4EZTA

Crystal structure of the substrate binding domain of e.coli dnak in complex with heliocin (residues 14 to 21)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
217
structure length
217
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
total genus 65
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4eztA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4eztA01
3T4AG 1DG4A 4EZTA 3T48A 4JWDA 2OP6A 1BPRA 4H6IA 4E81A 4R5GA 3T47A 3C7NB 4JN4A 4EZZA 4WV7A 2V7YA 5TKYA 2QFFA 4R5JA 4F01A 4EZYA 2QXLA 4EZUA 4JWEA 4WV5A 4FL9A 3D2FA 3T46A 3T49A 1U00A 4EZWA 4PO2A 4EZXA 4B9QA 4JWCA 4EZRA 3DPPA 4R5LA 4EZVA 4EZSA 1DKYA 5E84A 3OHXM 3DQGA 4JNEA 4HYBA 4HY9A 4JNFA 4EZQA 1YUWA 2KHOA 7HSCA 3QNJA 3L3OM 3D2EA 4R5KA 3C7NA 4JWIA 4EZOA 1Q5LA 2BPRA 2WINM 4R5IA 3DOBA 1CKRA 1DKXA 4F00A 3DPQA 3DPOA 3H0XA 4EZPA 1DKZA 4H6HA 4EZNA 3N8EA
chains in the Genus database with same CATH superfamily
3LLLA 1OAOA 3DX3A 3VEAA 4R5JA 4EZYA 2ND0A 2Q12A 2YLLA 1X04A 2Z0VA 4IWPA 2WINM 3ACOA 1YWMA 4AZ5A 2GAFD 4HR1A 5TKYA 1E1DA 2ELBA 3DX0A 3BUDA 3VKHA 4R5LA 2NCZA 3OHXM 3D52A 3SBSA 3L3OM 4R5KA 3Q84A 3EJPA 4JWEA 1WDZA 4IWOA 4JWCA 4WPCA 4AZCA 4NSWA 3LMFA 3QWEA 3RV0A 4JWIA 4AZIA 4AZGA 2YL6A 1DKXA 4AZ7A 4ILHB 3DPQA 3KAWA 3I39X 3DDGA 1OA1A 2WYIA 2EFLA 3BUPA 4AKVA 2V7YA 2F1AA 2OW7A 2ZXQA 4PO2A 3CVRA 5KBPA 4FZSA 4IM3A 2OZNB 4EZOA 3C7NA 3DOBA 2OO2A 3DPOA 3KDRA 4ATMA 1I4LA 1BPRA 5C5BB 3DDFA 4AZ6A 4FZOA 1HTYA 2PY6A 2ALWA 1U00A 3PLTA 1OA0A 5FLEX 3RV1A 1SU7A 5E84A 5FIGA 2MI7A 4H8SA 4WPEA 3KAVA 2FICA 3HAJA 4F00A 3ER9B 4EZTA 1GNLA 3HAHA 4E81A 4AVMA 2Z8YA 3T47A 4WV7A 1SUFA 2YL8A 1R34A 2X3VA 2YKTA 1I49A 4EZVA 1E2UA 3EJQA 3ZEDA 2EFKA 1CKRA 1SU8A 2WYHA 3EJSA 1R33A 4M0MA 4EZPA 3T48A 2F7RA 4JWDA 2OP6A 1TQSA 4IM0A 2OW6A 2OBLA 2YL5A 3I01A 2Z0OA 1PS3A 4EZRA 1W9MA 4EZSA 3CAZA 3ABHA 1LQ7A 3EJTA 4JL9A 3VEBA 4MQDA 4ILGA 4JN4A 2N3KA 2PMRA 4IW0A 2YIBA 3QA8A 3BVWA 1Y2OA 3B53X 1JQKA 3LVTA 3T46A 2RAKA 2GA9D 3SBTB 3O3MB 3BUIA 2EX3B 