4EZOA

Crystal structure of the substrate binding domain of e.coli dnak in complex with pr-39 (residues 1 to 15)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
211
structure length
211
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
molecule keywords Chaperone protein DnaK
total genus 61
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezoA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezoA01
1U00A 1DKXA 5TKYA 3D2FA 2QFFA 1DKYA 2BPRA 4H6IA 2KHOA 4JNFA 4WV7A 1DG4A 4FL9A 4EZWA 3N8EA 3OHXM 2V7YA 4EZPA 3T46A 1YUWA 3DPQA 4EZUA 4R5LA 4HY9A 3T48A 3D2EA 1DKZA 4EZYA 2WINM 4F00A 2OP6A 1Q5LA 4HYBA 3DPPA 4EZNA 4JN4A 4EZOA 3DPOA 3DOBA 4JWCA 4EZVA 4B9QA 4EZRA 4JWDA 7HSCA 4E81A 2QXLA 4EZTA 4R5JA 3L3OM 4JWEA 4R5KA 1CKRA 3C7NA 4R5IA 4JWIA 3T47A 3QNJA 5E84A 4R5GA 4EZZA 3DQGA 4EZXA 4H6HA 3T4AG 4EZQA 1BPRA 3H0XA 4WV5A 4JNEA 3T49A 4EZSA 4PO2A 3C7NB 4F01A
chains in the Genus database with same CATH superfamily
1U00A 2Z0OA 3CKDA 1QWUA 2X5CA 4AZIA 4H6IA 4JNFA 2F7PA 4AZ5A 4IW0A 4JNEA 4WV7A 2F1BA 4JLCA 3I01A 4EZWA 4I43A 1TQTA 1ZWWA 2EWFA 1E9VA 3I39X 3O3OB 3OWGA 2YIBA 2OO2A 4ILHB 4WPCA 2X3XA 3EJRA 4HY9A 3D2EA 4EZYA 2WYIA 2WINM 4NQIA 1SUFA 1OA0A 2YKTA 4NSWA 4EZOA 4AZBA 3D4YA 4EZNA 3ERCC 3DPOA 1E1DA 2X3VA 4IWQA 2YL5A 4B9QA 2N3KA 3BVTA 3D52A 1HTYA 1I4DA 4UDYX 4BNEA 1WDZA 4R5KA 1X04A 2F7QA 5FIGA 3DX3A 2RAIA 3G9GA 4E3CA 2EX3B 3DX4A 4JL9A 3BVUA 4FZPA 1DG4A 3GI7A 1SU6A 2GF4A 2QFFA 2Z8YA 3D2FA 2EFLA 2RAKA 3CZSA 3EJSA 2ND1A 3KAWA 3FD9A 3O3MB 3QNIA 4IM3A 3RPMA 3VEBA 2V7YA 3BUIA 1TQVA 1TQUA 2YI9A 3HAIA 3LLLA 3CV5A 2MI7A 2GAFD 4ILGA 4MQDA 4IWOA 3DYTA 3RV0A 4F00A 4NPHA 3QA8A 3RV1A 1I4LA 4AZ6A 3ZEFA 3DDGA 1QX1A 2JNKA 4EZSA 3DOBA 1E2UA 1PS3A 1R33A 3EJQA 3SBSA 2D4CA 2Z0NA 2ND0A 2YL6A 2JNSA 2YIAA 3BLBA 1OA1A 4JWDA 4DCNC 1GNTA 4E81A 4EZTA 2QKWA 2V0OA 1TQWA 3L3OM 4AVMA 3UITA 3I2WA 2F7RA 4IM0A 3CAZA 1Y2OA 1YWMA 1ZYLA 4EZXA 4H6HA 1MJGA 3BUBA 1R34A 1X03A 3Q84A 3A98A 3H0XA 1W9MA 1HWWA 3T49A 4ATMA 