4EZTA

Crystal structure of the substrate binding domain of e.coli dnak in complex with heliocin (residues 14 to 21)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
217
structure length
217
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/peptide binding protein
total genus 65
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4eztA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4eztA01
2QFFA 1DKZA 1YUWA 4JWDA 1DKYA 4F01A 4JNFA 4EZUA 1Q5LA 4PO2A 3DOBA 4R5LA 3L3OM 4EZOA 2KHOA 4EZZA 3DPPA 2QXLA 4JN4A 4R5GA 4EZNA 3D2EA 4WV5A 3DPOA 4E81A 5TKYA 3T4AG 4EZTA 4H6IA 3OHXM 4R5JA 3T46A 4HY9A 4F00A 4WV7A 3T48A 4FL9A 3DPQA 1CKRA 4B9QA 4R5KA 3C7NB 1BPRA 2V7YA 3T49A 3T47A 4JWEA 4JWIA 3C7NA 5E84A 4EZSA 3H0XA 3N8EA 4EZVA 4EZXA 4EZRA 3D2FA 3QNJA 7HSCA 4H6HA 1U00A 4EZPA 1DKXA 3DQGA 4EZQA 2WINM 2OP6A 1DG4A 4EZYA 4HYBA 4EZWA 4R5IA 4JWCA 2BPRA 4JNEA
chains in the Genus database with same CATH superfamily
2Z8YA 2YI8A 1HXKA 1OA0A 3L3OM 3BVWA 3DPPA 3D2EA 3CZSA 4F00A 4JLCA 3EJTA 3QNIA 1WDZA 2ELBA 3BUDA 4IW0A 1E1DA 4I43A 2YI9A 4EZYA 1E2UA 2OO2A 1DKZA 3DX0A 4R5LA 5FLEX 3LMFA 2MI7A 4EZNA 3SBSA 3T4AG 3HAHA 3Q0KA 4AZHA 4BNEA 2F7PA 4UDYX 4R5IA 3ERCC 4JWDA 4F01A 1SU7A 3QA8A 3KDRA 1CKRA 2JNKA 3D52A 2V7YA 1SU8A 1UPXA 4AZIA 3DDFA 4H6HA 3I04A 4WPEA 4EZWA 3BVTA 3EJSA 2Z0NA 1I4TA 2YIBA 3BLBA 2YL5A 1PS3A 3EJRA 4R5JA 1SU6A 3VKHA 4AZCB 3BVUA 3SYVA 1HWWA 1QX1A 3RPMA 3I39X 1Q5LA 4FZOA 5TKYA 2WYIA 3OHXM 1QWUA 2RAJA 4IWQA 4FL9A 3DPQA 2Q12A 3BVXA 3B53X 2OBMA 4JNEA 4KIKB 1YWMA 2F1BA 3OK8A 3DX4A 4EZZA 1GNTA 3BUIA 3SOGA 4E81A 4WPCA 2OBLA 3DYTA 2YKTA 2RAKA 4EZVA 3DX1A 4FM3A 3LLLA 1I4LA 1DKYA 2YL6A 4IM3A 1I4DA 3BUPA 2YIAA 4NPHA 3DDGA 2RAIA 3DPOA 2LXYA 2ZXQA 1SUFA 3T46A 1OAOA 1R5EA 2QKWA 2F1AA 2X3WA 2ND0A 3CV5A 3PLTA 4NQIA 4JWIA 5E84A 4MQDA 1U00A 1URUA 2D4CA 2OW6A 2WYHA 3QE6A 4AZGA 4ATMA 1R34A 3ER8C 3B51X 1O7DB 1TQWA 2X3VA 4ILHB 2N3KA 5KBPA 2YIVX 3KAVA 3EJUA 2OP6A 2OW7A 2QFFA 3DX2A 1X03A 4KIKA 4EZOA 