4EZTA

Crystal structure of the substrate binding domain of e.coli dnak in complex with heliocin (residues 14 to 21)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
217
structure length
217
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone/peptide binding protein
molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
total genus 65
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4eztA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4eztA01
4JWDA 2V7YA 4HY9A 1DKXA 3T46A 3DOBA 3T49A 4EZSA 3DQGA 3C7NB 4JN4A 3L3OM 4EZUA 3QNJA 1BPRA 4JNEA 4E81A 4EZYA 3DPPA 4H6IA 4JWIA 4R5KA 4R5GA 4WV5A 4EZOA 4EZPA 4B9QA 4HYBA 3OHXM 1DG4A 1DKYA 3DPQA 4R5LA 3N8EA 5E84A 3D2EA 4F00A 3T4AG 2WINM 1YUWA 1CKRA 4JWEA 4WV7A 5TKYA 3T47A 4PO2A 2OP6A 4JWCA 4EZTA 2BPRA 7HSCA 3C7NA 2KHOA 1DKZA 4EZQA 4EZZA 2QXLA 4F01A 3T48A 4EZWA 2QFFA 4EZNA 4EZXA 4EZVA 3DPOA 4EZRA 3H0XA 3D2FA 4H6HA 4JNFA 1Q5LA 4FL9A 4R5IA 4R5JA 1U00A
chains in the Genus database with same CATH superfamily
3HAHA 4IW0A 4AZIA 3B53X 3EJSA 4JN4A 4H8SA 3I39X 4AZ5A 3VEBA 1W9MA 4AZ6A 1GNTA 1HXKA 3I01A 1DKZA 3B52X 3T48A 4ILHB 2QFFA 3OK8A 2ND1A 1QWUA 4R5IA 2OZNB 4FM3A 1E2UA 2D4CA 3BUPA 2C08A 1OA1A 3QNJA 1X03A 3RV0A 3DX1A 2PY6A 3KAVA 3LMFA 4WV7A 3FD9A 3T47A 2Q13A 2F7RA 2KHOA 3QWEA 4AZBA 3ER8C 3ABHA 2FICA 3QE6A 2MI7A 1E9VA 1TQUA 4EZPA 3KAWA 3HAJA 4UDXX 1CKRA 3QNIA 4WPEA 2OW7A 3LLLA 4F01A 4MQDA 2YI8A 4JL9A 4ILIA 1HWWA 2Z0OA 4IM0A 3SYVA 1I4DA 3M3WA 4AZGA 2F1BA 4ATMA 2O0I1 4AVMA 1MJGA 2ZXQA 4D8JA 3F7WA 1SU7A 2EFKA 1ZYLA 4FL9A 4F00A 4FZSA 3I04A 3CZSA 2GF4A 4AZCA 2LM0A 4R5KA 1ZWWA 4WV5A 5FIGA 1I49A 3DPQA 1PS3A 3DDFA 1HTYA 3D4ZA 1YWMA 3CKDA 3DX0A 4JLCA 3DQGA 2D1LA 4BNEA 3RV1A 1BPRA 3O3OB 4FZOA 1R5EA 4JWEA 3G9GA 2F18A 3LVTA 3O3MB 2OW6A 4EZZA 4EZXA 4ILGA 4H6HA 1SU8A 5C5BA 3QA8A 4G6QA 4IWQA 3GI7A 1JQKA 4R5GA 4EZOA 4HYBA 3BVVA 2N3KA 2F1AA 3UITA 3SBSA 2GA9D 2RAIA 2ELBA 3ZEDA 4EZSA 3Q0KA 2YL5A 4EZYA 1OAOA 4UDYX 5C5BB 2YL9A 4HR1A 2X3WA 1LQ7A 2BPRA 