4L28A

Crystal structure of delta516-525 human cystathionine beta-synthase d444n mutant containing c-terminal 6xhis tag
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
507
structure length
493
Chain Sequence
LWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFNQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQMVFGVVTAIDLLNFVAAQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Cystathionine beta-synthase
publication title Structural basis of regulation and oligomerization of human cystathionine beta-synthase, the central enzyme of transsulfuration.
pubmed doi rcsb
source organism Homo sapiens
total genus 168
structure length 493
sequence length 507
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.22: Cystathionine beta-synthase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 4l28A03
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l28A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l28A02
5BW6B 3HF7A 4HO1X 3TBHA 5JJCA 5K25C 4P1OA 3HMKA 5LXQA 3RR2A 3VSDA 5I7HA 2O16A 5K23C 5I7AA 2WSYB 3AEYA 4LMBA 2DH6A 5B53A 4D9KA 3X44A 3AEXA 3KXRA 4D9MA 2NYEA 4HG0A 2Q3CA 2PQMA 2BHSA 2YZIA 4XUGB 4D9GA 1WTCA 2D1FA 1A5SB 1KFKB 4D9FA 4IYSA 3FV6A 3KPDA 5KS7A 3IQGX 1PWEA 2QLVC 1VE1A 3VSAA 2CLIB 2O2JA 4JBNA 2D4ZA 4D9NA 4P1GA 3DWGA 4I1YA 2CLOB 3CEPB 2TRSB 4NEGA 3K2VA 1OASA 3TDHC 4COOA 4NU8X 5D87A 1KFJB 1CX9B 1C29B 4D8TA 1A50B 4AIRA 2RC3A 1BEUB 3FWRA 5D85A 4GQVA 5K24C 3VC3A 1CW2B 1QOPB 3OCMA 5DVZA 3OI8A 3LV9A 5IIPA 3ORGA 3KH5A 2OUXA 2RKBA 3LFZA 1K3UB 1X1QA 4ESYA 2O2EA 4H27A 4IY0A 3SS9X 5IXJA 1P5JA 3L31A 4JBLA 1VE5A 1V8ZA 5I6DA 4IL5A 5I7WA 3LHHA 1J0BA 1FUYB 3KPCA 2QH1A 4D9BA 1Y7LA 3I8NA 5B1IA 1RQXA 4KKXB 3L2BA 3IQIX 4OFXA 1K8XB 1QOQB 2UV5A 1KFCB 2RIHA 3IQHX 1JBQA 2J9XB 1TTPB 1FCJA 4O9KA 1BKSB 1TYZA 2CLFB 3T4NC 3PC4A 2C2GA 4UUUA 3L6BA 4ZU1X 1TJPB 4HN4B 4ZU6X 5C3UA 2CLKB 3R0XA 3V7NA 5B1HA 2ISQA 3BM5A 3ZEIA 1C9DB 1WBJB 4D8WA 2CLLB 5KINB 3PC2A 4GQYA 4IY4A 2QRDE 2CLHB 3DDJA 1O58A 1WKVA 1UBSB 5D84A 3PC3A 2BHTA 5MMZA 5E0KB 4IY2A 1C8VB 3SS7X 2J9YB 4FRYA 2EGUA 1Z7WA 1A5BB 1K7XB 1PVMA 1J0CA 1J0DA 1KFEB 5DBHX 1V7CA 4L28A 4IY3A 4L27A 2YVYA 1K8ZB 1TZKA 2J9ZB 3R0ZA 1F2DA 1XKFA 4OREX 3FHMA 3T4PA 3TE5C 3SL7A 2RIFA 4HT3B 1K7FB 5I7OA 1PWHA 5EY5B 1TZ2A 2OOYE 4D96A 2ZR8A 4ESYB 5HBGA 4D99A 2UV7A 4NOCA 4WX2B 1TDJA 2RH9B 1UINA 2C2BA 4D9IA 2YVZA 4D9EA 5K22B 2ZPUA 2EMQA 5CVCA 2EFYA 5CGQB 2TYSB 1YAVA 4LI3X 4PCUA 4Y6GB 3GBYA 2CLEB 3K6EA 5B36A 3FNAA 5DW3A 2P9MA 2ECQA 4ZQCB 4HPXB 3SPXA 1KL7A 5JISA 2Q3DA 2RHGB 2PFIA 3LQNA 5D86A 1J0EA 5KZMB 1WDWB 1UIMA 1PBJA 2NYCA 3DKIA 3L6RA 2Q3BA 5IW8A 2CLMB 5I7RA 1TZMA 3L6CA 4LMAA 5J43A 1K7EB 1Z7YA 3DWIA 2JC3A 1VB3A 2YVXA 5DBEX 5J5VA 1TZJA 4L3VA 4D9CA 3OCOA 4QYSA 2QR1E 1A5AB 1J0AA 5T6MA 1D6SA 2DH5A 3IAUA 4L0DA 4HPJB 2YZQA 5IWCA 4DQWA 1TTQB 1M54A 1O50A 3KPBA 2ECOA 2TSYB 2GN2A 3FWSA 2OOXE 4GQWA 2QREE 2EF7A 2UV6A 4FXSA 2UV4A 3FCAA 2ZY9A 3X43A 4D92A 3FGPA 4AECA 4D8UA 1Y5HA 2QRCE 3VSCA 2GN1A 5DW0A 1V71A 2ZSJA 1K8YB 2GN0A 1KFBB 4F4FA 4D97A 5B55A 2V03A 3PR2B 3VBEA 5B3AA 1E5XA
chains in the Genus database with same CATH superfamily
3I1IA 1Y4AE 2P9YA 3CIOA 2R2AA 5BW6B 3CPHA 2C1ZA 2VAPA 2HK9A 1ORTA 4JQYA 2XD4A 3UC5A 3GJYA 4KJZA 1SVIA 5JJCA 4G89A 5D7NA 4A15A 3JQAD 4I1VA 3T1OA 4C43A 1L5GB 4ZXPA 3RUDA 3LV8A 4KHPB 4U5QA 4JP2A 4XUEA 5J59A 3SZMA 3JD3A 1XMIA 2PXHA 2ILTA 1T8WA 4RKQA 1T8PA 3MVEA 7ABPA 2RH4A 3OICA 3IQFA 3MLBA 2ZJ7A 2CCJA 5AHXA 2BMVA 1WCXA 1VRVA 2GCNA 2FGJA 1TM1E 3EXG2 2HGSA 3WE7A 3PXGA 4ALMA 3LRTA 3QQPA 4ARUA 4ZFNA 1U0HC 1LI4A 1ZWKA 2BZGA 2M2IA 3AM4A 3OJEA 4GQBA 4IJMA 5ECYA 3UMYA 4CL2A 3BA1A 1FC0A 4C05A 4YHHB 3IAM1 3RSQA 4QO7A 4E1BA 2PWZA 4K3VA 2VRCA 2FW6A 1N6NA 1WJGA 1PGJA 3GUZA 3TFOA 3WDLA 2QRVB 3INGA 3K9BA 2Q3CA 2GZDA 4NP6A 2CJWA 5FFMA 4HNQA 4BV3A 3AONB 3F6PA 3DDNA 1CLUA 4KR0A 5FBWB 1NMZA 4K6HA 1UBUS 1N0UA 5DFAA 1FTGA 3O2NA 5K6RA 2QTHA 1N3IA 1FOEB 5EIOA 4D9FA 2QE7A 4Y2SA 1BMQA 4IYSA 2E6UX 5HQ3A 3TZBA 3U3OA 1JJVA 1Z4NA 4L4RA 3KEGA 3K5IA 4FSXA 4LQCA 3EXIA 4YJGB 2VS1A 4GSYA 2HI0A 5CURA 3HJUA 4G0VA 3CFYA 3A9SA 4CIWA 1ODTC 3CEMA 2BEKA 4K86A 3AP2A 4UMFA 3VR5A 2HV9A 3NHFA 1ESCA 1MOQA 2MOKA 2I66A 4JBNA 4YJKA 4B9AA 2H16A 2QY9A 3LZCA 2CF6A 3Q3HA 4S3MA 4WXHA 1WNTA 1KA9H 2WUDA 5F5NA 4N5HX 1I7NA 4HLUC 1T0JB 1JHYA 3TB4A 2ZYVX 3PGJA 4TS4A 1V16A 2Z1MA 1BDMA 4J8PA 5SZHB 5K01A 3GEGA 3AUFA 4OYYA 5KWVA 2A9JA 1DV1A 4LW8A 1G2QA 3S5UA 5BSGA 5D5PA 1RCTE 3I8OA 5CAEB 4ZJYA 3VOAA 4OHKA 3EBLA 3ROGA 3TW4A 3N05A 1SK9A 3A4VA 1M2HA 2X76A 3MF4A 5AJYA 5LXTB 1QC5B 1RXCA 2QLFA 3PRKE 3ZLUA 1KI4A 4QBFA 5EMLA 3UPDA 4H1WA 1IJBA 4X97A 3DZBA 5CTAA 1JVNA 1PBNA 1FP2A 3FYUB 4Y1EA 4D45A 2PZAA 3KQVA 2VVTA 9LDBA 3LWZA 1Z4PX 2NSLA 2ZR7A 3KD3A 5T67A 3IKVA 1DOAA 3HN6A 5GTDA 3D6MA 4M0EA 3K0CC 1N2CB 3DZ8A 2CV0A 3T5MA 2I9PA 2BFDB 3WK8A 4KVFA 5BSHA 4PZLA 2GEKA 3BSFA 4QSMA 3TJRA 1REQB 4YGXB 2H5IA 4M7OA 3KPYA 3OUZA 5C1BA 3TXAA 1ODFA 1XLVA 1I1HA 4G4GA 4H3HB 2BKVA 3LKZA 1MIOA 5AM2A 3IEMA 1R66A 2XNKA 1XZPA 4KQGA 3LQ2A 3DDCA 1YTLA 3RHSA 2I4RA 4B8ZA 1EFRA 4RF3A 1PJ3A 1TVEA 2Y68A 1VCHA 1NAIA 2ZWIA 3FPAA 3K0CA 3L6OO 1ODSA 1KJJA 