3BLBA 3FD9A 3QE6A 3I04A 2JNKA 2FYVA 4UDYX 3HAIA 2YI8A 1TQUA 2F7OA 3SOGA 2Z0NA 2YL9A 4EZWA 4EZXA 4HR1B 4AZHA 1SU6A 2RT6A 4JNEA 3D2EA 2RAIA 1E9VA 3CZSA 3F7WA 4H6HA 4EZNA 3T4AG 3BVTA 4DYLA 4FZPA 3M3WA 1TQVA 1UPXA 2YIVX 3EJUA 3T49A 3BVVA 3CV5A 2EWFA 4FM3A 1O7DB 3DQGA 4EZQA 3QNJA 2D4CA 1O7DC 4E3CA 1GNTA 4IM2A 3DX4A 1MJGA 4I1QA 3DYTA 1R5EA 3G9GA 3DX2A 1I4DA 3BVXA 4B9QA 4NQIA 4AZBA 3D51A 2GF4A 7HSCA 3ER8C 1Q5LA 1GN9A 3Q0KA 1DKZA 2Q13A 2F1BA 4HY9A 4NPHA 3C7NB 3BVUA 2LXYA 2QFFA 2X3WA 3L3PA 4KIKB 2V0OA 1YUWA 1ZYLA 3H0XA 2QKWA 1DG4A 1HXKA 1URUA 4H6IA 3D4YA 4EZZA 2OBMA 1QX1A 2X5CA 4IWQA 2QXLA 3D2FA 3OWGA 4ILIA 1X03A 3BUBA 3ZEFA 5C5BA 3B51X 1QWUA 3A98A 2RAJA 4JLCA 4G6QA 1ZWWA 3CKDA 4I43A 4R5GA 2C08A 3O3NB 3GI7A 3SYVA 3OK8A 1QWNA 3BUQA 4EZUA 4WV5A 1TQTA 2D1LA 2JNSA 2LM0A 2KHOA 2O0I1 2F7PA 2YI9A 1TQWA 3D4ZA 3CZNA 3I2WA 3N8EA 4D8JA 4BNEA 3RPMA 2F18A 4FL9A 2X3XA 2ND1A 3UITA 1DKYA 1HWWA 3D50A 3EJRA 4UDXX 3O3OB 4KIKA 4AZCB 1I4TA 4F01A 3B52X 3DX1A 3DPPA 4HYBA 4JNFA 2F7QA 2BPRA 3ERCC 4R5IA 2YLAA 2YIAA 3QNIA 4DCNC
chains in the Genus database with same CATH topology
1DG4A 1BPRA 1OAOA 4H6IA 4UDYX 2YI8A 4EZZA 2OBMA 3VEAA 4R5JA 2X5CA 4IWQA 2PY6A 4EZYA 2QXLA 3D2FA 1U00A 4EZWA 2ND0A 3OWGA 1OA0A 4EZXA 4HR1B 4ILIA 1SU6A 2RT6A 5FLEX 3RV1A 3ZEFA 1SU7A 5E84A 4JNEA 5FIGA 3D2EA 3B51X 4IWPA 3A98A 2WINM 3KAVA 1E9VA 4F00A 4JLCA 4G6QA 3F7WA 3ER9B 4H6HA 4EZNA 3T4AG 4I43A 4EZTA 1GNLA 2GAFD 4E81A 4HR1A 4R5GA 2Z8YA 3T47A 4WV7A 3O3NB 3GI7A 5TKYA 1UPXA 1E1DA 1SUFA 2YIVX 4EZUA 4WV5A 3T49A 2EWFA 4FM3A 4R5LA 4EZVA 1E2UA 2NCZA 3VKHA 3OHXM 3DQGA 2JNSA 2LM0A 4EZQA 3SBSA 2KHOA 3QNJA 3L3OM 4R5KA 3ZEDA 2YI9A 1CKRA 1SU8A 4E3CA 1GNTA 4M0MA 4EZPA 3N8EA 4D8JA 4IM2A 3T48A 4JWDA 2OP6A 1MJGA 4IM0A 2OBLA 4JWEA 3I01A 4FL9A 4IWOA 4B9QA 4JWCA 2ND1A 3UITA 1W9MA 4EZRA 4EZSA 3LMFA 1DKYA 7HSCA 3ER8C 3RV0A 1Q5LA 4JWIA 1GN9A 1DKXA 4ILHB 3DPQA 3KAWA 4JL9A 3VEBA 4MQDA 4UDXX 1DKZA 3O3OB 4HY9A 4KIKA 3I39X 4NPHA 4ILGA 1OA1A 3C7NB 4JN4A 