4EZWA

Crystal structure of the substrate binding domain of e.coli dnak in complex with the designer peptide nrllltg
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
214
structure length
214
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone/peptide binding protein
molecule keywords Chaperone protein DnaK
publication title Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
total genus 62
structure length 214
sequence length 214
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4ezwA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4ezwA01
4WV7A 3DPOA 3DPQA 4JWEA 4HYBA 1BPRA 4F00A 1YUWA 3OHXM 4R5JA 4R5GA 3T48A 3DQGA 2KHOA 2BPRA 3T47A 4B9QA 4EZXA 2V7YA 2OP6A 4EZQA 7HSCA 3H0XA 1U00A 4HY9A 2WINM 4EZTA 4F01A 4EZWA 4R5KA 4JN4A 4EZZA 4EZSA 3L3OM 4EZRA 2QFFA 4EZUA 5TKYA 4R5LA 3C7NA 2QXLA 4FL9A 3T49A 4E81A 4EZVA 4H6IA 1CKRA 3DPPA 4H6HA 4JNEA 1DKZA 1DG4A 4JWDA 4JWCA 4EZOA 4EZPA 1DKYA 3QNJA 3C7NB 4R5IA 3T4AG 4JNFA 3D2FA 1Q5LA 3DOBA 3D2EA 4EZNA 4EZYA 3N8EA 4WV5A 4PO2A 1DKXA 5E84A 4JWIA 3T46A
chains in the Genus database with same CATH superfamily
1QX1A 1QWUA 4DCNC 2BPRA 2EFLA 4G6QA 3A98A 3BUBA 3GI7A 2YIVX 2OZNB 2F1AA 2F1BA 1TQVA 2D1LA 3EJUA 1ZWWA 3FD9A 3QWEA 3Q0KA 2X3XA 1OA0A 3UITA 4F01A 4ILGA 2YI8A 4AKVA 3BVVA 2QXLA 4E81A 4FZPA 1DG4A 1SUFA 4UDYX 3BUIA 4R5KA 3DPQA 4KIKB 2FYVA 2YL9A 4IWPA 2PMRA 3SBSA 4I1QA 2GA9D 3LMFA 7HSCA 4D8JA 4H8SA 3BVTA 1X03A 2D4CA 1UPXA 3DPPA 4JNEA 2YIAA 2NCZA 1TQTA 2F7PA 1SU7A 3B52X 3O3OB 1HWWA 2F7OA 3DDFA 3KAWA 2YKTA 3DPOA 1MJGA 3DX1A 3RPMA 1TQUA 1SU8A 1R34A 3BVXA 1I4LA 3D4YA 3QE6A 3CVRA 4NPHA 4HR1B 3D51A 2RAJA 3T48A 2Z0VA 4FZOA 3T47A 4E3CA 3EJPA 4AZ6A 2RAIA 3BUDA 2EFKA 2LXYA 3DX4A 4IM2A 2MI7A 4WPEA 2ND0A 1Q5LA 4ATMA 3DDGA 1YWMA 1YUWA 3VEAA 2WYIA 2V7YA 3B51X 3M3WA 1SU6A 3OK8A 1I4TA 3CAZA 4JN4A 3EJTA 1I49A 3C7NA 1I4DA 2F7RA 1JQKA 1Y2OA 2Q12A 3L3PA 3ABHA 3VKHA 1U00A 4EZRA 4EZZA 4AZCA 4DYLA 2RT6A 4EZVA 4H6IA 3QNIA 1O7DB 1OA1A 2JNSA 2ELBA 3N8EA 2X3WA 1DKXA 1QWNA 2Z0OA 4EZXA 