4NPHA 3B6KA 4DIEA 2ZS7A 4MV3A 3KWMA 1P80A 4TZ6A 5F5XA 4H27A 3H0KA 1M1UA 1UOQA 4LGCA 3KXKA 4ZO7A 1WXQA 5U9CA 3NBKA 4CKWB 5IXJA 2E85A 4KACA 4P8RA 1L4FA 4S12A 3ROTA 3FGNA 1XCBA 4B45A 3B13B 4EYOA 3ISTA 1SD5A 1QGZA 4MARA 4MDFA 1WW3A 3NATA 2FSSA 4AJ2A 4TXLA 3WLQA 3VO2A 4EA6A 2OKCA 2C1XA 4QNMA 4JSTA 3BHNA 1HT2E 1QDUA 2CC2A 2IVZA 2R3SA 1W73A 3BK7A 1JDSA 4G81A 3T5DA 3M0EA 4QGSA 3D6JA 2J9FA 3A2MA 3GLQA 3OT5A 1KEKA 1IM8A 2C57A 2JZCA 1VQ1A 1KI3A 4C14A 1Q11A 4J3FA 3ZWMA 1OHHD 1OXUA 1KAHA 3I8NA 3IHLA 3LI2A 1H6BA 2RGNC 4EW3A 5LFAA 2ZJOA 3PA6A 1TZBA 3GG2A 4KKXB 3F7MA 4ZVPA 3HHPA 4TL6A 3O91A 3HJBA 2ZYRA 3FH0A 4O2AA 2Q9BA 4Q93A 3HR8A 4TMYA 5AJUA 1ZIPA 3EGEA 1NBOA 3PNKA 3G0GA 4M7RA 3WWEA 1CUJA 4IAOA 4A5SA 3VH2A 1IE3A 4GU5A 5HWSA 1SXHA 1KH2A 1QIHA 2J3IA 2FMHA 4G0MA 3WIBA 1YDEA 1KAQA 3DCJA 3K32A 3N75A 4UU8A 3W77A 4WKNA 2ZYDA 4IH1A 3KL4A 1XQ9A 2ZUSA 1RI2A 3R7AA 5BNZA 3I62A 5JAQA 1RPNA 4GMFA 4B81A 2I4LA 4D4IA 3IDAA 4ND5A 3ZNOA 4Y2TA 5T4FA 2ID9A 4FE7A 5JDCA 1Y34E 2A9FA 1U80A 3FHLA 4QVKA 1TTPB 4YWJA 4AJJA 4OGWA 4BZQA 1ZQ1A 1SOUA 1SUCA 2H17A 3FDFA 1TUBB 4FCVA 4YRGA 1VLJA 2B83A 2DBVO 4L08A 4YO7A 3LP6A 1OX4A 3TZCA 4F4DA 4IDPA 3TVYA 2CXQA 3FD8A 1HYHA 2WAMA 1ISHA 3VO1A 3PF8A 1QH8A 2C5FA 5DMXA 1HETA 4J7XA 1NBHA 1YXMA 3FX2A 1Y48E 3CN7A 1ZKMA 3U1TA 1E2KA 3SYLA 1T25A 2I2FA 1XALA 1LPMA 1E1QA 4G0ZA 1YAJA 5ALXA 1IHYA 1QZ3A 3GLIA 2RBEA 3PXCX 5IBCA 1R4MA 2Q6OA 3ON5A 4Q39A 2P6PA 1UWLA 5BWCA 3R0XA 3CNQS 3PWSA 3R5JA 2R7KA 4WNAB 2H4XA 3FR8A 5TNXA 4ZJUA 5KREA 1N6OA 2ODEA 5AJXA 4GYJA 3PLNA 1QVWA 4IWNA 4DSZA 1C50A 4NMXB 4MQUA 4YMUA 1H85A 3OJOA 5DBOA 3V6MA 3BM5A 1UKBA 4WPGA 1PQYA 5EA2A 1QR6A 2FRDC 4KMMA 4GOXA 2N0SA 1YHZA 4D42A 4LGMA 4W6QA 1J1IA 5CYOA 1X7YB 3UY4A 5DI3A 3OMXA 4BO4A 4D81A 5K8IA 4JI0B 5EP3A 2BTOA 4C01A 2CLHB 2W0SA 4L5YA 3GEBA 5KOIA 1IAQA 3FFWA 4ZANA 3NETA 4EX6A 1KKLA 4RQTA 4HCJA 1UBSB 4BFWA 4W1QA 2YV1A 2J3MA 5J5CA 1N5JA 2B20A 4H7KA 1OBFO 4WUVA 3RS5A 5KDDA 4LF4B 4HTFA 4CM8A 5JNVA 3COJA 1D4AA 4K9SA 2AG1A 1ZH8A 1J24A 2W2LA 3DBHB 2XPCA 4J3NA 5IYZA 2JJYA 4E21A 2ZROA 3FDZB 3FXAA 4YXWA 2I7CA 5DP2A 2AW5A 2OCKA 2W58A 3F5MA 1WG8A 3ENQA 1FYFA 4KO8A 4LJSA 1CQZA 1UANA 3AVQA 3P2JA 4P3YA 1XV5A 3R5TA 5JCJD 5G3ZA 4IRMA 1MMFB 4AY2A 3LCMA 1YNSA 3BB4A 2XGMA 3RUEA 3URMA 3WS7A 4XASA 3VKUA 1AG9A 4R7TA 3IRVA 5JFGA 4W9RA 2D7JA 1RHRA 4MVJM 2CVZA 1Y6JA 7REQA 3WMXA 5LBUA 2Z3ZA 4EYGA 4DLUA 3WK4A 4NDAA 4Q6BA 3WIUA 4EKNB 1LEHA 4JL6A 3PXEA 3ZVLA 1SIOA 5BVHB 2FZWA 2XCSB 2VXBA 1U31A 4O4JA 3LDAA 3UW1A 4LVUA 4RW0A 2HIMA 1WD7A 4HDSA 3WMGA 2WM8A 1JLRA 4IICA 1R6DA 3PYLA 1GFIA 1P2UA 2PD4A 2O3JA 4H16A 1UJCA 4F45A 4WLNA 4RWEA 4ZCMA 5B30A 5FX2A 1U7OA 2YINC 4YMGA 1VBKA 1TF5A 2HXSA 1KF0A 4GOOD 3WXBA 1NTOA 3L6DA 1IONA 3K6RA 4AG3A 3JQ8A 1RRGA 1RLIA 1MUUA 4W5WA 2JGLA 1MEJA 1PWHA 4IH9A 4UVDA 3K30A 1V26A 3IR5A 2X7HA 2A0WA 1T9DA 5KSWB 2XMBA 4FOTA 1XTBA 1RWOA 1F12A 2I4NA 4NF2A 1OC4A 2J4FA 4KAXA 5B1EA 1TC1A 4UUPA 3VH3A 5JXWA 4HFNA 1DC6A 1MEOA 1V11A 2JI8A 3IBSA 2Q7DA 5BN3B 2RH9B 2ENUA 2F6RA 2X8BA 3DTYA 1SQSA 3AR3A 3MM4A 4HEA1 5BNFA 1SXQA 2XLCA 1EE1A 2OR3A 3CZ5A 4P33A 2ZIVB 2QIOA 3LCJA 3H16A 2EFYA 3WK9A 5JI3E 2PX5A 1OU4A 4LE1A 1K6MA 1US8A 4PAMA 4Q15A 2OPHA 2HRCA 4WXPA 2QTZA 3WDKA 4P5DA 4Z4IA 3HZHA 4BPRA 4DQVA 5JRJA 3C3XA 3PQ3A 1MT0A 3Q87B 1AX9A 4ZT2A 3WGYA 2IELA 2OXIA 1UKVY 2H85A 1EVQA 3DOJA 4V1CI 4I1UA 5FBHA 1FMLA 3OTOB 3C45A 3PUIA 3QPBA 3JD0A 4GICA 3T3PB 3MJEA 3R9IA 4ZO9A 1T9GS 3L84A 3UCFA 4C4SA 2R68A 3LC0A 4JMLA 3RYIA 2B1IA 3BJEA 3C4QA 4XGIA 2G5PA 1DO8A 3GUHA 3T9EA 5HS6A 2OV6A 3SZOA 1ZNYA 5AXDA 3U44B 3NONA 1KVRA 3NU1A 1KTVA 3ZTTA 5IKXA 4U2FA 3ZDAA 1MVLA 3EARA 5DEIA 4XA8A 4Q05A 5LZ4A 5E6SA 1R0KA 1KI8A 4MIOA 4TMKA 5I7SA 5FOVA 1EGHA 2AJ8A 3KJHA 4AVYA 3UNXA 2ZWPA 4PZCA 2PGXA 1M1NA 1TF7A 2H1HA 2ZJ3A 3EQZA 1E61A 4I5FA 4MNTA 2XUQA 1P2SA 1CNFA 4YBZA 5LWHA 4O2BB 4N0QA 1I2DA 1N3YA 1UP7A 2EIHA 3HCWA 4YBRA 3DYBA 1EG2A 1DRKA 1MXHA 3GRFA 4KNVA 1XZNA 2XZPA 3M5CA 3N2GA 1SBCA 4HZUA 1J9EA 1F51E 1L4UA 2A59A 2YYZA 3LBAA 3NWBA 4UMDA 4DADA 4DJ5X 3KXLA 5CHEA 5DHPA 3P9CA 3AO0B 2P0YA 4E4YA 5CFLA 2B2NA 3DKRA 1XNJA 4WLEA 2AKEA 4ZCSA 1H2EA 2QA5A 3EGXB 3B6EA 1U9JA 2JGKA 4WLOA 4YRJA 3ROMA 2ZT7A 5JYEA 1SXPA 5E8JA 1OXTA 3MYRA 4IV5A 1EGQA 3A32A 1T2EA 1KAOA 3T52A 1LQUA 1HA3A 2WSIA 1XDUA 2JGDA 2RGGA 3ITKA 5AW4A 1N2HA 1EX1A 2J0UB 1BS1A 2GYUA 1AXGA 4ZREA 2HDHA 4GL4A 1LPOA 4K6GA 3UATA 2JI4A 2QR1E 2IUUA 1SO8A 3GZTB 1GN9A 1Z8HA 2AMYA 2PN1A 2R00A 4FXOA 1W47A 4LGYA 4XVHA 2CHGA 2ZU6A 4YRZA 5BWLA 4NDNE 5K2OA 4N41A 2OUIA 3E2MA 3CLSC 3U7EB 3ZWPA 4IEIA 4YCLA 3ZCUA 2OP1A 2EDAA 3CRW1 3IJPA 1O50A 5IN4A 4ZOLB 4YO8A 2IUFA 1DRWA 1KO4A 1V43A 1UBKS 1VE6A 2CV1A 3LHDA 4IP0A 4DABA 4LRWA 5LD2B 4S1VA 2O19A 4UREA 2F62A 2X0EA 2Y2UA 2GN2A 1NA5A 4ZQFA 6NULA 1E63A 2FPKA 2W90A 3Q3CA 1HT1E 3GBVA 3HB0A 4K6MA 4UU0A 5DTIA 1U9IC 2FLVA 4OK3A 5JFTA 4YI5A 5FH9A 1FSGA 1RHQA 4N8SA 3HDGA 4PRKA 1CJVC 2OTCA 3ZN2A 2P79A 1BZYA 5HTOA 4HAOA 4HB4A 1D6NA 2BJHA 3MTEA 1ID1A 5LQUA 1G9TA 1Z4OA 3OOHA 4IHJB 1MNQA 1WDLA 2YY5A 4NZ9A 2WAOA 1M75A 4TKUB 1USIA 3WGLA 5HZGA 4FXSA 2IXBA 2M9MA 4ZD6A 3QEOA 3RSSA 1PVVA 1Y9ZA 1FSSA 2X4DA 3TLYA 4AG6A 2I55A 2C7GA 