2Q13A 4AZGA 4DYLA 2BPRA 1DKYA 2RT6A 2KHOA 2Z0VA 4AZHA 3CVRA 5KBPA 2ZXQA 3N8EA 3O3NB 3ER9B 2WYHA 2F18A 2ELBA 3HAHA 3DPQA 4G6QA 4EZUA 2YLAA 3D50A 4KIKB 3EJUA 3OK8A 3T48A 3BUPA 3SOGA 3Q0KA 4FZOA 3KAVA 2OP6A 1Q5LA 4UDXX 4IWPA 3KDRA 2F1AA 3ABHA 2F7OA 4JN4A 4D8JA 4JWCA 4EZVA 3BUDA 3HAJA 3I04A 4FZSA 4M0MA 3ZEDA 2YLLA 1URUA 2GA9D 3B51X 4HR1B 2O0I1 1I4TA 2QXLA 3D4ZA 3M3WA 4H8SA 4AKVA 3LVTA 2ALWA 4AZCB 3T47A 3QNJA 5E84A 4EZZA 4KIKA 3B53X 3T4AG 2YL9A 2PMRA 2OZNB 3L3PA 4FM3A 4WPEA 4WV5A 2FYVA 1JQKA 1SU8A 3BVWA 3PLTA 4I1QA 5FLEX 5TKYA 1DKXA 4AZCA 4F01A 1GNLA 2FICA 3BUQA 1O7DC 1SU7A 3D51A 1QWNA 2OBLA 2OW6A 4ILIA 4FL9A 3LMFA 3SYVA 3OHXM 1O7DB 2YL8A 3T46A 4HR1A 4EZPA 3SBTB 1YUWA 3BVXA 3BVVA 2LM0A 2OBMA 1TQSA 4R5LA 3VKHA 1R5EA 1DKZA 3CZNA 2PY6A 3EJTA 4AZ7A 3DX2A 3ACOA 3DDFA 1GN9A 2NCZA 3EJPA 4HYBA 3DPPA 3QWEA 5C5BA 3VEAA 3DX1A 2OW7A 3B52X 4EZRA 1LQ7A 3DX0A 2LXYA 5C5BB 7HSCA 4R5JA 2RAJA 4JWEA 3F7WA 1CKRA 3QE6A 2YIVX 3C7NA 4R5IA 2YI8A 2X3WA 4IM2A 4JWIA 3DQGA 4R5GA 2D1LA 2C08A 3ER8C 1HXKA 4EZQA 1UPXA 2EFKA 1BPRA 1OAOA 2Q12A 4PO2A 3C7NB 1I49A
chains in the Genus database with same CATH topology
1U00A 2X5CA 4WV7A 4H6IA 4JNFA 1DG4A 4IW0A 4JNEA 4EZWA 4JLCA 3I01A 4I43A 2EWFA 1E9VA 3I39X 3O3OB 3OWGA 2YIBA 4ILHB 4HY9A 3D2EA 4EZYA 2WINM 1SUFA 1OA0A 4EZOA 4EZNA 3ERCC 3DPOA 1E1DA 4IWQA 4B9QA 2N3KA 4UDYX 4R5KA 5FIGA 4E3CA 2EX3B 4JL9A 3GI7A 1SU6A 2QFFA 2Z8YA 3D2FA 3O3MB 2ND1A 3KAWA 3FD9A 4IM3A 2V7YA 3VEBA 2YI9A 2GAFD 4ILGA 4IWOA 3RV0A 4F00A 4NPHA 3QA8A 3RV1A 3ZEFA 3DOBA 1E2UA 3SBSA 4JWDA 2ND0A 2YIAA 2JNSA 1OA1A 1GNTA 4E81A 4EZTA 3L3OM 3UITA 4IM0A 1ZYLA 4EZXA 4H6HA 1MJGA 3H0XA 4WV5A 3A98A 1W9MA 3T49A 2BPRA 1DKYA 2RT6A 2KHOA 3N8EA 3O3NB 3ER9B 3DPQA 4G6QA 4EZUA 4KIKB 3T48A 3KAVA 2OP6A 4UDXX 4IWPA 3KDRA 4JN4A 4D8JA 4JWCA 4EZVA 3I04A 4M0MA 3ZEDA 3B51X 2GA9D 4HR1B 2QXLA 3T47A 3QNJA 5E84A 4EZZA 4KIKA 3B53X 3T4AG 4FM3A 5FLEX 1JQKA 1SU8A 4EZSA 4F01A 5TKYA 1DKXA 1Q5LA 1GNLA 1SU7A 2OBLA 4ILIA 4FL9A 3LMFA 3OHXM 