5C5BB 3BVWA 4BNEA 4EZTA 2ALWA 3L3OM 1GNLA 2X5CA 4R5LA 4IWQA 4FL9A 3T49A 1CKRA 4WPCA 4JLCA 4JWDA 3D52A 1E2UA 4EZOA 1DKYA 4R5IA 2WYHA 2V0OA 3ER8C 3B53X 1GN9A 3BUQA 3DQGA 2N3KA 4MQDA 3HAJA 2ND1A 3EJRA 3G9GA 3CZSA 2YL8A 3PLTA 4FZSA 2Q13A 4H6HA 3SOGA 4UDXX 3SYVA 2Z0NA 3BUPA 2OW6A 2PY6A 4JNFA 3D2EA 2EWFA 4PO2A 2YL5A 4WV7A 4ILHB 4R5GA 1ZYLA 2RAKA 5FLEX 3RV0A 4AZBA 2Z8YA 2OP6A 2WINM 3LLLA 4EZWA 2OO2A 3ERCC 4M0MA 1LQ7A 2LM0A 2EX3B 4KIKA 3QNJA 3T4AG 4AZIA 1TQSA 5E84A 3LVTA 4JWIA 3I01A 3O3MB 4JWEA 4HYBA 3OHXM 3EJQA 2X3VA 4NQIA 4JWCA 4EZNA 2QKWA 3D4ZA 1E1DA 1HTYA 4EZQA 5FIGA 2YLAA 2F18A 3ZEDA 2QFFA 3BLBA 1GNTA 3EJSA 3DX2A 3KAVA 1O7DC 4HR1A 5KBPA 1TQWA 3ACOA 3T46A 1R33A 1WDZA 4F00A 3I04A 3DX0A 4R5JA 4AVMA 2O0I1 2YI9A 4IW0A 4EZUA 4JL9A 3D50A 1X04A 4AZHA 4EZPA 1HXKA 4IM0A 3BVUA 3D2FA 3SBTB 2ZXQA 3OWGA 3ER9B 1PS3A 3I2WA 4B9QA 2OW7A 1E9VA 4EZSA 3CZNA 5TKYA 3RV1A 2GAFD 3HAHA 3C7NB 3DOBA 4IM3A 4FM3A 3I39X 2KHOA 1OAOA 4AZ5A 4HY9A 3H0XA 4AZ7A 2JNKA 2OBLA 2YL6A 2FICA 1W9MA 1DKZA 2GF4A 3O3NB 4AZCB 3F7WA 2C08A 1R5EA 2OBMA 4EZYA 3DX3A 5C5BA 3ZEFA 1BPRA 4I43A 3CV5A 2F7QA 4IWOA 3QA8A 3Q84A 3CKDA 3KDRA 3DYTA 2YLLA 3HAIA 4ILIA 1URUA 4AZGA 4NSWA 2YIBA 3VEBA 4WV5A
chains in the Genus database with same CATH topology
4F00A 3I04A 4R5JA 3T48A 3DQGA 2N3KA 2BPRA 3T47A 4E3CA 4MQDA 2ND1A 4G6QA 3A98A 2YI9A 3T46A 4IW0A 4EZUA 4IM2A 3GI7A 2YIVX 4JL9A 4H6HA 4UDXX 4EZPA 2ND0A 4IM0A 2PY6A 4JNFA 3D2FA 1Q5LA 3D2EA 2EWFA 4PO2A 3SBTB 4WV7A 4ILHB 3FD9A 3OWGA 1YUWA 4R5GA 3ER9B 1ZYLA 3VEAA 5FLEX 4B9QA 2V7YA 3B51X 3RV0A 2Z8YA 1OA0A 1E9VA 1SU6A 2WINM 3UITA 4F01A 4EZWA 4EZSA 2YI8A 4JN4A 2OP6A 4ILGA 5TKYA 3C7NA 2QXLA 3RV1A 2GAFD 3ERCC 4E81A 3ER8C 1JQKA 4M0MA 1DG4A 2LM0A 2EX3B 1SUFA 4KIKA 3QNJA 3C7NB 4UDYX 3T4AG 3DOBA 4IM3A 4R5KA 5E84A 4JWIA 3DPQA 3I01A 3O3MB 4JWEA 4KIKB 4HYBA 4FM3A 3I39X 4IWPA 3OHXM 3VKHA 2KHOA 1OAOA 3SBSA 2GA9D 3LMFA 7HSCA 3H0XA 1U00A 4HY9A 4EZRA 4EZZA 4D8JA 2RT6A 1UPXA 2OBLA 4EZVA 4H6IA 1OA1A 3DPPA 1W9MA 1DKZA 4JNEA 2YIAA 3O3NB 4JWCA 