3CX7A 3I34X 2BVNA 3X43A 4O2LA 2I4TA 3A1CA 4O59O 4TXHA 3UJNA 3E0QA 2B4KA 3LA6A 4FMPA 1OXMA 3IA2A 5IWAB 3BD7A 4QTXA 1JPVA 1Y5HA 1E1MA 2QD5A 3JQAA 4I5DA 3TKLA 4C4RA 4G9EA 4QREA 2O6HA 4AP5A 1QK4A 4X20A 4YQFA 5A06A 1AQUA 2PT9A 3N0WA 1EK2A 4EG0A 2AWNA 1JQ3A 3RTBA 1AD2A 1YB7A 1QP8A 1RWQA 4IWXA 3A11A 1QNFA 1AS2A 4F8JA 3TEMA 5CCEA 1F8YA 4ZMSA 1FU4A 1BGXT 3DKVA 1SD1A 3PHBE 3DB1A 3KLMX 1RXSA 1DPFA 5C2JB 4IOMA 5JQGF 1MGOA 2O3SA 1Y8RB 1Z3CA 3GRPA 4ROSA 4ZA2A 3L4JA 2FSGA 3BUSA 4WERA 2IS6A 5K25C 2HEGA 2QRJA 1ZMTA 3HMKA 3R3WA 1X3LA 4XFKA 4BJ6A 1XLTA 2VH2A 4NJEA 1MJGA 5HF8A 4UMEA 3HK2A 1OA0A 4RKYA 5EHGA 3U9SA 5IULC 2PLNA 4AMZA 2G36A 2C7RA 5LM3A 2ZJYA 5G0UA 1GYRA 3EGIA 2P9QA 4BVFA 3WLSA 3KK0A 3N2NA 2EP7A 2YASA 3K0AB 2EERA 3GLGA 5B53A 5CW1A 1N6RA 1S01A 1HEUA 2VDMB 1PDWA 2Q4DA 2QW1A 1P7VA 5BQ3A 4KE7A 4OHPA 3PIRA 1DI0A 1EBBA 1VJ5A 2FY8A 3OIYA 1EQAA 2WWHA 1NQXA 5C8XA 2FDCA 4EECA 1XA3A 1DKLA 2NYAA 4MZDA 1GA1A 3IURA 4OYRA 1A2QA 1NI5A 5CLGA 5AWFC 1QFZA 1NATA 4HV4A 1VIMA 3W2FA 2G7MC 3ANYB 4HAYA 4Q1DA 2ZYSA 2D5LA 2PJDA 1V0JA 4WNYA 4DIUA 4E3ZA 1KIAA 3OF5A 1SVLA 4WNIA 3DTTA 2B61A 3GLVA 3NOOA 3FAZA 3IQGX 4D8VA 4HNHA 2W83A 4R41A 4X1IB 2Q8QA 1P1HA 3BWBA 5AVKA 3O95A 1P3DA 5BSRA 1EGMB 3RS3A 5BP7A 5AJVB 1UWCA 1CXZA 3G5MA 1FE8A 1GSOA 1JWBB 3HKDB 1VLQA 4G4SO 3UWOA 8ATCA 2H4ZA 1MF7A 3KBBA 4M1YA 1DQSA 4UBJA 1NM5C 1FEZA 3QA9A 1Z47A 221PA 2PZJA 1VP3A 2CVFA 1CEYA 4E46A 2FSIA 1BMDA 2FCRA 3I92A 1JIKA 3G0IA 1P7PA 2UVQA 1TK2A 5DTEA 4Z9BA 5KVCA 2WF8A 4RTOA 4NH0A 2DKOA 1NYLA 1RABA 1X7XB 3GJ0A 3GLKA 4US0R 4Y2JA 3TDHC 4ZAYA 2I2CA 3EEYA 3I37X 3ZTYA 4PN7A 2H1FA 3ZHUA 4BMCA 1DC7A 4I81A 1ZD4A 4UBLA 5UKDA 1WHTB 2FUKA 1LGYA 1B4DA 3UENA 1PJQA 1UK8A 2GA8A 2WKQA 2BP7B 3A6DA 3PTLA 1V8PA 2VT6A 3W7AA 1DEOA 4JLAA 1RM0A 3KXDA 4JELA 1X0XA 5IDVA 5E9WA 1XP8A 1ZU4A 1A98A 2BSAA 1L5ZA 2R85A 4KLCA 3SKVA 4D02A 3K6SA 1GZHB 1VSQA 1LNZA 2ZVQX 4HQLA 4JXKA 2RC3A 2VAWA 4N0PA 1BEUB 1WUTA 4EY5A 5J2UA 1Q0HA 3A28A 3KP1A 4RORA 1U3WA 5EE0A 1NP7A 2ZRHA 1TAUA 1WCIB 3CPEA 5HMMA 3ZCTA 2IWRA 1ZP6A 1Y8CA 1PAUA 5BMVF 1SUFA 4PYMA 1NVGA 3JALA 4KODA 4QGGA 2PRJA 2BEVA 2NU9B 1NFFA 4GI5A 8ABPA 2NTNA 4P7BA 3CUTA 5C53B 1XTTA 1XTJA 2BONA 2D74A 1LWNA 1E9SA 2JZNA 1M7GA 2NSYA 2WIBA 1J5PA 2A1UB 2XOKD 5BUZA 2Z30A 1J06A 3BQMB 1BE0A 3QE3A 3J81A 1O4WA 4YCJA 3VZPA 5IARA 5K3CA 3K9NA 4V2IA 3TH5A 1MJHA 3FBWA 3UUEA 1LLDA 2PRSA 3E82A 3A6JA 4J0EA 4V38A 1XPOA 1TA9A 1R12A 3D3JA 3T5TA 4DWVA 4UTNA 3D3EA 2CHEA 4KW7A 1DS6A 4LV6A 4ZP1A 4JYPA 2OGWA 3VNRA 5JHHB 4H7EA 3E4DA 3GRKA 2E4VA 3I9NA 4X61A 5EAIA 3TZHA 4C2BA 3VUFA 4AC9A 1SUEA 3KOMA 2P1ZA 3JYQA 3SS9X 4QHTA 5EJ6A 1F8FA 4B40A 4DV1B 3LUPA 1UBLS 5E38A 1IQPA 4O1IA 4NPAA 3KM0A 2P2YA 1CJUC 2DMRA 2IYFA 1U0SY 4G24A 2G1PA 1U1IA 3FCXA 1Q1NA 1U9ZA 1UDAA 1CUSA 2A9OA 3N0VA 2WSBA 3TQSA 2J3EA 1SXIA 2KWIA 4P3PA 5I6DA 2J7PD 1K6JA 2H4FA 4ZGBA 1GUAA 4Q7MB 1WMAA 3TFWA 4Y9RA 4D6PA 2BJWA 3QXGA 1NI4B 3OE5A 3ZHZA 3RADC 1JXAA 2ERXA 1ISIA 4FOOA 2GSWA 2UVPB 3A7DA 4V3BA 4EHNA 5BN4A 5K0FA 2ZRDA 5H68A 3OO0A 3G7UA 5HX7A 5IDXA 2QNBA 1EE9A 1XD9A 2QXYA 4HDRB 4DA7A 2GEBA 5F33A 1ECBA 2W6QA 3E53A 2FEPA 4X9XA 4CCAA 1K6XA 3AY7A 1EUDB 2QG4A 3EXHA 1JYEA 4M7WA 1OIXA 2XNDD 1SULA 3QVKA 3GA7A 4WGGA 4EJSB 1UPCA 2JCSA 5HJ2A 1E9CA 2QRKA 4BVLA 1QHIA 3UK6A 4H7HA 5E1DA 2XGJA 4RZXA 2PO7A 1J9ZA 1K8XB 1G9XA 2QP9X 4B6SA 4WVLA 4OLAA 4WH0A 2DLNA 3M6MD 2ZTHA 4DT1A 4D1YA 4X1YB 2O8BB 3MBIA 2VBCA 1XLUA 5SV2A 3O3CA 4E51A 5J4VA 5A7FA 3ESCA 4K5QA 3HXOA 2EJVA 5EYPA 1P81A 3DYVA 4KI0A 4EVQA 5IF9A 2VKQA 4MPRA 1JZSA 2NU7A 3HEAA 4QPZA 1OZHA 2QR3A 5EHIA 4HH4A 3ZD7A 1EIZA 1CUUA 5CB4F 3I1FA 2R7MA 5ECDA 1CY8A 4LSMA 2AGVA 1YCGA 1ZUIA 2VT3A 1GV0A 4OMCA 2XUJA 1AC5A 2DP4E 4QOEA 3T4UA 5JEEA 5LR6A 2WFAA 4A8TA 4YT4A 4DLXA 3AG6A 1BE1A 2AA3A 5L7YA 3RS2A 4QG3A 1KI6A 4RIEA 2OWDA 2BPOA 1UL1X 4Q82A 1BVUA 1TXGA 2QRZA 3AH8A 5J4YA 1KBZA 1SKMA 1OA1A 3CY6A 2CVPA 5EJ9A 1C8KA 1D7OA 2VNKA 2HO4A 2X6TA 4MITA 5H3CA 1GD1O 1TM5E 1X80A 4KWEA 4BCBA 3TOSA 2FW8A 3B1VA 1XVIA 2ZAOA 3B3QA 4CN8A 2Z5VA 3ESAA 3SZ3A 1F1BA 3IIJA 1L1EA 3TEFA 4EARA 5SZKB 4QTUB 2GJ9A 1XUOA 2D62A 2IEYA 2IOHA 2PMFA 2PYZA 3PFGA 3R1IA 4QASA 3V7NA 5GONF 5JJBA 1HNZB 2OHHA 3NVMB 3ITDA 2PTGA 3DT8A 2PL1A 1E7SA 1ZAYA 4PGFA 3AUXA 1XR3A 1BU8A 1DAOA 3G17A 1OGJA 5EVCA 2YFQA 3R6LA 4BNMA 4E1VA 4F3RA 5IUNC 1XD2A 3LXUX 3AB8A 2ST1A 3IT0A 2OO7A 3DV0B 4P5EA 1ODCA 1T5SA 2X19A 4PC2A 2ATVA 4CU2A 1T9ZA 5JY6A 3UMGA 3NM4A 7YASA 1JJFA 1S2IA 1W76A 2EX1A 2RONA 4Q4HB 5KOHB 3PHHA 1FNBA 1QH1A 2AG0A 4IY4A 3OZUA 4G36A 5JCJA 3SKXA 3ZCRA 4B7CA 2YMPA 4P4TA 1E2HA 4IOKA 2PUTA 4QFDA 2VF7A 1NX9A 1AA9A 2UZ0A 2XH8A 3IDZA 2YW9A 4Y1RB 1IVSA 3TAXA 4BRZA 3NUQA 2QUAA 3M70A 1APBA 4DNXA 1RXYA 3O8LA 3TGLA 2VH1A 4FJ2A 1R0YA 1SHZA 4WRRA 2BHTA 2CJPA 3C6BA 3IGFA 4RDXA 4B7XA 2IGTA 3DMFA 1F2UA 4AZWA 4GDMA 2PUFA 3BRQA 1TJ4A 1U6IA 2P6RA 5E2BA 3WGZA 2AS0A 1SY7A 4M8IA 2YQ5A 2JEYA 3QU4A 2Z0MA 3SG0A 5FNVF 4E5DA 1E8MA 3TAUA 2YZMA 4FEAA 2Y1LA 1A1SA 3PHJA 3AM1A 2BHLA 3ICPA 4DREA 3JZFA 4DSOA 4EY7A 3W5AA 4G4JA 5K45A 2V7UA 3KSBC 2IEDA 5LKRA 4EPYA 3DDSA 4L4SA 3IV9A 1HF3A 4FHEA 3PEUA 1LUAA 2R751 1MW9X 2V5AA 3EZGA 1CUIA 1YIOA 4N7BA 5FPSA 1WZCA 