3ER9B 2Z0VA 4WV5A 1W9MA 3EJQA 4EZTA 4WV7A 3ABHA 1MJGA 4EZSA 4ILGA 1QWNA 3QNJA 2WINM 4ILIA 2RT6A 3CVRA 1R33A 4FZSA 2KHOA 4I1QA 3EJPA 4G6QA 4AKVA 3RV0A 2F7RA 3T47A 2F7QA 3BUBA 3H0XA 4AZ7A 3D4YA 4HYBA 3BUQA 3A98A 3O3NB 4H8SA 3DOBA 2Z0OA 4UDXX 2OZNB 2GAFD 4HY9A 3UITA 2NCZA 3ACOA 3C7NB 2D1LA 2YLLA 2GA9D 3VEBA 1LQ7A 2EFLA 4M0MA 3CKDA 3ZEFA 2BPRA 4DCNC 3B52X 4HR1B 3BVVA 4D8JA 2PMRA 1OA1A 3FD9A 3VEAA 1BPRA 1O7DC 5C5BB 4AZ6A 3D2FA 2ALWA 7HSCA 3SBTB 2PY6A 4AZCA 4JL9A 5FIGA 2EWFA 3D4ZA 2Q13A 2C08A 2F7OA 2FICA 1GNLA 4H6IA 3M3WA 2V0OA 4NSWA 1TQVA 3HAIA 3T49A 3CAZA 4EZXA 2GF4A 4EZPA 4EZQA 4E3CA 4AZ5A 4DYLA 1YUWA 3L3PA 3RV1A 2QXLA 3D50A 4JN4A 3ZEDA 2YL9A 3QWEA 3F7WA 2O0I1 4B9QA 1TQUA 1TQSA 4JWEA 1ZWWA 3C7NA 3DX3A 1E9VA 3O3MB 1DG4A 2X5CA 4AZBA 3G9GA 1TQTA 4JNFA 4AVMA 3CZNA 4PO2A 1Y2OA 1I49A 4HR1A 2FYVA 4R5GA 2EX3B 1ZYLA 3KAWA 2ND1A 4IM2A 1HTYA 2X3XA 3N8EA 3GI7A 4EZRA 5C5BA 3O3OB 3I01A 2YLAA 3LVTA 4IWOA 4FZPA 4EZUA 3OWGA 1JQKA 2JNSA 3T48A 2YL8A 4R5KA 2EFKA 1GN9A 2LM0A 1X04A 4IM0A 4IWPA 3HAJA 1DKXA 3DQGA 3D51A 2F18A 3I2WA 3Q84A 4JWCA
chains in the Genus database with same CATH topology
2QFFA 2Z8YA 2EWFA 2YI8A 3I39X 1Q5LA 1OA0A 4KIKA 3L3OM 4EZOA 3ER9B 3DPPA 3D2EA 1W9MA 4WV5A 5TKYA 4F00A 4EZTA 1GNLA 3OHXM 4H6IA 4IWQA 4WV7A 4JLCA 4FL9A 3DPQA 3T49A 1MJGA 4EZSA 4ILGA 4EZXA 4IW0A 1E1DA 3QNJA 4EZPA 4I43A 3B53X 4EZQA 2WINM 2YI9A 4E3CA 2OBMA 4EZYA 1E2UA 4ILIA 2RT6A 4JNEA 4KIKB 1DKZA 1YUWA 4R5LA 3RV1A 2KHOA 3LMFA 5FLEX 4EZZA 2QXLA 4JN4A 4EZNA 3ZEDA 1GNTA 4G6QA 3SBSA 4E81A 3T4AG 2OBLA 3F7WA 3RV0A 4B9QA 3T47A 4JWEA 3C7NA 3H0XA 4EZVA 1E9VA 3O3MB 1DG4A 4HYBA 4UDYX 2X5CA 4R5IA 4FM3A 3ERCC 3A98A 4JWDA 1DKYA 4F01A 3O3NB 4JNFA 4IM3A 4PO2A 3DOBA 2YIAA 4NPHA 4HR1A 1SU7A 4R5GA 3QA8A 3DPOA 4UDXX 1SUFA 3T46A 3KDRA 2GAFD 4HY9A 3UITA 1OAOA 2NCZA 2EX3B 1ZYLA 1CKRA 2ND0A 3C7NB 3KAWA 2V7YA 1SU8A 1UPXA 2GA9D 2ND1A 4IM2A 4JWIA 5E84A 3N8EA 3GI7A 4EZRA 4MQDA 3VEBA 4H6HA 1U00A 3O3OB 3I01A 3I04A 4M0MA 4EZWA 3ZEFA 2BPRA 