2JNSA 2NCZA 3F7WA 1SU7A 3B52X 2OBMA 3O3OB 4EZNA 4EZYA 3N8EA 1DKXA 3ZEFA 3KAWA 1E1DA 3DPOA 1BPRA 1MJGA 4I43A 4EZXA 4IWOA 4EZQA 3QA8A 5FIGA 4EZTA 3L3OM 3ZEDA 2QFFA 1GNLA 2X5CA 1SU8A 3KDRA 4R5LA 4IWQA 4FL9A 3T49A 1GNTA 1CKRA 3KAVA 4JLCA 1GN9A 4JWDA 1E2UA 4HR1A 4EZOA 4ILIA 1DKYA 4R5IA 2YIBA 3VEBA 4WV5A 4NPHA 4HR1B 3B53X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WV7 A;  3DPO A;  3DPQ A;  4JWE A;  4HYB A;  1BPR A;  4F00 A;  1YUW A;  3OHX M;  4R5J A;  4R5G A;  3T48 A;  3DQG A;  2KHO A;  2BPR A;  3T47 A;  4B9Q A;  4EZX A;  2V7Y A;  2OP6 A;  4EZQ A;  7HSC A;  3H0X A;  1U00 A;  4HY9 A;  2WIN M;  4EZT A;  4F01 A;  4EZW A;  4R5K A;  4JN4 A;  4EZZ A;  4EZS A;  3L3O M;  4EZR A;  2QFF A;  4EZU A;  5TKY A;  4R5L A;  3C7N A;  2QXL A;  4FL9 A;  3T49 A;  4E81 A;  4EZV A;  4H6I A;  1CKR A;  3DPP A;  4H6H A;  4JNE A;  1DKZ A;  1DG4 A;  4JWD A;  4JWC A;  4EZO A;  4EZP A;  1DKY A;  3QNJ A;  3C7N B;  4R5I A;  3T4A G;  4JNF A;  3D2F A;  1Q5L A;  3DOB A;  3D2E A;  4EZN A;  4EZY A;  3N8E A;  4WV5 A;  4PO2 A;  1DKX A;  5E84 A;  4JWI A;  3T46 A; 
#chains in the Genus database with same CATH topology
 1QX1 A;  1QWU A;  4DCN C;  2BPR A;  2EFL A;  4G6Q A;  3A98 A;  3BUB A;  3GI7 A;  2YIV X;  2OZN B;  2F1A A;  2F1B A;  1TQV A;  2D1L A;  3EJU A;  1ZWW A;  3FD9 A;  3QWE A;  3Q0K A;  2X3X A;  1OA0 A;  3UIT A;  4F01 A;  4ILG A;  2YI8 A;  4AKV A;  3BVV A;  2QXL A;  4E81 A;  4FZP A;  1DG4 A;  1SUF A;  4UDY X;  3BUI A;  4R5K A;  3DPQ A;  4KIK B;  2FYV A;  2YL9 A;  4IWP A;  2PMR A;  3SBS A;  4I1Q A;  2GA9 D;  3LMF A;  7HSC A;  4D8J A;  4H8S A;  3BVT A;  1X03 A;  2D4C A;  1UPX A;  3DPP A;  4JNE A;  2YIA A;  2NCZ A;  1TQT A;  2F7P A;  1SU7 A;  3B52 X;  3O3O B;  1HWW A;  2F7O A;  3DDF A;  3KAW A;  2YKT A;  3DPO A;  1MJG A;  3DX1 A;  3RPM A;  1TQU A;  1SU8 A;  1R34 A;  3BVX A;  1I4L A;  3D4Y A;  3QE6 A;  3CVR A;  4NPH A;  4HR1 B;  3D51 A;  2RAJ A;  3T48 A;  2Z0V A;  4FZO A;  3T47 A;  4E3C A;  3EJP A;  4AZ6 A;  2RAI A;  3BUD A;  2EFK