4LK3A 4XM0A 5KYTA 2HHHB 3KR2A 1NQWA 4ZVSA 3HXQA 4L3WA 5TARA 1KJ9A 3IP7A 2WB4A 1CE8A 3HDYA 1XQXA 1EDZA 3FWYA 3O9ZA 3PHCA 5EJ7A 5KQLA 5CDFE 3A2NA 4K9LA 3RD5A 4NE2A 4OB6A 5BN1A 1JI3A 1II9A 3F7NA 4O25A 3EIXA 3FM9A 4LJ4A 4XDYA 4D9JA 3ORFA 1NOJA 2OO3A 3VZRA 5JAMA 2YWCA 3SL7A 1W0KD 4MUYA 4OP2A 5JLAA 2KS6A 1MAWA 2QLNA 2O2CA 5JSYA 4EI8A 4XVUA 1VCIA 1FLDA 4IJQA 1IUOA 1GIAA 1WUHS 3B1ZA 1UWVA 1K3FA 3DXXA 3WL4A 1BVRA 2FH5B 3JPWA 3M3PA 2Y1KA 4GYWA 4JROA 4M89A 3LBFA 1N6PA 4OHXA 3G02A 1PV1A 5KI6A 3UJ6A 3QJ5A 2YN2A 3N2YA 3VGPA 3X2EA 5JNSA 3GU3A 1NW5A 2ZE6A 3O4GA 3TS1A 1YO6A 3V8NA 4D56A 1B8NA 4IH4A 3KUCA 1LDBA 4ESYB 2IYRA 2IZ7A 2VJNA 2UV7A 4NOCA 2GNPA 2X41A 3MUEA 4Q1FA 4D99A 2PUCA 3L43A 5ALHA 2OB2A 4MS1A 4LJAA 1O57A 2G72A 2Z57A 3IR6A 3HYLA 3OCJA 4IUDS 4PLTA 4D4GA 3P71T 3ONWA 3AOGA 4IHKA 4TS1A 2XV1A 4U2CA 1ORIA 3JYNA 5K22B 3QYFA 2QGZA 3L7IA 1P2TA 3G1UA 1G3QA 3B51X 1OH6A 3FTNA 3AVOA 2V7XA 2QD2A 3H05A 4YPOA 4TV8F 1QU2A 4DLPA 1EP2B 1L5FA 2VC2B 2VZLA 4JR0A 4N7RA 5TGZA 3AVUA 1P9LA 2EFEB 4HDMB 4LI3X 1E2EA 2II6A 2W4IA 2NG1A 2WJAA 2XMSA 3H1AA 4PW0A 1UPXA 1W2GA 4PC7A 4Q1EA 1IY9A 3U7QB 5KU7A 5L3SA 3N5KA 4MKGA 3SD7A 2E82A 3AFGA 3EDMA 5LQSA 3ZGYA 2HCFA 5B36A 2P9MA 2AB0A 3V33A 1NDHA 1U0FA 3SOZA 4PVCA 1J21A 2R66A 3W5SA 3AKZA 4UE6A 4HATA 1K5PA 4ZMRA 1KL7A 2J6BA 3CLRC 4QFMA 1P17A 3VR6D 1VL5A 1KS9A 2O20A 1DUSA 2DT5A 5HW0A 3ROEA 4B3HA 2QM0A 5KMGA 1CVIA 2NVUA 1YTUA 1QK3A 4IDEA 1AO0A 4F96A 4NAUA 5DM2A 6LDHA 5H8WA 3EEIA 1CEXA 4ZRMA 3SEFA 4IQ8A 2ZJ4A 4DA0A 4F2WA 4R84A 2HHJA 1GUBA 2QVCA 4HOYA 1PNOA 2GAAA 5LC1A 4MRPA 3VDXA 2XEXA 4RUKA 2PU5A 3CKKA 3W8RA 4BFTA 4GH5A 4K05A 5KNCH 3MGBA 2BKLA 3LVFO 2VK1A 5I7RA 4G65A 4NDZA 1TZMA 4QU8A 4RXUA 1RIFA 2LUOA 5J43A 2H4HA 5JS6A 3V7UA 1PE0A 1C7ZA 3D2AA 1EUQA 4KLRA 3AF6A 1NF2A 1QF7A 5PNTA 2OLJA 2P2NA 3GMDA 3PDIB 3R5KA 1L7PA 1RCFA 3DAGA 4M60A 3KYDB 4DPLA 2BE9A 4GKAA 4OF4A 5AM4A 4CEIB 5MFPA 4B79A 3AL3A 2NUTA 1OLUB 3JCZA 4JDPA 4D9CA 5JYCA 3PFIA 4PR3A 3CRVA 3PC6A 2YJ6A 3T7AA 1O54A 1ODLA 2A4MA 2R4QA 3EDOA 4G5HA 4NR0A 4BNXA 5A1JA 4GLFA 2PS3A 3ZY6A 5LQAA 5M5BA 1XTUA 1H9AA 3B1XA 4YQZA 1WP9A 3PTAA 4PZ9A 4PEVA 5HG0A 1KJZA 4S0ZA 1WU7A 3PR1A 4IUBS 2DH5A 2ONJA 1RC1A 5B6PA 3F73A 2W42A 3UOAB 1HOXA 2BIFA 3C1UA 3FPHA 4ZCPA 5JADA 2VJYA 3LGSA 1C7JA 2B35A 3I3OA 4YRQA 2G1JA 4CV3A 3NEPX 3LY9A 2O3TA 3PFBA 4B3JA 1DPGA 2D8AA 2R6DA 3IPRA 4CTMA 1LDEA 1JIXA 5T7BA 1G8FA 1K9SA 4UNSA 2IYWA 2E9SA 1KYWA 3QIVA 2H07A 3ZIDA 4MVJI 4Q66C 1W35A 4FFRA 1SZCA 4TOIA 5FEMA 1U4OA 1Z08A 3QBVA 3OM8A 3LP8A 3MXOA 3ZWBA 1PFYA 3OPQA 2X6QA 4I5EA 3VYWA 4A27A 2HR1A 1Z74A 4QDZA 5IKEA 2ZZMA 4QYIB 1KK3A 4JAVC 4OA5A 5LNK6 3FMFA 3N87A 3PHGA 3GWZA 4J0IA 3MG9A 3H4TA 2UV4A 1R3UA 1F0NA 2VWPA 4IDQA 1F2TB 2HWXA 5JTTA 3LDHA 5KHAA 1WEKA 3AVVA 1XYVA 2ZB3A 2HSEA 3GBSA 4L4ZA 4LXGA 4X7RA 4OX9B 5JZMA 1HYBA 1OXBB 3TMKA 4BNZA 2I2XB 2OYSA 3O2JA 4WK0B 4MUHA 1MVOA 1N2JA 5EHNA 2F3UA 1A9TA 4AECA 1FRQA 1CR2A 3PE3A 721PA 3G5LA 3OX4A 3QYAA 4J4BA 2Q4OA 2B69A 1A04A 1NJ1A 3AT1A 1IOWA 1DXQA 1N0HA 4BQRA 2XR1A 3I9JA 1E96A 2IS1A 3JZAA 3V00A 4XQGA 1QV7A 5AVUA 3QJYA 2OA0A 1G9SA 2VJCA 3M4ZA 4KQKA 4FZ3A 3SM3A 2YNMD 4IILA 2QTAA 3THXA 1SURA 1T29A 3A1DA 5IBQA 1WMDA 1WOMA 2Q7OE 1TVKB 3PNOA 3LH5A 3NASA 3TPCA 4G5GA 2PWPA 4NE7A 4YJGA 3LYAA 2W2XA 4HMOA 4BNYA 5HUHA 1FNCA 1KJWA 2OCBA 3AESA 1QHXA 4JEUA 1AUOA 3I6IA 3ZDDA 7MHTA 2F9LA 2C5BA 1Y6QA 4H7DA 5JSQA 3HBAA 1SIUA 4WXMA 2YXLA 4HLQB 2H2HA 4JGBA 4ENVA 5K23C 4B82A 1MC8A 4XE5A 3RKSA 5FPKA 1DG1G 1FVXA 1ZZGA 4LMBA 4LFBB 1V47A 3IVGA 4IIVA 2CFSA 3DAHA 5TDHA 4F86A 3LO8A 3GUYA 4IDDA 4AUKA 1FTQA 4EHFA 3ESXA 2D0OB 4KXUA 1GGNA 2WKRA 3K0KA 5JS1A 1R9JA 1OSNA 3VNVA 1RBYA 4TVBA 4QYXA 5ARCA 2HJSA 3WO0A 4UZSA 3P97A 2YMMA 1N2SA 4K40A 5EWLA 1ULHA 2V59A 2PQMA 3WOHA 1KZ1A 1EFKA 4OJYA 1WD5A 1VKZA 4DMLA 4WAUA 5I7FA 1QC5A 1WQ3A 4F3CA 2JDID 3VGJA 1TK9A 4RS3A 1GFZA 4YFYA 2G28A 1NXVA 1QB8A 2RG1A 4IGEA 4C7OB 1PFGA 3K9WA 3CMMA 1ULUA 2DPLA 3BAZA 4JXZA 1N3BA 3FYUA 2G9NA 3PFFA 3JQFA 5IH3A 1M2EA 5K6TA 1HR0B 4QRDA 4ZOEA 4CM9D 1YQGA 4DMFA 3I39X 5JRDS 1KYIA 4RO0A 2JHCA 3DZGA 1ZRMA 3J80A 1QGED 3KBOA 1W1IA 1XAGA 2EZ8A 4PR0A 4RF2A 4OU4A 1NUQA 2BELA 2Z08A 4TN5A 3VPHA 4MGIR 4HPWA 4ZARA 1E3DA 2RAUA 2OBLA 1PGNA 1TVMA 4J0GA 2TRSB 5BSUA 3LW7A 3PF9A 1XZFA 3E48A 1TGYA 3FWZA 3ZQKA 3JQBC 5EIAA 2P90A 3VNSA 5FR2A 1XCOA 4MWEA 5I4CA 1QIFA 1PR5A 3BD9A 3MPUA 3EVZA 3B8HA 4WKBA 1T3ZA 2PT5A 1BD3A 2JH8A 1SNYA 3MTGA 3DT6A 3K0EA 5AM1A 2L82A 1PF7E 2WJZB 4PPGA 2HFJA 3WL3A 4YRAA 3RC8A 4UVHA 3H2SA 3SK0A 1SC4A 2YYYA 3K1AB 4AJ4A 1EXMA 1QG2A 2XOKA 3W9BA 1R50A 2RI6A 1IWOA 5G40A 4CKWA 2ZYWX 4COKA 1E7RA 1HDZA 1PW5A 1Q16A 1ZL2A 4M1MA 3CUUA 5JS2A 4BMOB 1JEEA 1F20A 4MYSA 1RTTA 2FK8A 3ACBA 4BRUA 3SQXA 2WHPB 3U4DA 3JQBA 1ECPA 2JHAA 2XTAA 3AW9A 4DJEC 5AKXA 1NLUA 5K20A 3LT0A 4B2LA 5TPWB 5AVRA 4RPHA 3TTYA 2FXVA 3ONEA 2OORA 3HH8A 5IIPA 3MWDB 3NKLA 5HBRA 3RRFA 5EXPA 3UJ8A 3WIVA 1SHJA 2XHZA 4UD2A 4OYLA 2NXWA 2LCQA 2B98A 3WP0A 3GLFE 2H5JA 1TYCA 5EJIA 3WYCA 2A3NA 3PNYA 4LHSA 4GE3A 2PY6A 4ZEMA 4OMUA 1CVLA 4GKVA 4BRWA 3HKBB 3INRA 3TIFA 4NG5A 3IKMB 3L0PA 2RKBA 2X2PA 2ZJZA 4UCXA 2ZANA 5CG2A 2GJKA 4FKMA 2DTDA 3TL3A 4E09A 