4IWOA 4EZUA 3B52X 4HR1B 3OWGA 2YIBA 1JQKA 3ER8C 3B51X 2JNSA 4R5JA 4D8JA 3T48A 1SU6A 1OA1A 3FD9A 3VEAA 4R5KA 1BPRA 1GN9A 2LM0A 3VKHA 4ILHB 2N3KA 4IM0A 2YIVX 3KAVA 3D2FA 4IWPA 7HSCA 3SBTB 1DKXA 3DQGA 2PY6A 2OP6A 4JL9A 4JWCA 5FIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QFF A;  1DKZ A;  1YUW A;  4JWD A;  1DKY A;  4F01 A;  4JNF A;  4EZU A;  1Q5L A;  4PO2 A;  3DOB A;  4R5L A;  3L3O M;  4EZO A;  2KHO A;  4EZZ A;  3DPP A;  2QXL A;  4JN4 A;  4R5G A;  4EZN A;  3D2E A;  4WV5 A;  3DPO A;  4E81 A;  5TKY A;  3T4A G;  4EZT A;  4H6I A;  3OHX M;  4R5J A;  3T46 A;  4HY9 A;  4F00 A;  4WV7 A;  3T48 A;  4FL9 A;  3DPQ A;  1CKR A;  4B9Q A;  4R5K A;  3C7N B;  1BPR A;  2V7Y A;  3T49 A;  3T47 A;  4JWE A;  4JWI A;  3C7N A;  5E84 A;  4EZS A;  3H0X A;  3N8E A;  4EZV A;  4EZX A;  4EZR A;  3D2F A;  3QNJ A;  7HSC A;  4H6H A;  1U00 A;  4EZP A;  1DKX A;  3DQG A;  4EZQ A;  2WIN M;  2OP6 A;  1DG4 A;  4EZY A;  4HYB A;  4EZW A;  4R5I A;  4JWC A;  2BPR A;  4JNE A; 
#chains in the Genus database with same CATH topology
 2Z8Y A;  2YI8 A;  1HXK A;  1OA0 A;  3L3O M;  3BVW A;  3DPP A;  3D2E A;  3CZS A;  4F00 A;  4JLC A;  3EJT A;  3QNI A;  1WDZ A;  2ELB A;  3BUD A;  4IW0 A;  1E1D A;  4I43 A;  2YI9 A;  4EZY A;  1E2U A;  2OO2 A;  1DKZ A;  3DX0 A;  4R5L A;  5FLE X;  3LMF A;  2MI7 A;  4EZN A;  3SBS A;  3T4A G;  3HAH A;  3Q0K A;  4AZH A;  4BNE A;  2F7P A;  4UDY X;  4R5I A;  3ERC C;  4JWD A;  4F01 A;  1SU7 A;  3QA8 A;  3KDR A;  1CKR A;  2JNK A;  3D52 A;  2V7Y A;  1SU8 A;  1UPX A;  4AZI A;  3DDF A;  4H6H A;  3I04 A;  4WPE A;  4EZW A;  3BVT A;  3EJS A;  2Z0N A;  1I4T A;  2YIB A;  3BLB A;  2YL5 A;  1PS3 A;  3EJR A;  4R5J A;  1SU6 A;  3VKH A;  4AZC B;  3BVU A;  3SYV A;  1HWW A;  1QX1 A;  3RPM A;  3I39 X;  1Q5L A;  4FZO A;  5TKY A;  2WYI A;  3OHX M;  1QWU A;  2RAJ A;  4IWQ A;  4FL9 A;  3DPQ A;  2Q12 A;  3BVX A;  3B53 X;  2OBM A;  4JNE A;  4KIK B;  1YWM A;  2F1B A;  3OK8 A;  3DX4 A;  4EZZ A;  1GNT A;  3BUI A;  3SOG