2WYHA 4EZNA 3VKHA 2X5CA 3T46A 2F7OA 5FLEX 3L3OM 3Q84A 3DPPA 3O3NB 3ER9B 4IWPA 1URUA 4NQIA 4M0MA 2Q12A 4JWCA 2JNKA 4AKVA 3CAZA 2YKTA 3DPOA 3SOGA 3H0XA 1Q5LA 3VEAA 1DKXA 3ERCC 4EZUA 3CV5A 2RT6A 3ZEFA 1E1DA 2YL6A 2FYVA 3DDGA 3D4YA 3DX4A 1X04A 4IWOA 7HSCA 3D50A 4EZVA 4EZRA 2F7PA 1I4TA 1YUWA 4R5JA 1WDZA 3EJTA 2JNSA 4DCNC 3D51A 1O7DC 1OA0A 1Y2OA 2RAJA 3PLTA 2YIVX 3SBTB 3I2WA 1I4LA 4AZCB 4AZ7A 2Z0NA 1UPXA 3BLBA 2RAKA 2LXYA 4HY9A 4NPHA 3DOBA 4JNEA 3ACOA 4FZPA 2YI9A 4WPCA 4R5LA 3T4AG 3EJUA 2YLLA 4EZQA 4I1QA 3B51X 2ALWA 3DYTA 1GN9A 3BUDA 4IM2A 4I43A 4H6IA 3EJQA 3D52A 3BVUA 4KIKA 3D2EA 3DX2A 3EJPA 3CZNA 3CVRA 2OBMA 3C7NA 3EJRA 4E3CA 1TQVA 2EWFA 2ND0A 2Z8YA 2X3XA 1GNLA 3BVWA 2Z0VA 3BVTA 1TQTA 1R34A 4IM3A 5TKYA 2OP6A 3OWGA 4EZTA 2WYIA 2QXLA 4KIKB 1O7DB 4JNFA 2YIBA 2EFLA 1U00A 4JWDA 3KDRA 4NSWA 4HR1B 2YL8A 3T49A 2EX3B 3C7NB 3A98A 2X3VA 3BUIA 4DYLA 3L3PA 4JWIA 3HAIA 5E84A 3DX3A 1TQSA 2F7QA 1SU6A 2V0OA 5KBPA 2YIAA 3BVXA 1QX1A 2PMRA 1SUFA 4AZHA 2V7YA 2YLAA 4E81A 2GAFD 1TQWA 2NCZA 4B9QA 3BUBA 2QKWA 3OHXM 1DG4A 1DKYA 3N8EA 3BUQA 2WINM 3RPMA 2OO2A 4PO2A 2OBLA 1QWNA 4EZWA 3D2FA 1R33A
chains in the Genus database with same CATH topology
1GN9A 3I04A 2X5CA 3T46A 4IW0A 3B53X 4IM2A 5FLEX 4I43A 4JN4A 3L3OM 2LM0A 3DPPA 3I39X 4H6IA 4R5KA 4WV5A 5FIGA 3O3NB 3ER9B 3VEBA 1W9MA 4KIKA 4IWPA 3DPQA 1GNTA 3D2EA 4M0MA 3I01A 4JWCA 2OBMA 3C7NA 1DKZA 3B52X 3T48A 4ILHB 2QFFA 4E3CA 3DPOA 3H0XA 2ND1A 1Q5LA 4R5IA 2EWFA 4FM3A 3VEAA 4JLCA 1E2UA 1DKXA 2ND0A 3DQGA 2Z8YA 3ERCC 1OA1A 1GNLA 3RV1A 3QNJA 4EZUA 1BPRA 3O3OB 2RT6A 3ZEFA 1E1DA 3RV0A 2PY6A 3KAVA 3LMFA 4JWEA 4WV7A 3FD9A 4IM3A 5TKYA 3T47A 4IWOA 2OP6A 3OWGA 4EZTA 7HSCA 2KHOA 3O3MB 4EZZA 2QXLA 4EZXA 4ILGA 4KIKB 4EZVA 4EZRA 4H6HA 4JNFA 2YIBA 1YUWA 4R5JA 1U00A 4JWDA 1SU8A 3KDRA 4HR1B 2JNSA 3QA8A 4G6QA 3T49A 3ER8C 2EX3B 3C7NB 3A98A 1OA0A 4IWQA 3GI7A 1JQKA 4JWIA 4R5GA 4EZOA 1E9VA 4EZPA 4HYBA 3KAWA 2N3KA 4UDXX 5E84A 2YIVX 1CKRA 3SBTB 1SU6A 2YIAA 4F01A 4MQDA 2YI8A 4JL9A 1UPXA 4ILIA 