1C4KA 3QEMB 4G8BA 4KQ2A 1BIFA 3FZYA 2PZLA 2ZRAA 2RAPA 4NNPA 4Y6SA 2BKEA 4AO8A 1MT3A 2O5EA 3DWEX 5EXSA 3H5NA 3ZYCA 3PR3A 4DCVA 3U7JA 3EQ8A 1RFGE 4IIYA 4LCEA 5DO9A 3RK1A 5C1OA 3C7AA 1MX1A 3LQ4A 1T4BA 2B21A 3KQLA 3VTZA 3ZDCA 1Z4KA 3IIMA 1DC3A 3EK2A 5JAZA 3Q6NA 2QTTA 2TECE 5EGSA 2G4VA 3R0IA 4J90A 4UULA 5GJBA 4YRDA 4QUHA 2AK2A 3WKEA 3NYIA 3PNQA 4R1NA 2J9RA 4CR7A 2YUIA 2QPOA 2XNDA 3NDIA 3PVSA 4ND8B 5DK6A 1QU3A 2X58A 4QIHA 3R7NA 2NOAA 4EL0A 3MINB 1ADCA 3M6IA 4HH1A 1LPPA 2GZHA 3EVDA 3OP4A 3UICA 3H5OA 1KMCA 4EEXA 2FUCA 3WKBA 2AZDA 4ER7A 4DGQA 2HA7A 3KZVA 1W36B 3L07A 3IEVA 2I4MA 5TVKA 5EXEA 4YWHA 3RWBA 2QH1A 1USVA 3WAKA 2FOLA 2YXNA 3QFCA 2H6EA 4XQ9A 1Y7LA 4QOFA 2Q6LA 1A9OA 3DL7A 1QHYA 1HLDA 1U5AA 3IEXA 2IYNA 3ND9A 1TL7C 2E2WA 3C8HA 2PG3A 1H66A 4FMCB 1BX0A 4ITVA 3SQLA 2WFLB 1W88B 1E6LA 1JNXX 2AI2A 4W5RA 3CH7A 5C51B 4IVQA 4O8CA 4DR7B 3RVPA 3U7RA 1ZEJA 3W6PA 3RSHA 3BTVA 2I78A 3CZMA 5FWXB 1YB4A 5AUPB 2JFBA 1N36B 5CFPA 2ACKA 2ZE8A 4OXXA 1YOVA 4I36A 4N47A 2Z98A 4WNAA 4BBJA 4OEHA 1HORA 3EZYA 3NPAA 4EKIA 1K0FA 3Q0EA 4MKHA 4Y2RA 4RS4A 4U8GA 4U63A 3R23A 2QX8A 4X62B 4NCNA 1U90A 1XHLA 3MGGA 3O21A 4MCJA 4Y9DA 2KLBA 3TVDA 4OMDA 3IQHX 3AHEA 4B3DA 2BFNA 4FYVA 4G1UC 3RIXA 4Z9XA 4AN0A 3EYWA 3UF0A 1JDTA 1X7YA 1GT91 4V1CA 1G0OA 5FIUA 1U1EA 1LPSA 4O9KA 3KU4A 1U2ZA 2CBGA 2OVFA 3I1JA 2MIIA 3Q72A 4FUTA 4HDNB 4MWTA 5G0WA 1GNSA 1M5UA 3L8HA 3REQB 2ZSEA 5KHOC 1N77A 2NGRA 3OQ1A 4GOKA 3BE4A 1PFKA 1QYVA 4GOND 4Q1VA 5TPZD 4MWZA 3RYHB 3FIJA 1IZ0A 4FB4A 2GK4A 3UB2A 3VVBA 2V0GA 3H5WA 1G7SA 3RH0A 1UODA 1U9CA 1QONA 3FSGD 3IOBA 4EJMA 4A6XA 1M9NA 1NQVA 4KTTE 2JLSA 1JMKC 3GJ4A 3D6HA 3W5VA 4C89A 3DBHA 3SIWA 2DY1A 5AVQA 1KSHA 4HN4B 1GGKA 4QSHA 3FDZA 4DE5A 4QOSA 5ICEA 4BO2A 2ILVA 2WIJA 3FVRA 4BO8A 5IM4F 3P96A 5DCLA 3TQHA 4C5CA 4Z86A 3VTKA 4DWOA 3H2HA 3T7KA 5BT9A 4MW5A 4C0HA 4DVJA 2YW2A 3PRHA 2WUWE 3IEIA 1JAHA 4D4HA 3N2IA 1V8FA 4PSUA 1JF8A 2AFIA 2BLNA 3QU7A 1L7NA 4M37A 4WY2A 2CD9A 1L5LA 1N0WA 2WLSA 4FONA 4GO1A 4EPWA 2GN6A 2Q6KA 2QZ4A 3KUKA 1TTHA 3N1UA 4ETNA 5J63A 2UUAB 4KX5A 1PT6A 1O5OA 1XKLA 3HM2A 4RGQA 2VJMB 3GZNA 1Y1TA 2J4DA 3BDAA 2VFAA 2H8KA 2GKGA 2FWBA 1Q3HA 4X6YA 2PIAA 4UHBA 3SF8B 5BVHA 1L5QA 2OM2A 3V4RA 4EO7A 2WP8J 3DDJA 1CZKA 3B3FA 1W5FA 2FTKE 4RCVA 2C78A 2OBFA 2VDJA 5F1YA 1SKAA 1ILEA 1IVYA 3DZKA 3IAS6 5BWMA 1E99A 2PU7A 3VO8A 2WSLA 4TKVA 1BC5A 4NJOA 2HRBA 2JJ2D 3X1YA 3K1JA 3G2MA 4QQ8A 4A6DA 4Z7QB 4BBPA 2XE7A 4J0QA 1NW9B 1F3OA 2WA1A 2WIDA 3WLNA 2H7XA 4UOZA 1OPRA 4E2WA 1GL7A 3RFVA 2CNDA 1J49A 2JCGA 3GL9A 3WOVA 2J09A 1KU0A 3DEHA 3MBKA 2NO1A 1YS1X 2VK2A 1YFZA 1W0KA 2HNBA 1Q91A 2YZ7A 3H87A 3TQTA 1JU4A 1YCFA 2JVKA 2P9TA 3CG0A 2C2YA 2VTBB 3O8CA 4D5EA 3QPWA 5BUSA 4KQCA 2FUEA 4J9VA 3QNUA 3N0TA 2PUJA 5I4IA 1RWKA 4P4LA 2E48A 2F1HA 1LA2A 4TLEA 5CBPA 1S2NA 5G1NA 1QRSA 3RU9A 1Z4JA 1P3JA 2DF8A 1DDGA 2J0VA 2G88A 4LWZA 5ADVA 4D4KA 1ATIA 1U9YA 1JMVA 2WNIA 5DCYA 1QIJA 4EZEA 5FL3A 1P72A 3G9ZA 4O4IF 1N7GA 2UYYA 3OHSX 1T1IA 1IG0A 4TT3D 3C2QA 3GZJA 5A7GA 3KZNA 4C0JA 2VNJA 4QJIA 3MOGA 2ZKIA 2BV3A 4QGFA 3IUNA 4CR6A 5KCMA 2VT2A 3IEPA 3LQ1A 3HB4X 1L8AA 2DB3A 2HQRA 1NF8A 3U44A 4ETIA 1FS4A 2R8RA 1DC5A 1X1RA 3CINA 4JVOA 3BZBA 5F1OA 4CEHA 2YDYA 1E8DA 3H5AA 4E12A 4CMAA 2LKCA 1N33B 1R4AA 2OLEA 3HJFA 3T95A 4F85A 3U31A 3H18A 3UG6A 2QN9A 3B1YA 1SVSA 2X0KA 3F47A 1UINA 4QD3A 3ESYA 1FPQA 1HFWA 3TK1A 2P78A 5AMXA 2WIFA 2ZP1A 1HM5A 4D9EA 4BX8A 4OQYA 1ZD9A 1ZOPA 2HMYB 4PIMA 3GLSA 3DA8A 3UMFA 1Z8FA 1TPZA 1LQ2A 2PWYA 3QG5A 2JCBA 1C9YA 1FXWA 3BTSA 4URZR 1EFUA 2TYSB 1PW7A 3DZDA 1Q0RA 4REQB 3B2EA 1Y5IA 4L9AA 2WF7A 3KHKA 4WI1A 1PGPA 2HUPA 3HY3A 3NHZA 5A3VA 3ENVA 4ZQCB 4E15A 1AKTA 3EGXA 3SPXA 4IQGA 1WW2A 4HZIA 1JTEA 2QVBA 2YWJA 1NVXQ 1P29A 3QBEA 2O7RA 1GQYA 4RIGA 4EVIA 4UQPA 5FUXA 3QOWA 4IXWA 5K3FB 2WMYA 4AJNA 2R1TB 4PO1A 3EXG1 3O2SB 4JP8A 1MAHA 2R6CA 5BYJA 2XRFA 5LD2C 1CDEA 1NYTA 1KK0A 4KHZA 1YQQA 3IA7A 4FMDB 2Q5EA 4CMBA 4EY4A 2SCUB 3LBYA 1S9DA 1KY3A 3KZKA 3EEBA 1UIMA 3NTOA 2ZYIA 3C39A 1AHHA 4GNRA 5JVDB 3SZGA 3W1VA 2ZETA 3AOEC 1KE1A 1ZCZA 4CWAA 2NSDA 1Y8AA 3L7KA 3MHPA 1RYZA 3PUXA 1AV6A 1VI5A 1KQFA 1CRWG 1CIVA 5K0JA 3FMIA 2NXEA 3JQ7B 4PQFA 1P9NA 4XJSA 1W4BA 3ELBA 1NF3A 1W34A 1ELOA 1XRQA 1XZKA 4KIFA 4ZOLA 4B4OA 2JLQA 4HWOA 3HGTA 1SKBA 3M4NA 4F3KA 1O6FA 2I65A 1W5AA 3KLPX 4AIIA 1SMKA 1U0EA 5F1KA 1L5SA 1SR8A 2FN9A 2LV8A 2WU1A 3D5QA 3PL5A 5MDHA 4RVOA 4ARZA 3ENZA 4WZAA 3E18A 4IHJA 1MN6A 4HQ6A 1OYOA 2AHRA 4TKUA 5KJFA 1LSOA 3ZS8A 2VYND 4RZ2A 4ZYTA 2DQKA 3WLJA 5A7HA 3DZFA 1QV6A 4QJ5A 2GLTA 3IBCA 5HNKA 1IOZA 4M0DA 5AKHA 1N6KA 4RJTA 5CB0A 1XTVA 3BH7A 1KMNA 2VSFA 4TV8B 4A82A 5FPQA 2Q6TA 16PKA 2QJOA 5JDIA 4Q6WA 4HX5A 3H9QA 4Q3BA 4MR7A 2FEOA 3A1EA 1U8UA 3DAFA 4MR8B 2Q41A 1AURA 1T2FA 3BIJA 1M54A 2WTNA 3Q9NA 1Q7TA 3RGGA 2IY8A 2QRHA 3BQNB 1P8AA 2X42A 2PVCA 2GD1O 1EEXB 3IODA 2YCBA 5B58T 4HNRA 1N2BA 1DG3A 2GWRA 3HCRA 4JASB 2FEKA 1ZIOA 4QG7A 4UFPA 4RM2A 1R16A 2RK4A 1Y8RA 4PC6A 2IHBA 4D0SA 4NRDA 4DWWA 1A4RA 1HLFA 1XELA 2HC9A 1TCUA 2HCRA 5EE9A 1TD9A 1OGYA 4FWIB 1XEAA 2WQ7A 3K09C 5HKKD 2P5TB 3AHHA 3K1YA 3OBBA 3T7JA 4G84A 3SJUA 2B6NA 2WU3A 5K3AA 1C0EA 2QTLA 2YNMA 1H5QA 3RQIA 3F96A 3U39A 3ZXYA 1T4MA 