A;  4E81 A;  4WPC A;  2OBL A;  3DYT A;  2YKT A;  2RAK A;  4EZV A;  3DX1 A;  4FM3 A;  3LLL A;  1I4L A;  1DKY A;  2YL6 A;  4IM3 A;  1I4D A;  3BUP A;  2YIA A;  4NPH A;  3DDG A;  2RAI A;  3DPO A;  2LXY A;  2ZXQ A;  1SUF A;  3T46 A;  1OAO A;  1R5E A;  2QKW A;  2F1A A;  2X3W A;  2ND0 A;  3CV5 A;  3PLT A;  4NQI A;  4JWI A;  5E84 A;  4MQD A;  1U00 A;  1URU A;  2D4C A;  2OW6 A;  2WYH A;  3QE6 A;  4AZG A;  4ATM A;  1R34 A;  3ER8 C;  3B51 X;  1O7D B;  1TQW A;  2X3V A;  4ILH B;  2N3K A;  5KBP A;  2YIV X;  3KAV A;  3EJU A;  2OP6 A;  2OW7 A;  2QFF A;  3DX2 A;  1X03 A;  4KIK A;  4EZO A;  3ER9 B;  2Z0V A;  4WV5 A;  1W9M A;  3EJQ A;  4EZT A;  4WV7 A;  3ABH A;  1MJG A;  4EZS A;  4ILG A;  1QWN A;  3QNJ A;  2WIN M;  4ILI A;  2RT6 A;  3CVR A;  1R33 A;  4FZS A;  2KHO A;  4I1Q A;  3EJP A;  4G6Q A;  4AKV A;  3RV0 A;  2F7R A;  3T47 A;  2F7Q A;  3BUB A;  3H0X A;  4AZ7 A;  3D4Y A;  4HYB A;  3BUQ A;  3A98 A;  3O3N B;  4H8S A;  3DOB A;  2Z0O A;  4UDX X;  2OZN B;  2GAF D;  4HY9 A;  3UIT A;  2NCZ A;  3ACO A;  3C7N B;  2D1L A;  2YLL A;  2GA9 D;  3VEB A;  1LQ7 A;  2EFL A;  4M0M A;  3CKD A;  3ZEF A;  2BPR A;  4DCN C;  3B52 X;  4HR1 B;  3BVV A;  4D8J A;  2PMR A;  1OA1 A;  3FD9 A;  3VEA A;  1BPR A;  1O7D C;  5C5B B;  4AZ6 A;  3D2F A;  2ALW A;  7HSC A;  3SBT B;  2PY6 A;  4AZC A;  4JL9 A;  5FIG A;  2EWF A;  3D4Z A;  2Q13 A;  2C08 A;  2F7O A;  2FIC A;  1GNL A;  4H6I A;  3M3W A;  2V0O A;  4NSW A;  1TQV A;  3HAI A;  3T49 A;  3CAZ A;  4EZX A;  2GF4 A;  4EZP A;  4EZQ A;  4E3C A;  4AZ5 A;  4DYL A;  1YUW A;  3L3P A;  3RV1 A;  2QXL A;  3D50 A;  4JN4 A;  3ZED A;  2YL9 A;  3QWE A;  3F7W A;  2O0I 1;  4B9Q A;  1TQU A;  1TQS A;  4JWE A;  1ZWW A;  3C7N A;  3DX3 A;  1E9V A;  3O3M B;  1DG4 A;  2X5C A;  4AZB A;  3G9G A;  1TQT A;  4JNF A;  4AVM A;  3CZN A;  4PO2 A;  1Y2O A;  1I49 A;  4HR1 A;  2FYV A;  4R5G A;  2EX3 B;  1ZYL A;  3KAW A;  2ND1 A;  4IM2 A;  1HTY A;  2X3X A;  3N8E A;  3GI7 A;  4EZR A;  5C5B A;  3O3O B;  3I01 A;  2YLA A;  3LVT A;  4IWO A;  4FZP A;  4EZU A;  3OWG A;  1JQK A;  2JNS A;  3T48 A;  2YL8 A;  4R5K A;  2EFK A;  1GN9 A;  2LM0 A;  1X04 A;  4IM0 A;  4IWP A;  3HAJ A;  1DKX A;  3DQG A;  3D51 A;  2F18 A;  3I2W A;  3Q84 A;  4JWC A; 
