1O50A

Crystal structure of a cbs domain-containing protein (tm0935) from thermotoga maritima at 1.87 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
148
structure length
141
Chain Sequence
HHHMKVKDVCKLISLKPTVVEEDTPIEEIVDRILEDPVTRTVYVARDNKLVGMIPVMHLLKVSGFHFFGFIPSMKRLIAKNASEIMLDPVYVHMDTPLEEALKLMIDNNIQEMPVVDEKGEIVGDLNSLEILLALWKGREK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CBS domain-containing predicted protein TM0935
publication title Crystal structure of a tandem cystathionine-beta-synthase (CBS) domain protein (TM0935) from Thermotoga maritima at 1.87 A resolution
pubmed doi rcsb
source organism Thermotoga maritima
total genus 37
structure length 141
sequence length 148
ec nomenclature
pdb deposition date 2003-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 1o50A00
3SL7A 3L31A 4P1GA 2QRCE 3T4NC 3LFZA 3GBYA 2YZIA 3HF7A 2UV4A 4PCUA 4IYSA 5K25C 1YAVA 4COOA 3KPCA 1O50A 3FWRA 4ESYB 2YVXA 4O9KA 4UUUA 5K22B 5KS7A 3FNAA 3KPBA 5IIPA 2RIFA 2NYCA 2D4ZA 3OCMA 2OUXA 1Y5HA 2UV5A 2YVYA 4HG0A 4L28A 3ORGA 3LQNA 2PFIA 4ESYA 1PVMA 4IY2A 3PC4A 4GQVA 2O16A 4GQWA 3I8NA 3FWSA 3PC2A 2QRDE 1PBJA 2NYEA 3LHHA 3LV9A 4GQYA 2QH1A 2EF7A 3TDHC 3PC3A 5K24C 2YZQA 4FXSA 2QREE 2OOYE 4DQWA 4IY0A 2OOXE 3FHMA 4L3VA 5K23C 2QR1E 2P9MA 4L27A 2QLVC 3K2VA 2RC3A 5MMZA 2EMQA 3KPDA 2UV7A 2RIHA 3OI8A 4NOCA 3K6EA 3TE5C 3KXRA 4P1OA 2YVZA 3L2BA 4FRYA 2UV6A 3DDJA 4IY4A 4L0DA 3FV6A 4IY3A 3OCOA 1XKFA 2ZY9A 5LXQA 3KH5A
chains in the Genus database with same CATH superfamily
3SL7A 3L31A 4P1GA 2QRCE 3T4NC 3LFZA 3GBYA 2YZIA 3HF7A 2UV4A 4PCUA 4IYSA 5K25C 1YAVA 4COOA 3KPCA 1O50A 3FWRA 4ESYB 2YVXA 4O9KA 4UUUA 5K22B 5KS7A 2JA3A 3FNAA 3KPBA 5IIPA 2RIFA 2NYCA 2D4ZA 3OCMA 2OUXA 1Y5HA 2UV5A 2YVYA 4HG0A 4L28A 3ORGA 3LQNA 2PFIA 4ESYA 1PVMA 4IY2A 3PC4A 4GQVA 2O16A 4GQWA 3I8NA 3FWSA 3PC2A 2QRDE 1PBJA 2NYEA 3LHHA 3LV9A 4GQYA 2QH1A 2EF7A 3TDHC 3PC3A 5K24C 2YZQA 4FXSA 2QREE 2OOYE 4DQWA 4IY0A 2OOXE 3FHMA 4L3VA 5K23C 2QR1E 2P9MA 4L27A 2QLVC 2J9LA 3K2VA 2RC3A 5MMZA 2EMQA 3KPDA 2UV7A 2RIHA 3OI8A 4NOCA 3K6EA 3TE5C 3KXRA 4P1OA 2YVZA 3L2BA 4FRYA 2UV6A 3DDJA 4IY4A 4L0DA 3FV6A 4IY3A 3OCOA 1XKFA 2ZY9A 5LXQA 3KH5A
chains in the Genus database with same CATH topology
3SL7A 3L31A 4P1GA 2QRCE 3T4NC 3LFZA 3GBYA 2YZIA 3HF7A 2UV4A 4PCUA 4IYSA 5K25C 1YAVA 4COOA 3KPCA 1O50A 3FWRA 4ESYB 2YVXA 4O9KA 4UUUA 5K22B 5KS7A 2JA3A 3FNAA 3KPBA 5IIPA 2RIFA 2NYCA 2D4ZA 3OCMA 2OUXA 1Y5HA 2UV5A 2YVYA 4HG0A 4L28A 3ORGA 3LQNA 2PFIA 4ESYA 1PVMA 4IY2A 3PC4A 4GQVA 2O16A 4GQWA 3I8NA 3FWSA 3PC2A 2QRDE 1PBJA 2NYEA 3LHHA 3LV9A 4GQYA 2QH1A 2EF7A 3TDHC 3PC3A 5K24C 2YZQA 4FXSA 2QREE 2OOYE 4DQWA 4IY0A 2OOXE 3FHMA 4L3VA 5K23C 2QR1E 2P9MA 4L27A 2QLVC 2J9LA 3K2VA 2RC3A 5MMZA 2EMQA 3KPDA 2UV7A 2RIHA 3OI8A 4NOCA 3K6EA 3TE5C 3KXRA 4P1OA 2YVZA 3L2BA 4FRYA 2UV6A 3DDJA 4IY4A 4L0DA 3FV6A 4IY3A 3OCOA 1XKFA 2ZY9A 5LXQA 3KH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SL7 A;  3L31 A;  4P1G A;  2QRC E;  3T4N C;  3LFZ A;  3GBY A;  2YZI