2GF2A 4BNFA 2YXPX 2ZCUA 3DNMA 4DARA 3K0AA 3KQSA 4DUPA 1QX4A 3TCXB 3A3NA 2VDVE 4K1XA 1YR7A 2V4MA 3FW1A 3ND8A 3WWYA 2CXTA 2F17A 2HT6A 5JCOC 4WKGA 3JQ9C 4P81A 3RYCB 3K09A 1KVQA 2V9PA 3EGOA 1I5EA 1OVMA 1V71A 4MJXA 5DW0A 1FB5A 3QUSA 2GN0A 3WTBA 4MVJF 4U0KA 1U2RA 2RAVA 3NBQA 4LC9A 5M7EA 2E3JA 1N5LA 4DLWA 1XXHE 2O1WA 2WBLC 1N5OX 3M81A 4WN3A 3KAQA 4RGBA 1JIUA 1YKGA 4D6YA 3AF1A 3K0SA 1ICIA 1BXKA 4UUQA 4I50B 4EFMA 4F4UA 1FRFS 2Y2VA 2PO5A 1ENOA 1NVWQ 2HZ7A 2VQSA 2G77B 3CISA 4GX0A 1M0TA 1R0SA 4K9RA 1RCUA 2VN8A 3LL4A 4X1IA 3ZU2A 4BJHB 2NO9A 4UM5A 2PNJA 3AKEA 3HWRA 4DMHA 3U6BA 3TJMA 3SXJA 5CT5A 2ONKA 3W2IA 3ZD8A 2JDIA 3OIFA 1W4CA 4YUWA 1S3IA 2FW0A 4GPEA 4KYIB 4R6WA 3TRDA 3C3WA 1KU6A 5F78A 2YV3A 4CM9A 5KEIA 3OFJA 5LB2A 4E07A 4CQNA 1SC6A 3X2FA 1BA3A 5ALUA 3SFVA 1I1QB 4K28A 1E5VA 3KQUA 1X7XA 1L7OA 4FWTA 1R8XA 5EEGA 4BE4A 4L0QA 3NBZC 1M76A 4BFYA 3ASVA 3JY6A 1WHTA 4A1OA 1ZK3A 5ECWA 2ZJ2A 1ZSVA 3OQNA 3WYAA 1YZ3A 5DJ5A 1KEZA 1A27A 3V48A 1WTCA 4EGSA 1ISJA 1A5SB 3NV9A 5AM5A 1YKSA 2BE7A 4J0JA 5B37A 3MZ0A 5ALMA 1F7UA 3OIGA 3M89A 3THWB 4EY8A 5KX5B 3PD1A 4QUBA 2WYHA 1DT5A 1RYFA 2A67A 3TLGB 1WCIA 1D1PA 3A8TA 4ZOBA 2PD3A 2HOQA 2EYUA 1E6WA 4MIYA 4OI2A 3DHVA 1P8JA 2Q07A 4FDMA 4IDHA 4J49A 4ZRDA 5BV8A 1ILWA 4R1QA 2NU9A 1GQSA 3H5IA 2O4CA 1CUYA 3FJOA 1T1GA 1XWFA 2WE7A 1WSDA 3QMWA 1WKCA 1NASA 4RIHA 1OH7A 4TRRA 2CCGA 2G17A 5ILQA 3VPAA 1NRIA 1NJ6A 4XGKA 4FMBB 1V9CA 2K7ZA 3GRRA 3T12A 5HVNA 1GLVA 3K2VA 1RI3A 2CDRA 4PO3X 2DFKB 1LVGA 2ATCA 4MW6A 4EO9A 4MGKR 1YJCA 3G5UA 2MSCB 1UQUA 4GOLD 4KIUA 4MS4B 1IOLA 1L5MA 2PV7A 3OFKA 4BDSA 3V8BA 1T5BA 1SCUB 2I76A 1NJ5A 1MV8A 4LTDA 1YULA 1KFJB 3DZHA 1OOEA 4TTAA 4QA9A 1GCAA 3DUFA 2V1UA 2QTWB 4YIHA 3RVDA 2C98A 1FRZA 1P5RA 1FQKA 2JLCA 4YONB 4OV6B 5ILOA 3ZQJA 2NNWB 2CVQA 1Q74A 3TX6A 4HZGA 2OQRA 4RV9A 4UAVA 1XF9A 4PV7A 4RIFA 5BSEA 4ZN6A 1SELA 2JFUA 4M22A 5CT8A 2I8LA 2Q46A 2QROA 1MB4A 4MLZA 1BQ4A 1JSXA 3PC8C 4C04A 5IJZA 1H4QA 1FFYA 4KV9A 2QUHA 1NP6A 4P31A 1XCMA 3PI6A 1VE7A 4QJ3A 3RRNA 4C5BA 4GXTA 1S2GA 3F3YA 5JC8A 2JFZA 1PR0A 5FR1A 1NI4A 5HE8A 1TPYA 1RKXA 1IHXA 2UVPA 4BFLA 4RVCA 1R8JA 3LXXA 4OY3A 4I9FA 5GJWC 1QMPA 1O96B 4PO9A 3PE4A 1RJWA 2DETA 1FFGA 4UKDA 3ZY3A 1Z73A 2RCNA 2DEUA 2NSHA 1EUDA 3BB3A 3EZLA 4KLNA 4CLOB 1EFDN 2PXAA 4BB9A 4EJSA 1X1BA 2G71A 1A95A 2COUA 1ZNWA 3UJPA 2B0CA 4RZSA 5D5HA 1GG5A 3ZVNA 1Y6GA 3TIIA 2Z3VA 4IY0A 4KQWA 3T41A 1XRNA 1ULZA 3R8XA 2R62A 4J0FA 2CMHA 2PEYA 3HJRA 3LF2A 3N6VA 4NHOA 5BSMA 5B1YA 5JXJA 3L0BA 2O8BA 1NBME 2I1QA 1ZHOA 1W36D 2V9ZA 1QP4A 3L8GA 2GEDA 4LJ9A 2AUTA 1PUXA 3M5WA 4JP1A 3NWEA 2EFHB 1UP4A 2NX2A 4OHWA 5LIRA 4P98A 2BBWA 4H77A 1QSGA 1T5HX 4BNUA 3MRTA 3SC6A 2B9EA 3HDJA 3LX5A 2F55A 5C5DA 3KSDO 4XI9A 3P0EA 3EAQA 3HCFA 1I2AA 1RRPA 3UWKA 1JA1A 3A14A 3BHIA 1J0BA 4D8XA 4IIGA 1P4HA 1HDEA 2W6NA 1S4MA 4DCTA 3KPCA 4YALA 4JUAA 3OKFA 2PSSA 4BUZA 3MGCA 4R0MA 5CX1B 3OWHA 3E7FA 3MT8A 4BMYA 5IDWA 3IP9A 4MHOA 2ZM6B 3F67A 3IQIX 4EI2A 4TYWA 2NTVA 2AJTA 1ZNZA 2QZPA 1G21E 3H9EO 5CITA 5IF3A 5CLLA 5F4ZA 2EX4A 4DWJA 3V9PA 4MRRA 2NAPA 2C3YA 3OC6A 5JZOA 2HCJB 1XRRA 2CDCA 3NHYA 5ER9A 5AXBA 1UJBA 4URFA 2QX6A 4P0TA 3EN0A 1GXSA 3DD5A 3GAAA 2B8WA 3K5WA 2PBZA 1GV1A 1NVUQ 3BC1A 3QF4B 1N7IA 4JWKA 4LMPA 1K7CA 3WMEA 1W49A 2G5GX 3DV0A 3S27A 5KQPA 2BOVA 1S3SA 4Q7JB 1I10A 3ZH9B 2YHAA 5J4LA 1BJKA 1B0ZA 1BHJA 4YMIA 1RHMA 1AU9A 1UP6A 2C3OA 1M10A 1UBCA 2GBFA 2HCTA 2WEKA 1EFVB 3IP6A 1FCJA 3SE0A 1V45E 1X42A 2CD7A 4L50A 4Q01A 3VU9B 3H2ZA 1WHSA 4S2EA 1P39A 2DPXA 1V5FA 2O2XA 3HJGA 3CPSA 5ARDA 1VHLA 4OYHA 3P32A 1DWUA 4NK4A 1P74A 2AVDA 5A4MS 2FMFA 1GU7A 1CIJA 4KR6A 1QH0A 3DVRX 2PUWA 4R51A 5L3ZA 1P6QA 2DHQA 4G1EB 1IEXA 3KQOA 3ZE7A 5FEUA 1I80A 3FPFA 4J03A 3FMPB 3RARA 2OV3A 1FUIA 2YS7A 4EG5A 3AI1A 4RH1A 1TEHA 5TT0A 5EZYF 3A04A 4DV4B 4UQLA 3FSRA 1TJYA 4EO4A 1YZNA 1OZFA 3GDGA 4C6HA 1NW4A 2D2IA 2JJ2A 1QH9A 3S2UA 1V35A 4O1HA 1WBJB 4BVHA 2XI4A 4YR9A 1AKNA 2AX3A 3NBFA 3WVNA 2BHRA 4PBTA 2CLLB 2RC5A 5ALSA 1RDFA 5LJLA 2W8ZA 5E4FA 4JODA 1QHEA 2P91A 4WNCA 1UBEA 1I2MA 3K3PA 3KSZO 2ZJ8A 1EJBA 3NHUA 3O93A 4OK6A 4W7IA 1ULTA 3KV3O 1GQRA 4F4IA 4OG2A 4F2PA 2QMHA 4FD2A 5D84A 3PT5A 3IT1A 4FCWA 3LT2A 1VP9A 2BZSA 2L19A 1O8CA 3DSRA 3NBUA 3ZK9A 1QQ5A 4CGZA 5KTMA 5F4BA 4NAVA 3NYQA 3LQYA 1UXOA 4TSFD 4GWKA 5FT9A 4EHBA 2ORVA 3PIDA 3ZCVA 2GPAA 3I2JA 4WBNB 3R9WA 3USES 2B2CA 1C3OB 2I29A 3P94A 1WZ2A 1TNDA 4LCJA 4DTCA 4UD6A 4QAQA 4PHHA 3F6SA 4TT3A 1HZZC 1K7XB 4NONA 3FWKA 3LZ6A 3NHBA 4HDOB 2IFTA 3NT4A 3OTIA 3LLMA 4PSVA 2UZ4A 2COEA 3H2IA 2R87A 4XWWA 1Q6YA 4NNOA 1B8VA 1ESDA 3ZJ5A 4B7AA 5HF9A 4BNDB 1FU7A 3N8DA 5FHQA 1GNRA 4XLZA 4AS2A 4WY8A 1PV4A 5T57A 2VTDA 3G5TA 4ZJPA 2ZSAA 4REMA 2D59A 3QX8A 4OREX 2WYVA 5EE5B 3M4XA 4HWPA 4BQQA 4JP3A 4Q5IA 3U7QA 3O26A 2Z9CA 5JE8A 3BXEA 5CLQA 1BEEA 5COBA 2Y1FA 4CKEB 2NXNA 4QO8A 3G2HA 2BMEA 4NJMB 1E4VA 2OK8A 1C3LA 1BJRE 2GVNA 3H1PA 2GK6A 3CZPA 4DEYA 1KEEB 3KEMA 4PZEA 4BJ1A 2EP5A 4LA4A 3UN1A 5IDQA 4QYMA 3GT7A 3PPVA 3ADOA 2BC9A 3V4VB 1X15A 1LI7A 2RBKA 5JLJA 2CV2A 1GZUA 4L85A 4V0RA 4LRUA 4LZLA 2W8BB 2CGEA 2ZLBA 1SKYE 5GIPE 1SVKA 3CX4A 3E58A 1D2GA 1MNAA 2AMLA 3GDOA 3MCVA 4AJOA 2QVGA 3OVMA 3GZ4A 1XEXB 2XDAA 3R6TA 