3UITA 3SBSA 2GA9D 1SUFA 4IM0A 4HY9A 4NPHA 2V7YA 3ZEDA 3DOBA 4EZSA 4JNEA 4E81A 2GAFD 4EZYA 1OAOA 2YI9A 2NCZA 4B9QA 4UDYX 3OHXM 1DG4A 1DKYA 4R5LA 3N8EA 1MJGA 4HR1A 3T4AG 2WINM 4PO2A 4D8JA 2OBLA 2BPRA 3F7WA 1SU7A 4EZQA 4EZWA 4EZNA 3B51X 3D2FA 1ZYLA 4FL9A 4F00A 3VKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWD A;  2V7Y A;  4HY9 A;  1DKX A;  3T46 A;  3DOB A;  3T49 A;  4EZS A;  3DQG A;  3C7N B;  4JN4 A;  3L3O M;  4EZU A;  3QNJ A;  1BPR A;  4JNE A;  4E81 A;  4EZY A;  3DPP A;  4H6I A;  4JWI A;  4R5K A;  4R5G A;  4WV5 A;  4EZO A;  4EZP A;  4B9Q A;  4HYB A;  3OHX M;  1DG4 A;  1DKY A;  3DPQ A;  4R5L A;  3N8E A;  5E84 A;  3D2E A;  4F00 A;  3T4A G;  2WIN M;  1YUW A;  1CKR A;  4JWE A;  4WV7 A;  5TKY A;  3T47 A;  4PO2 A;  2OP6 A;  4JWC A;  4EZT A;  2BPR A;  7HSC A;  3C7N A;  2KHO A;  1DKZ A;  4EZQ A;  4EZZ A;  2QXL A;  4F01 A;  3T48 A;  4EZW A;  2QFF A;  4EZN A;  4EZX A;  4EZV A;  3DPO A;  4EZR A;  3H0X A;  3D2F A;  4H6H A;  4JNF A;  1Q5L A;  4FL9 A;  4R5I A;  4R5J A;  1U00 A; 
#chains in the Genus database with same CATH topology
 3HAH A;  4IW0 A;  4AZI A;  3B53 X;  3EJS A;  4JN4 A;  4H8S A;  3I39 X;  4AZ5 A;  3VEB A;  1W9M A;  4AZ6 A;  1GNT A;  1HXK A;  3I01 A;  1DKZ A;  3B52 X;  3T48 A;  4ILH B;  2QFF A;  3OK8 A;  2ND1 A;  1QWU A;  4R5I A;  2OZN B;  4FM3 A;  1E2U A;  2D4C A;  3BUP A;  2C08 A;  1OA1 A;  3QNJ A;  1X03 A;  3RV0 A;  3DX1 A;  2PY6 A;  3KAV A;  3LMF A;  4WV7 A;  3FD9 A;  3T47 A;  2Q13 A;  2F7R A;  2KHO A;  3QWE A;  4AZB A;  3ER8 C;  3ABH A;  2FIC A;  3QE6 A;  2MI7 A;  1E9V A;  1TQU A;  4EZP A;  3KAW A;  3HAJ A;  4UDX X;  1CKR A;  3QNI A;  4WPE A;  2OW7 A;  3LLL A;  4F01 A;  4MQD A;  2YI8 A;  4JL9 A;  4ILI A;  1HWW A;  2Z0O A;  4IM0 A;  3SYV A;  1I4D A;  3M3W A;  4AZG A;  2F1B A;  4ATM A;  2O0I 1;  4AVM A;  1MJG A;  2ZXQ A;  4D8J A;  3F7W A;  1SU7 A;  2EFK A;  1ZYL A;  4FL9 A;  4F00 A;  4FZS A;  3I04 A;  3CZS A;  2GF4 A;  4AZC A;  2LM0 A;  4R5K A;  1ZWW A;  4WV5 A;  5FIG A;  