4EZPA 3T46A 4HR1A 3SBTB 1YUWA 2LM0A 2OBMA 4R5LA 3VKHA 1DKZA 2PY6A 1GN9A 2NCZA 4HYBA 3DPPA 3VEAA 3B52X 4EZRA 7HSCA 4R5JA 4JWEA 3F7WA 1CKRA 2YIVX 3C7NA 4R5IA 2YI8A 4IM2A 4JWIA 3DQGA 4R5GA 3ER8C 4EZQA 1UPXA 1BPRA 1OAOA 4PO2A 3C7NB 4MQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U00 A;  1DKX A;  5TKY A;  3D2F A;  2QFF A;  1DKY A;  2BPR A;  4H6I A;  2KHO A;  4JNF A;  4WV7 A;  1DG4 A;  4FL9 A;  4EZW A;  3N8E A;  3OHX M;  2V7Y A;  4EZP A;  3T46 A;  1YUW A;  3DPQ A;  4EZU A;  4R5L A;  4HY9 A;  3T48 A;  3D2E A;  1DKZ A;  4EZY A;  2WIN M;  4F00 A;  2OP6 A;  1Q5L A;  4HYB A;  3DPP A;  4EZN A;  4JN4 A;  4EZO A;  3DPO A;  3DOB A;  4JWC A;  4EZV A;  4B9Q A;  4EZR A;  4JWD A;  7HSC A;  4E81 A;  2QXL A;  4EZT A;  4R5J A;  3L3O M;  4JWE A;  4R5K A;  1CKR A;  3C7N A;  4R5I A;  4JWI A;  3T47 A;  3QNJ A;  5E84 A;  4R5G A;  4EZZ A;  3DQG A;  4EZX A;  4H6H A;  3T4A G;  4EZQ A;  1BPR A;  3H0X A;  4WV5 A;  4JNE A;  3T49 A;  4EZS A;  4PO2 A;  3C7N B;  4F01 A; 
#chains in the Genus database with same CATH topology
 1U00 A;  2Z0O A;  3CKD A;  1QWU A;  2X5C A;  4AZI A;  4H6I A;  4JNF A;  2F7P A;  4AZ5 A;  4IW0 A;  4JNE A;  4WV7 A;  2F1B A;  4JLC A;  3I01 A;  4EZW A;  4I43 A;  1TQT A;  1ZWW A;  2EWF A;  1E9V A;  3I39 X;  3O3O B;  3OWG A;  2YIB A;  2OO2 A;  4ILH B;  4WPC A;  2X3X A;  3EJR A;  4HY9 A;  3D2E A;  4EZY A;  2WYI A;  2WIN M;  4NQI A;  1SUF A;  1OA0 A;  2YKT A;  4NSW A;  4EZO A;  4AZB A;  3D4Y A;  4EZN A;  3ERC C;  3DPO A;  1E1D A;  2X3V A;  4IWQ A;  2YL5 A;  4B9Q A;  2N3K A;  3BVT A;  3D52 A;  1HTY A;  1I4D A;  4UDY X;  4BNE A;  1WDZ A;  4R5K A;  1X04 A;  2F7Q A;  5FIG A;  3DX3 A;  2RAI A;  3G9G A;  4E3C A;  2EX3 B;  3DX4 A;  4JL9 A;  3BVU A;  4FZP A;  1DG4 A;  3GI7 A;  1SU6 A;  2GF4 A;  2QFF A;  2Z8Y A;  3D2F A;  2EFL A;  2RAK A;  3CZS A;  3EJS A;  2ND1 A;  3KAW A;  3FD9 A;  3O3M B;  3QNI A;  4IM3 A;  3RPM A;  3VEB A;  2V7Y A;  3BUI A;  1TQV A;  1TQU A;  2YI9 A;  3HAI A;  3LLL A;  