5FLYA 4J2OA 5DHSA 3NDRA 1R0ZA 3S55A 1ZQ9A 3GVHA 1VSUA 3A6HA 3HBMA 4B43A 3P9PA 2HUNA 1TA0A 2OKGA 1MA0A 4J6EA 1OFIA 2FQ1A 4BNNA 3HRKA 1XXLA 3EFHA 2X2OA 3S40A 4CLEA 4R05A 3TIXB 6GPBA 1R64A 4DNQA 1CJKC 4FYHA 1Q95A 4BC0A 2VJAA 1I7PA 1J9GA 1Z25A 3PDIA 2DGDA 1RYEA 2QW8A 1OLOA 4J16C 1ZO8A 4IQFA 1JA0A 1VI6A 2ZI5A 2JD1A 5EOVA 4PPYA 1XTPA 5AFSA 4GSKA 4AZTA 5LQCA 1HDYA 3C8MA 2Q27A 2OCDA 2PR2A 2ZOSA 4MDHA 5E4JA 2CMFA 4IRUB 1L8XA 3GGOA 4U00A 2D1YA 2OK7A 1ZUHA 4BFZA 1TJ5A 1O7JA 4MPJA 5JD3A 4W5TA 2K7FA 2W70A 4Y1FA 2E87A 3QW4B 3T6KA 4CF4A 2BMFA 4WN9B 4AY3A 5T6BA 2QNRA 1FW8A 2IP2A 3B6IA 1EFCA 1VJRA 3Q1KA 2IKSA 3EEOA 2OBNA 1Q17A 3SNHA 1GYPA 1WDWB 4TRNA 4DBVO 2PZBA 5JQWA 2BMDA 5JZVA 4Q3DA 4F6RA 3U19A 4LEIA 1ENYA 2C1EA 1RYMA 1UM9B 3ULKA 4XIJA 1UBGA 4BLUA 5KWJA 4Z2YA 3P5SA 1OT5A 1MENA 3L6RA 4HEJA 4KQFA 5AJZA 1ISPA 3ZV5A 3PICA 4FM9A 4TTJA 4XWTA 1O94D 1T1SA 2VYNA 4GR9A 2A3RA 2E1PA 4LWQA 5TQ2B 4JOSA 1NI3A 4ABYA 4JC8A 3V1TC 1IG3A 2PUVA 5HUQA 4NCXA 1NE2A 3NT5A 5DZSA 4PAGA 3TL2A 3U81A 3GPCA 3OX1A 3R7WB 1R6TA 1TUEA 3A3KA 4M1SA 1D04A 2H9IA 2YVXA 1GUYA 2OHJA 3E61A 4KBFA 1C2YA 3PEEA 1MPXA 2OZKA 3Q7SA 5AH0A 1N1EA 2G6BA 5KJEA 3BK2A 4QYIA 2ADFA 3QWHA 3W34A 1RXEA 3EIOA 4BLWA 1N9GB 4TMXA 2C0QA 3A6LA 4YCMA 2DQZA 4ASUD 3HO1A 5E8RA 2XZDA 4FGLA 3TZLA 2D0DA 1PNRA 3OD1A 2B5OA 1SBQA 4QYSA 4HUTA 2QUBA 2VJDA 3WB9A 2G9VA 4Z9FA 1NMSA 3D2BA 5T64A 1ABFA 2G08A 4AICA 2IV2X 1W46A 3T3GA 2FPSA 5GGXA 1J39A 3CF2A 1PKXA 4CM4B 3L18A 3ZHTA 3F4BA 2Y1EA 1N3LA 3WGQA 3AJEA 3MRSA 2ERCA 3O0DA 4H3SA 3T3MB 1DLJA 1YRHA 1HEIA 1WPGA 3MMXA 1IHDA 1Y7TA 1XNHA 4MTCA 3VR2D 5EXDA 1F0KA 4V0QA 2EOAA 4JD5A 2H65A 5HKKA 1QG6A 2CUZA 3GQVA 4NCIA 3ZU5A 1GZDA 1JI0A 4I4TB 1Z5UA 1N9ZA 1L4LA 1XCJA 3I04A 1JYFA 4NSNA 3RIEA 2AZXA 2P6MA 3NBXX 5K2MA 3UWDA 3UYKA 3D8SA 1TECE 3AM3A 2M6LA 2BYTA 4B33A 4JT2A 5FTJA 3O9MA 5A1TA 1TVKA 1UAYA 2CN1A 1XO1A 2OOXE 2GPNA 1WXHA 2JH9A 2NU6B 1JZQA 1E1LA 2O14A 2VSNA 4RC9A 5GQSA 1GPDG 5BSVA 4NBNA 1Q1GA 1G8PA 3L7AA 1N1GA 1SC3A 2ONYA 3PNLA 5EE3A 1FYEA 3L3BA 4F3TA 3AHJA 1I2CA 1G1MA 1PWXA 2HA5A 4NYIQ 4D4LA 5EIFA 5K3EA 1Y89A 4JI6B 1CJSA 1N5KA 2ZKLA 3ZJVA 4KOAA 1Y3AA 2PWAA 1WS6A 1GKIA 3IQZA 1FDOA 4W6ZA 2JG3A 2AZ4A 1GU0A 2J6CA 3EZ6A 2EJCA 2AKYA 3I4LA 3TDNA 1O95C 1NXQA 3ASUA 1QAMA 3KB1A 2WA2A 3RSCA 3TFQA 4O2AF 1B7GO 4GXNA 2IDKA 4TROA 5LQDA 3NDBB 2RJNA 3JRWA 4JSRA 3KQNA 1XG5A 2P4SA 1YRAA 2J07A 1D9ZA 2AOTB 4NYMQ 3C1AA 3ZY4A 3GCXA 1KFBB 3ASZA 3DFIA 4PRYA 3CM0A 3QVUA 4Y9TA 5AKIA 2X7XA 2JASA 1ADYA 4PBRA 4QPDA 4YS6A 5B3AA 2GFQA 2YMLA 2VA8A 1GUFA 4H9GA 4F9FA 1E5XA 3ZDQA 4C7OA 2QTRA 4Q4AB 2VPYA 3PG5A 2VHZA 4CN9A 4UHEA 1ULSA 2DRIA 1N25A 5MN4A 1E0DA 4BP9A 4Y1GA 1UDWA 1F8XA 2W0MA 3L0SA 4HFJA 1KYZA 1XTSA 2ZRIA 2PSHA 4TYYA 5KYGA 4YA6A 3VSDA 4NMHA 3M8KA 1MOSA 3BWMA 3KXIA 2FFRA 2RDMA 3EH2A 5J1TB 3UTCA 4HXFB 1Y7HA 4R0VA 4DDMA 3D3QA 1ZC3A 1QTQA 3C97A 3WFZA 3UJCA 4WL0A 2GEUA 4E33A 4EKGA 2I3BA 2FAXA 1DRUA 1MABB 4JFAA 4KYVA 3W8FA 1DB3A 4PC1A 3TBFA 1LZLA 3D59A 4I1PA 3AYXB 1JAYA 1UT6A 3NC0C 3FNQA 5FOWA 2P9ZA 3QZUA 3ZY2A 2A0YA 4GR5A 3NHWA 2XMPA 1Z17A 2ZIXB 2J3DA 3CX6A 4LNAA 3OE4A 3X2SA 2QSYA 1C9EA 2VRBA 4Q1BA 2GBLC 1N0IA 2ZI9A 2GMWA 1IUPA 1HLGA 2EATA 2NUPA 2PCLA 1VKNA 3I9KA 3HB9A 3K1AA 3KT8A 1MB2A 1UKAA 3ECSA 3HJHA 3QI7A 2V96A 3W05A 1W25A 4X65B 1H2FA 3PUVA 1KFKB 1NMEA 5I9IA 3Q5EA 2Z8YA 3CO5A 3OTWA 1Q1AA 1Q50A 2GDJA 3E3LA 3LHSA 4JL5A 4MV9A 3WKAA 1G59A 1XEWY 1KAMA 2CMGA 1ZNQO 3B7PA 4QGBA 2IU3A 3PSHA 2AXQA 3UV3A 5TPWA 2GILA 2LIVA 3NUZA 6REQB 3R7FA 5HSGA 3OP1A 5IT9A 4BV2A 1M34E 2XECA 4TLBA 3MWDA 4Z54A 3T5AA 3ZY5A 1SQFA 5B3KA 3OIVA 3GLHA 4PFSA 1DL5A 1IBSA 4GM4A 4OQLA 1Z6PA 1EK5A 2P11A 4JZKA 5CFQA 3BQ9A 4IO1A 2HBZA 1TMOA 3VJMA 3HKBA 2BCEA 3CEPB 2AEMA 2IUSA 1L7BA 2AJCA 2XADA 5TEVA 4C7KA 1YDFA 3PDJA 4O3FA 4B4VA 2P30A 1AXEA 2REXB 3QEMA 3R7SA 3AMVA 4AY4A 4U4AA 1S8OA 5JCPA 1L7XA 5B4TA 1DV2A 4MVXA 1ONSA 3VX3A 2PLAA 3QF7A 2C5EA 2HSDA 3LWBA 3QOXA 1HXHA 5KOHA 3RG2A 3FHCB 2HF2A 1KPHA 5I9MA 2G9ZA 4N65A 2XAUA 1RHJA 3L0CA 3L6UA 3EBPA 4JFRA 4MVJH 2AC4A 4BIMA 2OD2A 5IC5A 3K31A 4D8TA 4CLXA 3PJRA 1SBNE 3PQ7A 2DUUA 4INPA 1CD5A 1XHEA 1V1MB 2VHWA 4ZEWA 4AIRA 1KJIA 3FWRA 4I99A 4P58A 5DBGA 4LRYA 4L0CA 3WBBA 2F43B 5ALIA 5DTMA 5FJIA 1JKJA 4I55B 4OH7A 4QDKA 4O4JF 4NI5A 3FLBA 2IDMA 5FLKA 1MV5A 4UXIA 3LV9A 4GZLA 1WUYA 2PIDA 1ONBA 5I7VA 2YHIB 4F7WA 3KELA 3BXOA 4EEZA 3J7TA 3ZHVA 2PGJA 3AJDA 3BXXA 2DUNA 4QDXA 2YWFA 4CW7A 1E58A 1GL3A 4CHTA 3L1VA 3K2BA 1Z0SA 2QY6A 2XVAA 3OZRA 1QHSA 1WXEA 2OXEA 4OATA 4QC2A 4MV1A 4PWZA 4PG4A 2IEAA 1IBRA 4QICA 5KDLA 4JUCA 2OHXA 5FQOA 5I8PA 2WFLA 1DBRA 1W88A 4R81A 5J9FA 3LMKA 3LC1O 5F51A 1Z45A 3FZEA 4HR7A 4BOYA 3RUPA 1YU6A 2Q9CA 3WLKX 1YJAA 4OKIA 5FWXA 3F8SA 3PUYA 4IIJB 2OMKA 4Y7CA 1KNQA 5P21A 5IEJA 4RHUA 3U4CA 3U2QA 3H1GA 1BA2A 3E9CA 3LHIA 5BMVA 2P35A 1IZ7A 1NSTA 1S89A 1W9HA 2Q49A 4WINA 2OLKA 5G1PA 1QR2A 1NNUA 2HADA 4W9NA 2XWJI 3RS0A 3DLPX 4MP3A 4YI3A 1UH5A 1ZFNA 3NEJA 1GA6A 2EGHA 1L5WA 4DIBA 3OA0A 1V41E 1Z28A 2ZI7A 1SBTA 3HPQA 4N7JA 4N49A 4WJKB 1AOXA 4MYTA 2XYQA 4LZPA 2ODBA 1U98A 3W2EA 1H6CA 1HEYA 5L4NA 2M6RA 3NG1A 4Q16A 4EVSA 4XQ0A 4LBZA 1T2AA 3REQA 2UUPA 4WE3A 2NV0A 3D0QA 