A;  1U00 A;  1WDZ A;  3O3O B;  4E81 A;  1DKZ A;  1JQK A;  2PMR A;  2F18 A;  1SU7 A;  1TQT A;  4HY9 A;  4JWE A;  2WIN M;  3BVT A;  1I4D A;  1TQW A;  2V0O A;  3I39 X;  1DKX A;  3CKD A;  4AZC B;  2EWF A;  2YL6 A;  3QNI A;  3VEB A;  4EZQ A;  4EZR A;  4JWC A;  1DKY A;  2QKW A;  3DOB A;  4NPH A;  3DYT A;  5FLE X;  1CKR A;  1X03 A;  2F7P A;  3B52 X;  3BUQ A;  3OK8 A;  2EFL A;  2YIA A;  3A98 A;  1QWU A;  4EZT A;  2F7O A;  4JLC A;  2WYI A;  2D4C A;  2X3V A;  4D8J A;  1R33 A;  3KDR A;  3ABH A;  2EFK A;  1TQU A;  2RAJ A;  4H8S A;  3DQG A;  5C5B B;  2X5C A;  2MI7 A;  1GN9 A;  4KIK A;  2C08 A;  3HAH A;  3ER8 C;  2OBM A;  3DPQ A;  4JWI A;  3DX4 A;  4R5L A;  3CZN A;  4HR1 A;  3DPO A;  3H0X A;  1HXK A;  5TKY A;  2ND0 A;  3SBS A;  3C7N B;  4EZW A; 
#chains in the Genus database with same CATH homology
 3L3O M;  3O3M B;  3VKH A;  4HR1 B;  1E9V A;  1U00 A;  3O3O B;  4E81 A;  2YI8 A;  3OHX M;  1DKZ A;  4IM0 A;  1W9M A;  3ERC C;  3RV1 A;  1JQK A;  1UPX A;  4JNF A;  1SU7 A;  4HY9 A;  4IM2 A;  4JN4 A;  4UDX X;  4I43 A;  1GNL A;  2KHO A;  3KAV A;  4EZY A;  4WV5 A;  1E2U A;  4WV7 A;  3ZED A;  1E1D A;  3I04 A;  4JWE A;  3T4A G;  2WIN M;  4FM3 A;  1YUW A;  2Z8Y A;  7HSC A;  4MQD A;  4G6Q A;  4R5J A;  4EZP A;  2YIV X;  3I39 X;  4EZX A;  2QXL A;  1DKX A;  4ILI A;  3GI7 A;  2V7Y A;  2GA9 D;  5FIG A;  2YIB A;  5E84 A;  4IW0 A;  2EWF A;  3RV0 A;  3D2F A;  4F00 A;  3QNJ A;  4R5I A;  2BPR A;  3VEB A;  4EZQ A;  1DG4 A;  4EZR A;  4JWC A;  1DKY A;  2RT6 A;  3DOB A;  4EZS A;  4IM3 A;  3O3N B;  2NCZ A;  1OAO A;  2JNS A;  4NPH A;  3ZEF A;  4IWQ A;  4M0M A;  5FLE X;  1Q5L A;  2N3K A;  4JL9 A;  4IWP A;  4EZV A;  1SU6 A;  3B51 X;  3B52 X;  3OWG A;  4EZO A;  1CKR A;  3KAW A;  1BPR A;  3F7W A;  1SU8 A;  2YIA A;  3D2E A;  4EZZ A;  4JWD A;  1OA1 A;  3A98 A;  4EZT A;  4JLC A;  3SBT B;  1SUF A;  3T48 A;  3FD9 A;  4D8J A;  3KDR A;  4UDY X;  4IWO A;  2ND1 A;  4R5K A;  2YI9 A;  4EZU A;  4HYB A;  3DQG A;  4ILH B;  4H6H A;  2X5C A;  2QFF A;  4E3C A;  2OBL A;  1GN9 A;  4EZN A;  3ER9 B;  3N8E A;  1MJG A;  3SBS A;  3LMF A;  4KIK A;  4R5G A;  3DPP A;  3QA8 A;  3T49 A;  3ER8 C;  4PO2 A;  2OBM A;  3VEA A;  3T46 A;  4H6I A;  3B53 X;  4FL9 A;  4ILG A;  4KIK B;  3DPQ A;  4JWI A;  4R5L A;  1GNT A;  2OP6 A;  3C7N A;  3T47 A;  2LM0 A;  2EX3 B;  1ZYL A;  2PY6 A;  4F01 A;  2GAF D;  4HR1 A;  1OA0 A;  3I01 A;  3DPO A;  3H0X A;  3UIT A;  5TKY A;  2ND0 A;  4JNE A;  3C7N B;  4B9Q A;  4EZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...