3CV5 A;  2MI7 A;  2GAF D;  4ILG A;  4MQD A;  4IWO A;  3DYT A;  3RV0 A;  4F00 A;  4NPH A;  3QA8 A;  3RV1 A;  1I4L A;  4AZ6 A;  3ZEF A;  3DDG A;  1QX1 A;  2JNK A;  4EZS A;  3DOB A;  1E2U A;  1PS3 A;  1R33 A;  3EJQ A;  3SBS A;  2D4C A;  2Z0N A;  2ND0 A;  2YL6 A;  2JNS A;  2YIA A;  3BLB A;  1OA1 A;  4JWD A;  4DCN C;  1GNT A;  4E81 A;  4EZT A;  2QKW A;  2V0O A;  1TQW A;  3L3O M;  4AVM A;  3UIT A;  3I2W A;  2F7R A;  4IM0 A;  3CAZ A;  1Y2O A;  1YWM A;  1ZYL A;  4EZX A;  4H6H A;  1MJG A;  3BUB A;  1R34 A;  1X03 A;  3Q84 A;  3A98 A;  3H0X A;  1W9M A;  1HWW A;  3T49 A;  4ATM A;  2Q13 A;  4AZG A;  4DYL A;  2BPR A;  1DKY A;  2RT6 A;  2KHO A;  2Z0V A;  4AZH A;  3CVR A;  5KBP A;  2ZXQ A;  3N8E A;  3O3N B;  3ER9 B;  2WYH A;  2F18 A;  2ELB A;  3HAH A;  3DPQ A;  4G6Q A;  4EZU A;  2YLA A;  3D50 A;  4KIK B;  3EJU A;  3OK8 A;  3T48 A;  3BUP A;  3SOG A;  3Q0K A;  4FZO A;  3KAV A;  2OP6 A;  1Q5L A;  4UDX X;  4IWP A;  3KDR A;  2F1A A;  3ABH A;  2F7O A;  4JN4 A;  4D8J A;  4JWC A;  4EZV A;  3BUD A;  3HAJ A;  3I04 A;  4FZS A;  4M0M A;  3ZED A;  2YLL A;  1URU A;  2GA9 D;  3B51 X;  4HR1 B;  2O0I 1;  1I4T A;  2QXL A;  3D4Z A;  3M3W A;  4H8S A;  4AKV A;  3LVT A;  2ALW A;  4AZC B;  3T47 A;  3QNJ A;  5E84 A;  4EZZ A;  4KIK A;  3B53 X;  3T4A G;  2YL9 A;  2PMR A;  2OZN B;  3L3P A;  4FM3 A;  4WPE A;  4WV5 A;  2FYV A;  1JQK A;  1SU8 A;  3BVW A;  3PLT A;  4I1Q A;  5FLE X;  5TKY A;  1DKX A;  4AZC A;  4F01 A;  1GNL A;  2FIC A;  3BUQ A;  1O7D C;  1SU7 A;  3D51 A;  1QWN A;  2OBL A;  2OW6 A;  4ILI A;  4FL9 A;  3LMF A;  3SYV A;  3OHX M;  1O7D B;  2YL8 A;  3T46 A;  4HR1 A;  4EZP A;  3SBT B;  1YUW A;  3BVX A;  3BVV A;  2LM0 A;  2OBM A;  1TQS A;  4R5L A;  3VKH A;  1R5E A;  1DKZ A;  3CZN A;  2PY6 A;  3EJT A;  4AZ7 A;  3DX2 A;  3ACO A;  3DDF A;  1GN9 A;  2NCZ A;  3EJP A;  4HYB A;  3DPP A;  3QWE A;  5C5B A;  3VEA A;  3DX1 A;  2OW7 A;  3B52 X;  4EZR A;  1LQ7 A;  3DX0 A;  2LXY A;  5C5B B;  7HSC A;  4R5J A;  2RAJ A;  4JWE A;  3F7W A;  1CKR A;  3QE6 A;  2YIV X;  3C7N A;  4R5I A;  2YI8 A;  2X3W A;  4IM2 A;  4JWI A;  3DQG A;  4R5G A;  2D1L A;  2C08 A;  3ER8 C;  1HXK A;  4EZQ A;  1UPX A;  2EFK A;  1BPR A;  1OAO A;  2Q12 A;  4PO2 A;  3C7N B;  1I49 A; 