2V7YA 2N3KA 4IW0A 2YIBA 2QFFA 3QA8A 4F01A 3B53X 1JQKA 4KIKB 3T46A 4PO2A 2GA9D 3B52X 3DPPA 3SBTB 3O3MB 4IM3A 4HYBA 4JNFA 1YUWA 1ZYLA 2EX3B 4EZOA 3C7NA 2BPRA 3ERCC 4R5IA 3DOBA 3FD9A 2YIAA 3DPOA 3H0XA 3KDRA 3I04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T4A G;  1DG4 A;  4EZT A;  3T48 A;  4JWD A;  2OP6 A;  1BPR A;  4H6I A;  4E81 A;  4R5G A;  3T47 A;  3C7N B;  4JN4 A;  4EZZ A;  4WV7 A;  2V7Y A;  5TKY A;  2QFF A;  4R5J A;  4F01 A;  4EZY A;  2QXL A;  4EZU A;  4JWE A;  4WV5 A;  4FL9 A;  3D2F A;  3T46 A;  3T49 A;  1U00 A;  4EZW A;  4PO2 A;  4EZX A;  4B9Q A;  4JWC A;  4EZR A;  3DPP A;  4R5L A;  4EZV A;  4EZS A;  1DKY A;  5E84 A;  3OHX M;  3DQG A;  4JNE A;  4HYB A;  4HY9 A;  4JNF A;  4EZQ A;  1YUW A;  2KHO A;  7HSC A;  3QNJ A;  3L3O M;  3D2E A;  4R5K A;  3C7N A;  4JWI A;  4EZO A;  1Q5L A;  2BPR A;  2WIN M;  4R5I A;  3DOB A;  1CKR A;  1DKX A;  4F00 A;  3DPQ A;  3DPO A;  3H0X A;  4EZP A;  1DKZ A;  4H6H A;  4EZN A;  3N8E A; 
#chains in the Genus database with same CATH topology
 3LLL A;  1OAO A;  3DX3 A;  3VEA A;  4R5J A;  4EZY A;  2ND0 A;  2Q12 A;  2YLL A;  1X04 A;  2Z0V A;  4IWP A;  2WIN M;  3ACO A;  1YWM A;  4AZ5 A;  2GAF D;  4HR1 A;  5TKY A;  1E1D A;  2ELB A;  3DX0 A;  3BUD A;  3VKH A;  4R5L A;  2NCZ A;  3OHX M;  3D52 A;  3SBS A;  3L3O M;  4R5K A;  3Q84 A;  3EJP A;  4JWE A;  1WDZ A;  4IWO A;  4JWC A;  4WPC A;  4AZC A;  4NSW A;  3LMF A;  3QWE A;  3RV0 A;  4JWI A;  4AZI A;  4AZG A;  2YL6 A;  1DKX A;  4AZ7 A;  4ILH B;  3DPQ A;  3KAW A;  3I39 X;  3DDG A;  1OA1 A;  2WYI A;  2EFL A;  3BUP A;  4AKV A;  2V7Y A;  2F1A A;  2OW7 A;  2ZXQ A;  4PO2 A;  3CVR A;  5KBP A;  4FZS A;  4IM3 A;  2OZN B;  4EZO A;  3C7N A;  3DOB A;  2OO2 A;  3DPO A;  3KDR A;  4ATM A;  1I4L A;  1BPR A;  5C5B B;  3DDF A;  4AZ6 A;  4FZO A;  1HTY A;  2PY6 A;  2ALW A;  1U00 A;  3PLT A;  1OA0 A;  5FLE X;  3RV1 A;  1SU7 A;  5E84 A;  5FIG A;  2MI7 A;  4H8S A;  4WPE A;  3KAV A;  2FIC A;  3HAJ A;  4F00 A;  3ER9 