1I49 A;  3DPQ A;  1PS3 A;  3DDF A;  1HTY A;  3D4Z A;  1YWM A;  3CKD A;  3DX0 A;  4JLC A;  3DQG A;  2D1L A;  4BNE A;  3RV1 A;  1BPR A;  3O3O B;  4FZO A;  1R5E A;  4JWE A;  3G9G A;  2F18 A;  3LVT A;  3O3M B;  2OW6 A;  4EZZ A;  4EZX A;  4ILG A;  4H6H A;  1SU8 A;  5C5B A;  3QA8 A;  4G6Q A;  4IWQ A;  3GI7 A;  1JQK A;  4R5G A;  4EZO A;  4HYB A;  3BVV A;  2N3K A;  2F1A A;  3UIT A;  3SBS A;  2GA9 D;  2RAI A;  2ELB A;  3ZED A;  4EZS A;  3Q0K A;  2YL5 A;  4EZY A;  1OAO A;  4UDY X;  5C5B B;  2YL9 A;  4HR1 A;  2X3W A;  1LQ7 A;  2BPR A;  2WYH A;  4EZN A;  3VKH A;  2X5C A;  3T46 A;  2F7O A;  5FLE X;  3L3O M;  3Q84 A;  3DPP A;  3O3N B;  3ER9 B;  4IWP A;  1URU A;  4NQI A;  4M0M A;  2Q12 A;  4JWC A;  2JNK A;  4AKV A;  3CAZ A;  2YKT A;  3DPO A;  3SOG A;  3H0X A;  1Q5L A;  3VEA A;  1DKX A;  3ERC C;  4EZU A;  3CV5 A;  2RT6 A;  3ZEF A;  1E1D A;  2YL6 A;  2FYV A;  3DDG A;  3D4Y A;  3DX4 A;  1X04 A;  4IWO A;  7HSC A;  3D50 A;  4EZV A;  4EZR A;  2F7P A;  1I4T A;  1YUW A;  4R5J A;  1WDZ A;  3EJT A;  2JNS A;  4DCN C;  3D51 A;  1O7D C;  1OA0 A;  1Y2O A;  2RAJ A;  3PLT A;  2YIV X;  3SBT B;  3I2W A;  1I4L A;  4AZC B;  4AZ7 A;  2Z0N A;  1UPX A;  3BLB A;  2RAK A;  2LXY A;  4HY9 A;  4NPH A;  3DOB A;  4JNE A;  3ACO A;  4FZP A;  2YI9 A;  4WPC A;  4R5L A;  3T4A G;  3EJU A;  2YLL A;  4EZQ A;  4I1Q A;  3B51 X;  2ALW A;  3DYT A;  1GN9 A;  3BUD A;  4IM2 A;  4I43 A;  4H6I A;  3EJQ A;  3D52 A;  3BVU A;  4KIK A;  3D2E A;  3DX2 A;  3EJP A;  3CZN A;  3CVR A;  2OBM A;  3C7N A;  3EJR A;  4E3C A;  1TQV A;  2EWF A;  2ND0 A;  2Z8Y A;  2X3X A;  1GNL A;  3BVW A;  2Z0V A;  3BVT A;  1TQT A;  1R34 A;  4IM3 A;  5TKY A;  2OP6 A;  3OWG A;  4EZT A;  2WYI A;  2QXL A;  4KIK B;  1O7D B;  4JNF A;  2YIB A;  2EFL A;  1U00 A;  4JWD A;  3KDR A;  4NSW A;  4HR1 B;  2YL8 A;  3T49 A;  2EX3 B;  3C7N B;  3A98 A;  2X3V A;  3BUI A;  4DYL A;  3L3P A;  4JWI A;  3HAI A;  5E84 A;  3DX3 A;  1TQS A;  2F7Q A;  1SU6 A;  2V0O A;  5KBP A;  2YIA A;  3BVX A;  1QX1 A;  2PMR A;  1SUF A;  4AZH A;  2V7Y A;  2YLA A;  4E81 A;  2GAF D;  1TQW A;  2NCZ A;  4B9Q A;  3BUB A;  2QKW A;  3OHX M;  1DG4 A;  1DKY A;  3N8E A;  3BUQ A;  2WIN M;  3RPM A;  2OO2 A;  4PO2 A;  2OBL A;  1QWN A;  4EZW A;  3D2F A;  1R33 A; 