#chains in the Genus database with same CATH homology
 1U00 A;  2X5C A;  4WV7 A;  4H6I A;  4JNF A;  1DG4 A;  4IW0 A;  4JNE A;  4EZW A;  4JLC A;  3I01 A;  4I43 A;  2EWF A;  1E9V A;  3I39 X;  3O3O B;  3OWG A;  2YIB A;  4ILH B;  4HY9 A;  3D2E A;  4EZY A;  2WIN M;  1SUF A;  1OA0 A;  4EZO A;  4EZN A;  3ERC C;  3DPO A;  1E1D A;  4IWQ A;  4B9Q A;  2N3K A;  4UDY X;  4R5K A;  5FIG A;  4E3C A;  2EX3 B;  4JL9 A;  3GI7 A;  1SU6 A;  2QFF A;  2Z8Y A;  3D2F A;  3O3M B;  2ND1 A;  3KAW A;  3FD9 A;  4IM3 A;  2V7Y A;  3VEB A;  2YI9 A;  2GAF D;  4ILG A;  4IWO A;  3RV0 A;  4F00 A;  4NPH A;  3QA8 A;  3RV1 A;  3ZEF A;  3DOB A;  1E2U A;  3SBS A;  4JWD A;  2ND0 A;  2YIA A;  2JNS A;  1OA1 A;  1GNT A;  4E81 A;  4EZT A;  3L3O M;  3UIT A;  4IM0 A;  1ZYL A;  4EZX A;  4H6H A;  1MJG A;  3H0X A;  4WV5 A;  3A98 A;  1W9M A;  3T49 A;  2BPR A;  1DKY A;  2RT6 A;  2KHO A;  3N8E A;  3O3N B;  3ER9 B;  3DPQ A;  4G6Q A;  4EZU A;  4KIK B;  3T48 A;  3KAV A;  2OP6 A;  4UDX X;  4IWP A;  3KDR A;  4JN4 A;  4D8J A;  4JWC A;  4EZV A;  3I04 A;  4M0M A;  3ZED A;  3B51 X;  2GA9 D;  4HR1 B;  2QXL A;  3T47 A;  3QNJ A;  5E84 A;  4EZZ A;  4KIK A;  3B53 X;  3T4A G;  4FM3 A;  5FLE X;  1JQK A;  1SU8 A;  4EZS A;  4F01 A;  5TKY A;  1DKX A;  1Q5L A;  1GNL A;  1SU7 A;  2OBL A;  4ILI A;  4FL9 A;  3LMF A;  3OHX M;  4EZP A;  3T46 A;  4HR1 A;  3SBT B;  1YUW A;  2LM0 A;  2OBM A;  4R5L A;  3VKH A;  1DKZ A;  2PY6 A;  1GN9 A;  2NCZ A;  4HYB A;  3DPP A;  3VEA A;  3B52 X;  4EZR A;  7HSC A;  4R5J A;  4JWE A;  3F7W A;  1CKR A;  2YIV X;  3C7N A;  4R5I A;  2YI8 A;  4IM2 A;  4JWI A;  3DQG A;  4R5G A;  3ER8 C;  4EZQ A;  1UPX A;  1BPR A;  1OAO A;  4PO2 A;  3C7N B;  4MQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...