B;  4EZT A;  1GNL A;  3HAH A;  4E81 A;  4AVM A;  2Z8Y A;  3T47 A;  4WV7 A;  1SUF A;  2YL8 A;  1R34 A;  2X3V A;  2YKT A;  1I49 A;  4EZV A;  1E2U A;  3EJQ A;  3ZED A;  2EFK A;  1CKR A;  1SU8 A;  2WYH A;  3EJS A;  1R33 A;  4M0M A;  4EZP A;  3T48 A;  2F7R A;  4JWD A;  2OP6 A;  1TQS A;  4IM0 A;  2OW6 A;  2OBL A;  2YL5 A;  3I01 A;  2Z0O A;  1PS3 A;  4EZR A;  1W9M A;  4EZS A;  3CAZ A;  3ABH A;  1LQ7 A;  3EJT A;  4JL9 A;  3VEB A;  4MQD A;  4ILG A;  4JN4 A;  2N3K A;  2PMR A;  4IW0 A;  2YIB A;  3QA8 A;  3BVW A;  1Y2O A;  3B53 X;  1JQK A;  3LVT A;  3T46 A;  2RAK A;  2GA9 D;  3SBT B;  3O3M B;  3BUI A;  2EX3 B;  3BLB A;  3FD9 A;  3QE6 A;  3I04 A;  2JNK A;  2FYV A;  4UDY X;  3HAI A;  2YI8 A;  1TQU A;  2F7O A;  3SOG A;  2Z0N A;  2YL9 A;  4EZW A;  4EZX A;  4HR1 B;  4AZH A;  1SU6 A;  2RT6 A;  4JNE A;  3D2E A;  2RAI A;  1E9V A;  3CZS A;  3F7W A;  4H6H A;  4EZN A;  3T4A G;  3BVT A;  4DYL A;  4FZP A;  3M3W A;  1TQV A;  1UPX A;  2YIV X;  3EJU A;  3T49 A;  3BVV A;  3CV5 A;  2EWF A;  4FM3 A;  1O7D B;  3DQG A;  4EZQ A;  3QNJ A;  2D4C A;  1O7D C;  4E3C A;  1GNT A;  4IM2 A;  3DX4 A;  1MJG A;  4I1Q A;  3DYT A;  1R5E A;  3G9G A;  3DX2 A;  1I4D A;  3BVX A;  4B9Q A;  4NQI A;  4AZB A;  3D51 A;  2GF4 A;  7HSC A;  3ER8 C;  1Q5L A;  1GN9 A;  3Q0K A;  1DKZ A;  2Q13 A;  2F1B A;  4HY9 A;  4NPH A;  3C7N B;  3BVU A;  2LXY A;  2QFF A;  2X3W A;  3L3P A;  4KIK B;  2V0O A;  1YUW A;  1ZYL A;  3H0X A;  2QKW A;  1DG4 A;  1HXK A;  1URU A;  4H6I A;  3D4Y A;  4EZZ A;  2OBM A;  1QX1 A;  2X5C A;  4IWQ A;  2QXL A;  3D2F A;  3OWG A;  4ILI A;  1X03 A;  3BUB A;  3ZEF A;  5C5B A;  3B51 X;  1QWU A;  3A98 A;  2RAJ A;  4JLC A;  4G6Q A;  1ZWW A;  3CKD A;  4I43 A;  4R5G A;  2C08 A;  3O3N B;  3GI7 A;  3SYV A;  3OK8 A;  1QWN A;  3BUQ A;  4EZU A;  4WV5 A;  1TQT A;  2D1L A;  2JNS A;  2LM0 A;  2KHO A;  2O0I 1;  2F7P A;  2YI9 A;  1TQW A;  3D4Z A;  3CZN A;  3I2W A;  3N8E A;  4D8J A;  4BNE A;  3RPM A;  2F18 A;  4FL9 A;  2X3X A;  2ND1 A;  3UIT A;  1DKY A;  1HWW A;  3D50 A;  3EJR A;  4UDX X;  3O3O B;  4KIK A;  4AZC B;  1I4T A;  4F01 A;  3B52 X;  3DX1 A;  3DPP A;  4HYB A;  4JNF A;  2F7Q A;  2BPR A;  3ERC C;  4R5I A;  2YLA A;  2YIA A;  3QNI A;  4DCN C; 