2AD5A 4TXNA 2QJWA 2Y92A 4NYIR 2DWOA 5AW0A 2OHVA 5IVPA 3D0RA 3NI2A 4FK8A 2JF0A 3K2QA 4YFVA 5EZSA 2HBQA 4NWIA 3NCTA 3L4KA 2NYUA 3QHAA 4DYVA 1H2HA 3G82C 3SAJA 3R5FA 3RV3A 2I71A 3IKTA 4AZVA 4AZSA 4O4LB 2O0KA 3FF1A 1K7YA 1W0CA 2WZDA 3A3OA 4AKSA 2VPPA 4KXVA 2IF0A 3WC4A 2J5KA 5G3YA 5JPDA 5EUBA 2E18A 3KG2A 4NCJA 1LJUA 2I4IA 1MG5A 2PSJA 2CYAA 5FCDA 3RABA 3T7EA 1DZ3A 5JXHA 5KQMA 4NYMR 3EDQA 1VMKA 3FMGA 1O97C 2VP3A 1ZY2A 2VPXA 2PUGA 4HEQA 3T15A 4FINA 3LCVB 3CONA 5CDHA 3CNOA 1U7ZA 3KVYA 5D1NA 2UYGA 2I8CA 1HL3A 1YRYE 3RSGA 2BBOA 3SF8A 5CFZA 4GKBA 4HTAA 5MHTA 3DFZA 3U37A 5F9FA 3UGQA 3HU2A 1R37A 3OTHA 1FNMA 1X7GA 2A4KA 2V3VA 2VWQA 2XNJA 3HCBA 1JHZA 3D6AA 3K0BA 5AVTA 1W85B 3THRA 3WMFA 4CKXA 2EQAA 1GZSA 1M2VB 3FGZA 3LYLA 4IVPA 4U9UA 4EG6A 3SCZA 1C0LA 2G67A 1I3KA 4TLAA 3RVRA 3OT4A 1D9XA 5HIAA 3UPTA 2YH2A 1RPJA 3PXDA 4FGUA 2NYVA 1U5CA 2G0TA 2Q1XA 2QMQA 1AB6A 3ML1A 3TR6A 3WZ2A 4QX6A 2HMSA 1DMSA 4LFAB 5D8DA 4ENQA 5A02A 1SXJE 2VHQA 4X5OA 2FQQA 2BI7A 1PTJA 2B7CA 3FUWA 5CH8A 4GL2A 5FL7D 5E6UA 3C0KA 5ALJA 2JIOA 3R75A 3EBOA 1YD7A 4JC5A 3PKZA 4Z8XA 3GELA 1JHQA 3DV2A 3LQKA 4HGYA 3OH8A 1XZCA 2O1SA 4I6EA 4JLSA 1U7TA 1X1EA 4G97A 3TZ6A 4DFDA 2VTBA 4E3WA 5DDIP 1QKIA 1G5FA 1B16A 1BDBA 1RI5A 1S02A 1XQ1A 1C9DB 2C2ZA 2AF3C 2Q29A 3OZFA 4Q3EA 3WHIA 2PJZA 1DKNA 3AI3A 1A77A 4R8SA 2AC2A 4RD1A 4BNVA 5JD4A 5KC9A 2NZ8A 5KTYA 2IS4A 1JTFA 2ES4A 2ZI3A 1G3MA 4M8NE 4F60A 1A9RA 2SICE 2PMKA 1UFRA 2I7DA 4JUFA 4UAGA 1O6ZA 3N39C 2NADA 3U7GA 5C7LO 3OPMA 1JAXA 2ZRMA 3I5YA 4N18A 4ZQEA 1E9AA 1VM6A 1EP3B 1I4TD 2XQJA 4CL8A 2VJOA 5DLQC 2YQ4A 3RAEC 1PJBA 3K4PA 4NBUA 1SRRA 3B9RA 2C7QA 1VLHA 2OB1A 1OWPA 4FR2A 1JR3D 5U1PA 2X5NA 3UIEA 1YFLA 2Z6QA 1QJCA 2W2VA 4DHEA 3G2OA 2WD7A 4PHCA 2CEAA 4JQOA 4TL9A 3HNPA 5AIBA 1COZA 1V25A 2FG7C 2V55B 4BEJA 1QO0D 3VR4H 3GEDA 2YYSA 4KQHA 4GHWA 3FF4A 4W63A 4PS0A 1KY4A 2PUHA 1K88A 2R8OA 3AY6A 4FEGA 3NV7A 3COYA 4JGIA 3PQ4A 1IDOA 4OXYA 4Q24A 1KO5A 1LF0A 1UAGA 2D2VA 3U4AA 2D5CA 3DOHA 1J0DA 5DM70 3EOAI 1I4LD 1SJ9A 4XPIB 4B3RB 3AR4A 3NC4A 1DADA 2Y0PA 1SA0B 1CP2A 2HV8A 2VAVA 3NC1C 3P9IA 3RAPR 5CFNA 2Q5IA 4ZMBA 5K0EA 3R0ZA 1G4HA 2P3QA 2LXNA 1I13A 4REQA 2Y1XA 2NZ2A 5CW2A 3AJAA 4YCNA 1FDRA 2RHMA 4WADA 1ZM2A 3KKKA 1A9SA 1GITA 2DY0A 2V7BA 4JJ4A 3CSDA 1Q92A 3G2QA 3H1EA 4D25A 3RIMA 2G25A 4KLZA 2VLIA 3H04A 1LSUA 5KAMA 3I8XA 1XA4A 3NDPA 2IDJA 4M87A 3VHQA 2PL9A 3TUZC 1GQ2A 3G2NA 5AXAA 1USKA 1WVGA 2GBGA 3GFGA 4E88A 2RIFA 4DQKA 1BW9A 1H0KA 4HT3B 1GL9B 1OVGA 1QBGA 1A9YA 2YVQA 5EIXA 3F7TA 4UXJA 5K3FA 3H5TA 3MWFA 1TKAA 5F23A 1AGXA 3KVOA 4DUZB 2NO0A 4J0HA 3TXYA 3L4BC 1P6XA 2HSZA 4JT9A 3PUWA 4IIDA 4B3XA 2I3AA 4GMHA 3KB2A 2R8BA 5A3SA 2R6AA 4F6CA 3KYJB 2SCUA 2R5WA 2E4UA 4FFSA 5DASA 2HH9A 1IN5A 4BCDA 5JVDA 3CZRA 4I3HA 3HS3A 3HVRA 4PQEA 3JR3A 5TSDA 1P73A 4EQZA 5CA0F 4FUQA 4YMSA 1RTKA 2FVXA 4QXMA 1Z5VA 5E6RB 2WJPA 5C9ZA 3DXZA 3JQ7A 3VV2A 4AU1A 1MCZA 3I45A 4J3JA 4ZTBA 4LN1A 1F6BA 2IPLA 4MWOA 1XPUA 4H1HA 4EENA 1JDJA 3QA3E 2BEWA 2V0NA 3JQGB 2PH7A 3L4BA 2RAFA 3PFCA 1DE0A 4Y6GB 4ZI7B 1K8QA 2J41A 2KI5A 2BDUA 2PT6A 4KGVA 5DW3A 3JTEA 3U3KA 3UTDA 4TWZA 2R96A 3HCOA 3JAKB 4P4UA 4N6GA 2QORA 4E13A 4EMSA 4PTYA 3I76A 3NHLA 5DGIA 1O94A 1I94B 2BBTA 3SSNA 5I9TA 1A4XA 4R8RA 4ZT6A 4A8HA 2B8JA 4GGOA 4QXPA 4RPJA 1CEQA 1Z62A 2VR1A 5F7JA 1G291 4J4HA 2QZ9A 3EASA 1EHYA 2DU8A 2PS1A 5PGMA 2FLKA 3PP8A 1MFZA 3IP3A 3RS9A 1C5KA 4B1FA 2GAJA 3M6FA 2D2XA 1VHWA 1AIPA 1THMA 4OKSA 1VTKA 3GFQA 4TV8A 4MYUA 1CR1A 4OIMA 2CDAA 2F3TA 2KJQA 2WJWA 1DCKA 1YVRA 2BGTA 2ZRPA 4RNDB 5CA1A 4ASUA 4CE6A 1GPWB 1JEAA 4MR8A 4CV0A 1JA9A 2UXBB 1I32A 4AS3A 1CTQA 1GFSA 3RK0A 3UT5B 4MLCA 4R8MA 3L6CA 1B73A 4F9GA 1RP1A 1PK7A 5LB4A 5HTKA 3AX6A 1N7JA 1O6BA 5J2UF 1DKOA 2CNBA 1BWSA 2X9LA 2Z2JA 3HB1A 3L8EA 4PLVA 5JFOA 1LBHA 4DOMA 2H1VA 3HZZA 1C1DA 1YZYA 2EJBA 4JB2A 4UBNA 2NSJA 1N57A 3VR3D 2P6OA 3VR2A 4BNHA 1GKUB 4BUJA 2J31A 2NP6A 4GMXA 2ZIAA 4GR4A 3ZV7A 3AUKA 5LZ7A 1JEDA 1K6EA 4BIIA 3KYBA 5CJPA 4NQZA 4XD7D 3DF7A 2D1TA 4WK2B 2ZE5A 5DYYA 4EAQA 5JMOA 1FMFA 2YWRA 4HHEA 3F9CA 1FYWA 4J6FA 2Q45A 4MIEA 3AUAA 3EC2A 3CNLA 3WNCA 3OY7A 2XUFA 1P0IA 2ZJ6A 5K7SA 1D1QA 1U4NA 3HMQA 1BFDA 1NLMA 2FPPA 4ML3A 1ZLXA 3RFFA 2GRJA 2XVYA 2H2IA 3PCRB 5IXYA 1C80A 1ZUWA 2JI7A 2PKXA 3LY8A 3DFUA 2D1RA 3BX1A 1R6AA 3DNPA 4IDNA 1TRHA 3RYCA 3ZJYA 1YV9A 3EX7C 2R5FA 1GPBA 3N2KB 1U8FO 4C22A 1C7EA 1IHPA 4L07A 3UCEA 3UW3A 4ZC8A 1GTSA 3UJHA 1Z2AA 1OAOA 2LPMA 1PR9A 2DCUA 4QULA 3S3TA 4CR8A 1H3NA 5JMWA 5K0SA 2Q2OA 3A4YA 2FFAA 1F48A 2OEPA 2AMFA 2VF2A 2WD8A 2X8JB 4QODA 1U8XX 3D8TA 3ANLA 2GPTA 1Q84A 2SBTA 1TM3E 2C7OA 3LX4A 3DHWC 4TXMA 1RXWA 3K8QA 2WTAA 1DQPA 5IVHA 1VPDA 2C99A 1T15A 2YVLA 1DEKA 2ZJFA 3FCOA 3TTVA 5D00A 1RFLA 4ENPA 4Q21A 3RS8A 3D0OA 4HXYA 1SQGA 1VJ1A 1ZD1A 3D6NB 1DQNA 1WUKS 1M2JA 1PWYE 2SKCA 3FCAA 4AUMA 5FV4A 4KDCA 2IYAA 1VIYA 2UV8A 4QTTB 1MBZA 5CP8A 4UDXX 2AQ8A 5KC8A 1CUDA 1C8LA 3EF3A 1ZIYA 3EIEA 3KO8A 5SYNA 3OE1A 3PDHA 4HAZA 4N0MA 3VOSA 4BVKA 3ZNQA 4OUDB 2LD4A 5MF6A 4KFSA 4FC7A 1SOWA 1Z0JA 3ELDA 4UVEA 1OXXK 5FPTA 3MCTA 2DHDA 3JW8A 3DBOB 2PZKA 4X7PA 1WQ1R 3FOBA 5F2NA 1XRJA 5CIQA 5K0CA 5F5LA 2FHPA 3RHZA 4KX3A 4RZHA 3RBAA 1A7AA 4AZ3A 3EC1A 1CR