A;  3HF7 A;  2UV4 A;  4PCU A;  4IYS A;  5K25 C;  1YAV A;  4COO A;  3KPC A;  1O50 A;  3FWR A;  4ESY B;  2YVX A;  4O9K A;  4UUU A;  5K22 B;  5KS7 A;  3FNA A;  3KPB A;  5IIP A;  2RIF A;  2NYC A;  2D4Z A;  3OCM A;  2OUX A;  1Y5H A;  2UV5 A;  2YVY A;  4HG0 A;  4L28 A;  3ORG A;  3LQN A;  2PFI A;  4ESY A;  1PVM A;  4IY2 A;  3PC4 A;  4GQV A;  2O16 A;  4GQW A;  3I8N A;  3FWS A;  3PC2 A;  2QRD E;  1PBJ A;  2NYE A;  3LHH A;  3LV9 A;  4GQY A;  2QH1 A;  2EF7 A;  3TDH C;  3PC3 A;  5K24 C;  2YZQ A;  4FXS A;  2QRE E;  2OOY E;  4DQW A;  4IY0 A;  2OOX E;  3FHM A;  4L3V A;  5K23 C;  2QR1 E;  2P9M A;  4L27 A;  2QLV C;  3K2V A;  2RC3 A;  5MMZ A;  2EMQ A;  3KPD A;  2UV7 A;  2RIH A;  3OI8 A;  4NOC A;  3K6E A;  3TE5 C;  3KXR A;  4P1O A;  2YVZ A;  3L2B A;  4FRY A;  2UV6 A;  3DDJ A;  4IY4 A;  4L0D A;  3FV6 A;  4IY3 A;  3OCO A;  1XKF A;  2ZY9 A;  5LXQ A;  3KH5 A; 
#chains in the Genus database with same CATH topology
 3SL7 A;  3L31 A;  4P1G A;  2QRC E;  3T4N C;  3LFZ A;  3GBY A;  2YZI A;  3HF7 A;  2UV4 A;  4PCU A;  4IYS A;  5K25 C;  1YAV A;  4COO A;  3KPC A;  1O50 A;  3FWR A;  4ESY B;  2YVX A;  4O9K A;  4UUU A;  5K22 B;  5KS7 A;  2JA3 A;  3FNA A;  3KPB A;  5IIP A;  2RIF A;  2NYC A;  2D4Z A;  3OCM A;  2OUX A;  1Y5H A;  2UV5 A;  2YVY A;  4HG0 A;  4L28 A;  3ORG A;  3LQN A;  2PFI A;  4ESY A;  1PVM A;  4IY2 A;  3PC4 A;  4GQV A;  2O16 A;  4GQW A;  3I8N A;  3FWS A;  3PC2 A;  2QRD E;  1PBJ A;  2NYE A;  3LHH A;  3LV9 A;  4GQY A;  2QH1 A;  2EF7 A;  3TDH C;  3PC3 A;  5K24 C;  2YZQ A;  4FXS A;  2QRE E;  2OOY E;  4DQW A;  4IY0 A;  2OOX E;  3FHM A;  4L3V A;  5K23 C;  2QR1 E;  2P9M A;  4L27 A;  2QLV C;  2J9L A;  3K2V A;  2RC3 A;  5MMZ A;  2EMQ A;  3KPD A;  2UV7 A;  2RIH A;  3OI8 A;  4NOC A;  3K6E A;  3TE5 C;  3KXR A;  4P1O A;  2YVZ A;  3L2B A;  4FRY A;  2UV6 A;  3DDJ A;  4IY4 A;  4L0D A;  3FV6 A;  4IY3 A;  3OCO A;  1XKF A;  2ZY9 A;  5LXQ A;  3KH5 A; 
#chains in the Genus database with same CATH homology
 3SL7 A;  3L31 A;  4P1G A;  2QRC E;  3T4N C;  3LFZ A;  3GBY A;  2YZI A;  3HF7 A;  2UV4 A;  4PCU A;  4IYS A;  5K25 C;  1YAV A;  4COO A;  3KPC A;  1O50 A;  3FWR A;  4ESY B;  2YVX A;  4O9K A;  4UUU A;  5K22 B;  5KS7 A;  2JA3 A;  3FNA A;  3KPB A;  5IIP A;  2RIF A;  2NYC A;  2D4Z A;  3OCM A;  2OUX A;  1Y5H A;  2UV5 A;  2YVY A;  4HG0 A;  4L28 A;  3ORG A;  3LQN A;  2PFI A;  4ESY A;  1PVM A;  4IY2 A;  3PC4 A;  4GQV A;  2O16 A;  4GQW A;  3I8N A;  3FWS A;  3PC2 A;  2QRD E;  1PBJ A;  2NYE A;  3LHH A;  3LV9 A;  4GQY A;  2QH1 A;  2EF7 A;  3TDH C;  3PC3 A;  5K24 C;  2YZQ A;  4FXS A;  2QRE E;  2OOY E;  4DQW A;  4IY0 A;  2OOX E;  3FHM A;  4L3V A;  5K23 C;  2QR1 E;  2P9M A;  4L27 A;  2QLV C;  2J9L A;  3K2V A;  2RC3 A;  5MMZ A;  2EMQ A;  3KPD A;  2UV7 A;  2RIH A;  3OI8 A;  4NOC A;  3K6E A;  3TE5 C;  3KXR A;  4P1O A;  2YVZ A;  3L2B A;  4FRY A;  2UV6 A;  3DDJ A;  4IY4 A;  4L0D A;  3FV6 A;  4IY3 A;  3OCO A;  1XKF A;  2ZY9 A;  5LXQ A;  3KH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...