#chains in the Genus database with same CATH homology
 1DG4 A;  1BPR A;  1OAO A;  4H6I A;  4UDY X;  2YI8 A;  4EZZ A;  2OBM A;  3VEA A;  4R5J A;  2X5C A;  4IWQ A;  2PY6 A;  4EZY A;  2QXL A;  3D2F A;  1U00 A;  4EZW A;  2ND0 A;  3OWG A;  1OA0 A;  4EZX A;  4HR1 B;  4ILI A;  1SU6 A;  2RT6 A;  5FLE X;  3RV1 A;  3ZEF A;  1SU7 A;  5E84 A;  4JNE A;  5FIG A;  3D2E A;  3B51 X;  4IWP A;  3A98 A;  2WIN M;  3KAV A;  1E9V A;  4F00 A;  4JLC A;  4G6Q A;  3F7W A;  3ER9 B;  4H6H A;  4EZN A;  3T4A G;  4I43 A;  4EZT A;  1GNL A;  2GAF D;  4E81 A;  4HR1 A;  4R5G A;  2Z8Y A;  3T47 A;  4WV7 A;  3O3N B;  3GI7 A;  5TKY A;  1UPX A;  1E1D A;  1SUF A;  2YIV X;  4EZU A;  4WV5 A;  3T49 A;  2EWF A;  4FM3 A;  4R5L A;  4EZV A;  1E2U A;  2NCZ A;  3VKH A;  3OHX M;  3DQG A;  2JNS A;  2LM0 A;  4EZQ A;  3SBS A;  2KHO A;  3QNJ A;  3L3O M;  4R5K A;  3ZED A;  2YI9 A;  1CKR A;  1SU8 A;  4E3C A;  1GNT A;  4M0M A;  4EZP A;  3N8E A;  4D8J A;  4IM2 A;  3T48 A;  4JWD A;  2OP6 A;  1MJG A;  4IM0 A;  2OBL A;  4JWE A;  3I01 A;  4FL9 A;  4IWO A;  4B9Q A;  4JWC A;  2ND1 A;  3UIT A;  1W9M A;  4EZR A;  4EZS A;  3LMF A;  1DKY A;  7HSC A;  3ER8 C;  3RV0 A;  1Q5L A;  4JWI A;  1GN9 A;  1DKX A;  4ILH B;  3DPQ A;  3KAW A;  4JL9 A;  3VEB A;  4MQD A;  4UDX X;  1DKZ A;  3O3O B;  4HY9 A;  4KIK A;  3I39 X;  4NPH A;  4ILG A;  1OA1 A;  3C7N B;  4JN4 A;  2V7Y A;  2N3K A;  4IW0 A;  2YIB A;  2QFF A;  3QA8 A;  4F01 A;  3B53 X;  1JQK A;  4KIK B;  3T46 A;  4PO2 A;  2GA9 D;  3B52 X;  3DPP A;  3SBT B;  3O3M B;  4IM3 A;  4HYB A;  4JNF A;  1YUW A;  1ZYL A;  2EX3 B;  4EZO A;  3C7N A;  2BPR A;  3ERC C;  4R5I A;  3DOB A;  3FD9 A;  2YIA A;  3DPO A;  3H0X A;  3KDR A;  3I04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...