A;  2LXY A;  3DX4 A;  4IM2 A;  2MI7 A;  4WPE A;  2ND0 A;  1Q5L A;  4ATM A;  3DDG A;  1YWM A;  1YUW A;  3VEA A;  2WYI A;  2V7Y A;  3B51 X;  3M3W A;  1SU6 A;  3OK8 A;  1I4T A;  3CAZ A;  4JN4 A;  3EJT A;  1I49 A;  3C7N A;  1I4D A;  2F7R A;  1JQK A;  1Y2O A;  2Q12 A;  3L3P A;  3ABH A;  3VKH A;  1U00 A;  4EZR A;  4EZZ A;  4AZC A;  4DYL A;  2RT6 A;  4EZV A;  4H6I A;  3QNI A;  1O7D B;  1OA1 A;  2JNS A;  2ELB A;  3N8E A;  2X3W A;  1DKX A;  1QWN A;  2Z0O A;  4EZX A;  5C5B B;  3BVW A;  4BNE A;  4EZT A;  2ALW A;  3L3O M;  1GNL A;  2X5C A;  4R5L A;  4IWQ A;  4FL9 A;  3T49 A;  1CKR A;  4WPC A;  4JLC A;  4JWD A;  3D52 A;  1E2U A;  4EZO A;  1DKY A;  4R5I A;  2WYH A;  2V0O A;  3ER8 C;  3B53 X;  1GN9 A;  3BUQ A;  3DQG A;  2N3K A;  4MQD A;  3HAJ A;  2ND1 A;  3EJR A;  3G9G A;  3CZS A;  2YL8 A;  3PLT A;  4FZS A;  2Q13 A;  4H6H A;  3SOG A;  4UDX X;  3SYV A;  2Z0N A;  3BUP A;  2OW6 A;  2PY6 A;  4JNF A;  3D2E A;  2EWF A;  4PO2 A;  2YL5 A;  4WV7 A;  4ILH B;  4R5G A;  1ZYL A;  2RAK A;  5FLE X;  3RV0 A;  4AZB A;  2Z8Y A;  2OP6 A;  2WIN M;  3LLL A;  4EZW A;  2OO2 A;  3ERC C;  4M0M A;  1LQ7 A;  2LM0 A;  2EX3 B;  4KIK A;  3QNJ A;  3T4A G;  4AZI A;  1TQS A;  5E84 A;  3LVT A;  4JWI A;  3I01 A;  3O3M B;  4JWE A;  4HYB A;  3OHX M;  3EJQ A;  2X3V A;  4NQI A;  4JWC A;  4EZN A;  2QKW A;  3D4Z A;  1E1D A;  1HTY A;  4EZQ A;  5FIG A;  2YLA A;  2F18 A;  3ZED A;  2QFF A;  3BLB A;  1GNT A;  3EJS A;  3DX2 A;  3KAV A;  1O7D C;  4HR1 A;  5KBP A;  1TQW A;  3ACO A;  3T46 A;  1R33 A;  1WDZ A;  4F00 A;  3I04 A;  3DX0 A;  4R5J A;  4AVM A;  2O0I 1;  2YI9 A;  4IW0 A;  4EZU A;  4JL9 A;  3D50 A;  1X04 A;  4AZH A;  4EZP A;  1HXK A;  4IM0 A;  3BVU A;  3D2F A;  3SBT B;  2ZXQ A;  3OWG A;  3ER9 B;  1PS3 A;  3I2W A;  4B9Q A;  2OW7 A;  1E9V A;  4EZS A;  3CZN A;  5TKY A;  3RV1 A;  2GAF D;  3HAH A;  3C7N B;  3DOB A;  4IM3 A;  4FM3 A;  3I39 X;  2KHO A;  1OAO A;  4AZ5 A;  4HY9 A;  3H0X A;  4AZ7 A;  2JNK A;  2OBL A;  2YL6 A;  2FIC A;  1W9M A;  1DKZ A;  2GF4 A;  3O3N B;  4AZC B;  3F7W A;  2C08 A;  1R5E A;  2OBM A;  4EZY A;  3DX3 A;  5C5B A;  3ZEF A;  1BPR A;  4I43 A;  3CV5 A;  2F7Q A;  4IWO A;  3QA8 A;  3Q84 A;  3CKD A;  3KDR A;  3DYT A;  2YLL A;  3HAI A;  4ILI A;  1URU A;  4AZG A;  4NSW A;  2YIB A;  3VEB A;  4WV5 A; 