#chains in the Genus database with same CATH homology
 1GN9 A;  3I04 A;  2X5C A;  3T46 A;  4IW0 A;  3B53 X;  4IM2 A;  5FLE X;  4I43 A;  4JN4 A;  3L3O M;  2LM0 A;  3DPP A;  3I39 X;  4H6I A;  4R5K A;  4WV5 A;  5FIG A;  3O3N B;  3ER9 B;  3VEB A;  1W9M A;  4KIK A;  4IWP A;  3DPQ A;  1GNT A;  3D2E A;  4M0M A;  3I01 A;  4JWC A;  2OBM A;  3C7N A;  1DKZ A;  3B52 X;  3T48 A;  4ILH B;  2QFF A;  4E3C A;  3DPO A;  3H0X A;  2ND1 A;  1Q5L A;  4R5I A;  2EWF A;  4FM3 A;  3VEA A;  4JLC A;  1E2U A;  1DKX A;  2ND0 A;  3DQG A;  2Z8Y A;  3ERC C;  1OA1 A;  1GNL A;  3RV1 A;  3QNJ A;  4EZU A;  1BPR A;  3O3O B;  2RT6 A;  3ZEF A;  1E1D A;  3RV0 A;  2PY6 A;  3KAV A;  3LMF A;  4JWE A;  4WV7 A;  3FD9 A;  4IM3 A;  5TKY A;  3T47 A;  4IWO A;  2OP6 A;  3OWG A;  4EZT A;  7HSC A;  2KHO A;  3O3M B;  4EZZ A;  2QXL A;  4EZX A;  4ILG A;  4KIK B;  4EZV A;  4EZR A;  4H6H A;  4JNF A;  2YIB A;  1YUW A;  4R5J A;  1U00 A;  4JWD A;  1SU8 A;  3KDR A;  4HR1 B;  2JNS A;  3QA8 A;  4G6Q A;  3T49 A;  3ER8 C;  2EX3 B;  3C7N B;  3A98 A;  1OA0 A;  4IWQ A;  3GI7 A;  1JQK A;  4JWI A;  4R5G A;  4EZO A;  1E9V A;  4EZP A;  4HYB A;  3KAW A;  2N3K A;  4UDX X;  5E84 A;  2YIV X;  1CKR A;  3SBT B;  1SU6 A;  2YIA A;  4F01 A;  4MQD A;  2YI8 A;  4JL9 A;  1UPX A;  4ILI A;  3UIT A;  3SBS A;  2GA9 D;  1SUF A;  4IM0 A;  4HY9 A;  4NPH A;  2V7Y A;  3ZED A;  3DOB A;  4EZS A;  4JNE A;  4E81 A;  2GAF D;  4EZY A;  1OAO A;  2YI9 A;  2NCZ A;  4B9Q A;  4UDY X;  3OHX M;  1DG4 A;  1DKY A;  4R5L A;  3N8E A;  1MJG A;  4HR1 A;  3T4A G;  2WIN M;  4PO2 A;  4D8J A;  2OBL A;  2BPR A;  3F7W A;  1SU7 A;  4EZQ A;  4EZW A;  4EZN A;  3B51 X;  3D2F A;  1ZYL A;  4FL9 A;  4F00 A;  3VKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...