#chains in the Genus database with same CATH homology
 2QFF A;  2Z8Y A;  2EWF A;  2YI8 A;  3I39 X;  1Q5L A;  1OA0 A;  4KIK A;  3L3O M;  4EZO A;  3ER9 B;  3DPP A;  3D2E A;  1W9M A;  4WV5 A;  5TKY A;  4F00 A;  4EZT A;  1GNL A;  3OHX M;  4H6I A;  4IWQ A;  4WV7 A;  4JLC A;  4FL9 A;  3DPQ A;  3T49 A;  1MJG A;  4EZS A;  4ILG A;  4EZX A;  4IW0 A;  1E1D A;  3QNJ A;  4EZP A;  4I43 A;  3B53 X;  4EZQ A;  2WIN M;  2YI9 A;  4E3C A;  2OBM A;  4EZY A;  1E2U A;  4ILI A;  2RT6 A;  4JNE A;  4KIK B;  1DKZ A;  1YUW A;  4R5L A;  3RV1 A;  2KHO A;  3LMF A;  5FLE X;  4EZZ A;  2QXL A;  4JN4 A;  4EZN A;  3ZED A;  1GNT A;  4G6Q A;  3SBS A;  4E81 A;  3T4A G;  2OBL A;  3F7W A;  3RV0 A;  4B9Q A;  3T47 A;  4JWE A;  3C7N A;  3H0X A;  4EZV A;  1E9V A;  3O3M B;  1DG4 A;  4HYB A;  4UDY X;  2X5C A;  4R5I A;  4FM3 A;  3ERC C;  3A98 A;  4JWD A;  1DKY A;  4F01 A;  3O3N B;  4JNF A;  4IM3 A;  4PO2 A;  3DOB A;  2YIA A;  4NPH A;  4HR1 A;  1SU7 A;  4R5G A;  3QA8 A;  3DPO A;  4UDX X;  1SUF A;  3T46 A;  3KDR A;  2GAF D;  4HY9 A;  3UIT A;  1OAO A;  2NCZ A;  2EX3 B;  1ZYL A;  1CKR A;  2ND0 A;  3C7N B;  3KAW A;  2V7Y A;  1SU8 A;  1UPX A;  2GA9 D;  2ND1 A;  4IM2 A;  4JWI A;  5E84 A;  3N8E A;  3GI7 A;  4EZR A;  4MQD A;  3VEB A;  4H6H A;  1U00 A;  3O3O B;  3I01 A;  3I04 A;  4M0M A;  4EZW A;  3ZEF A;  2BPR A;  4IWO A;  4EZU A;  3B52 X;  4HR1 B;  3OWG A;  2YIB A;  1JQK A;  3ER8 C;  3B51 X;  2JNS A;  4R5J A;  4D8J A;  3T48 A;  1SU6 A;  1OA1 A;  3FD9 A;  3VEA A;  4R5K A;  1BPR A;  1GN9 A;  2LM0 A;  3VKH A;  4ILH B;  2N3K A;  4IM0 A;  2YIV X;  3KAV A;  3D2F A;  4IWP A;  7HSC A;  3SBT B;  1DKX A;  3DQG A;  2PY6 A;  2OP6 A;  4JL9 A;  4JWC A;  5FIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...