#chains in the Genus database with same CATH homology
 4F00 A;  3I04 A;  4R5J A;  3T48 A;  3DQG A;  2N3K A;  2BPR A;  3T47 A;  4E3C A;  4MQD A;  2ND1 A;  4G6Q A;  3A98 A;  2YI9 A;  3T46 A;  4IW0 A;  4EZU A;  4IM2 A;  3GI7 A;  2YIV X;  4JL9 A;  4H6H A;  4UDX X;  4EZP A;  2ND0 A;  4IM0 A;  2PY6 A;  4JNF A;  3D2F A;  1Q5L A;  3D2E A;  2EWF A;  4PO2 A;  3SBT B;  4WV7 A;  4ILH B;  3FD9 A;  3OWG A;  1YUW A;  4R5G A;  3ER9 B;  1ZYL A;  3VEA A;  5FLE X;  4B9Q A;  2V7Y A;  3B51 X;  3RV0 A;  2Z8Y A;  1OA0 A;  1E9V A;  1SU6 A;  2WIN M;  3UIT A;  4F01 A;  4EZW A;  4EZS A;  2YI8 A;  4JN4 A;  2OP6 A;  4ILG A;  5TKY A;  3C7N A;  2QXL A;  3RV1 A;  2GAF D;  3ERC C;  4E81 A;  3ER8 C;  1JQK A;  4M0M A;  1DG4 A;  2LM0 A;  2EX3 B;  1SUF A;  4KIK A;  3QNJ A;  3C7N B;  4UDY X;  3T4A G;  3DOB A;  4IM3 A;  4R5K A;  5E84 A;  4JWI A;  3DPQ A;  3I01 A;  3O3M B;  4JWE A;  4KIK B;  4HYB A;  4FM3 A;  3I39 X;  4IWP A;  3OHX M;  3VKH A;  2KHO A;  1OAO A;  3SBS A;  2GA9 D;  3LMF A;  7HSC A;  3H0X A;  1U00 A;  4HY9 A;  4EZR A;  4EZZ A;  4D8J A;  2RT6 A;  1UPX A;  2OBL A;  4EZV A;  4H6I A;  1OA1 A;  3DPP A;  1W9M A;  1DKZ A;  4JNE A;  2YIA A;  3O3N B;  4JWC A;  2JNS A;  2NCZ A;  3F7W A;  1SU7 A;  3B52 X;  2OBM A;  3O3O B;  4EZN A;  4EZY A;  3N8E A;  1DKX A;  3ZEF A;  3KAW A;  1E1D A;  3DPO A;  1BPR A;  1MJG A;  4I43 A;  4EZX A;  4IWO A;  4EZQ A;  3QA8 A;  5FIG A;  4EZT A;  3L3O M;  3ZED A;  2QFF A;  1GNL A;  2X5C A;  1SU8 A;  3KDR A;  4R5L A;  4IWQ A;  4FL9 A;  3T49 A;  1GNT A;  1CKR A;  3KAV A;  4JLC A;  1GN9 A;  4JWD A;  1E2U A;  4HR1 A;  4EZO A;  4ILI A;  1DKY A;  4R5I A;  2YIB A;  3VEB A;  4WV5 A;  4NPH A;  4HR1 B;  3B53 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...