4L28A

Crystal structure of delta516-525 human cystathionine beta-synthase d444n mutant containing c-terminal 6xhis tag
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
507
structure length
493
Chain Sequence
b'LWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFNQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQMVFGVVTAIDLLNFVAAQER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystathionine beta-synthase
publication title Structural basis of regulation and oligomerization of human cystathionine beta-synthase, the central enzyme of transsulfuration.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 168
structure length 493
sequence length 507
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.22: Cystathionine beta-synthase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 4l28A03
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l28A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l28A02
3LHHA 2GN2A 2QRCE 2CLFB 4O9KA 5C3UA 5KZMB 4D9NA 4IY0A 1X1QA 1PWEA 3VSAA 1J0BA 4L0DA 2YVZA 3FHMA 3KPBA 4IY2A 1A5SB 1K8YB 1KFKB 4WX2B 2D4ZA 4HG0A 3CEPB 3LV9A 1P5JA 1VB3A 2ZY9A 2EMQA 2C2BA 5DBEX 1WTCA 5BW6B 1TZKA 2ISQA 2Q3CA 4D9IA 1UBSB 4D99A 3ORGA 5B1HA 1FUYB 3RR2A 4D96A 3DWIA 4JBLA 1TZMA 4HPJB 3PR2B 1E5XA 4D8UA 5JJCA 3V7NA 3KH5A 4FRYA 3KXRA 5DBHX 2YVYA 2TRSB 2Q3BA 1A50B 1KFCB 2YZIA 4HO1X 3TDHC 3L6BA 3FWRA 1C9DB 5HBGA 4Y6GB 2CLEB 4D9KA 1XKFA 2OOXE 2EGUA 2DH6A 4PCUA 2V03A 1PVMA 4D8WA 4D8TA 1KL7A 3PC2A 4H27A 2TYSB 4D9EA 5K23C 5K25C 5D87A 4OREX 3VSDA 2CLKB 1J0CA 4D97A 2C2GA 2CLLB 1OASA 2ZSJA 3TE5C 2RH9B 1WBJB 4GQWA 3AEXA 4NU8X 5T6MA 4ZU6X 1TTPB 1Y7LA 3X43A 1K7EB 3X44A 5LXQA 1BKSB 2OOYE 3SPXA 2CLHB 2ZPUA 4F4FA 4UUUA 4XUGB 3L6RA 3FCAA 3VSCA 3BM5A 2P9MA 5D86A 3VBEA 4D9GA 3IQGX 2UV4A 1TJPB 2RIFA 5IWCA 4LMAA 5IXJA 4ZQCB 5B1IA 5MMZA 2J9YB 3L31A 3I8NA 4L3VA 2PQMA 1A5AB 3SS7X 5JISA 5IIPA 5I7AA 4HT3B 1CW2B 2CLIB 3OCMA 2D1FA 2JC3A 1J0DA 1YAVA 2QH1A 4JBNA 1QOPB 4HN4B 2UV7A 1RQXA 1K8XB 4KKXB 4LI3X 3L6CA 4LMBA 4AIRA 1Y5HA 2NYEA 2GN1A 3GBYA 5I6DA 5B55A 2UV5A 4FXSA 1Z7YA 3PC4A 1M54A 2QR1E 3DWGA 5IW8A 2ZR8A 5KS7A 1KFBB 1WDWB 5I7HA 1UIMA 1V8ZA 1K7FB 5J5VA 4QYSA 2QRDE 4AECA 1PBJA 5CVCA 3T4PA 2O2EA 1WKVA 5I7WA 2EF7A 3KPDA 4I1YA 4GQYA 3LQNA 1KFJB 2ECQA 4ESYB 5D84A 2O16A 3KPCA 3K6EA 5K24C 4COOA 3FWSA 5DW3A 1J0AA 3HMKA 3HF7A 3ZEIA 4DQWA 3DKIA 4D9MA 1K3UB 4GQVA 1V7CA 1QOQB 2J9XB 4IYSA 3R0ZA 5B53A 1C8VB 1CX9B 3PC3A 1D6SA 5CGQB 3K2VA 3FV6A 2RKBA 5I7OA 1FCJA 4L27A 1J0EA 1TTQB 5KINB 2BHSA 2YVXA 3OCOA 2YZQA 2UV6A 2GN0A 3IQIX 4D92A 3L2BA 4HPXB 2CLOB 5DW0A 4D9BA 2TSYB 1O58A 2QREE 1F2DA 1BEUB 2WSYB 5J43A 4NOCA 4IL5A 5I7RA 1TZ2A 4ESYA 1KFEB 1VE5A 1TYZA 1VE1A 4ZU1X 1TZJA 4D9FA 3AEYA 1K7XB 3IAUA 5E0KB 1C29B 4L28A 1K8ZB 3LFZA 1A5BB 4D9CA 4IY3A 2ECOA 2DH5A 3FGPA 2CLMB 2RHGB 4P1OA 5B3AA 2OUXA 3IQHX 2BHTA 2EFYA 1V71A 3R0XA 2RC3A 3OI8A 3T4NC 1PWHA 4OFXA 5D85A 3SL7A 2QLVC 3DDJA 3VC3A 5DVZA 2O2JA 5EY5B 3SS9X 1UINA 1TDJA 1JBQA 5B36A 4P1GA 2J9ZB 2Q3DA 3TBHA 2NYCA 5K22B 3FNAA 2RIHA 1O50A 4NEGA 4IY4A 2PFIA 1Z7WA
chains in the Genus database with same CATH superfamily
4C4AA 3V1MA 4LC9A 1CBUA 1HDOA 3AVQA 3Q41A 1T9GS 4L6CA 5GM2A 1FB5A 1QDEA 4XFDA 3WB1A 3ZKWA 4DC0A 1Y6FA 2CLFB 1XPJA 5C3UA 1N36B 3E27A 4I3GA 2J48A 2AXPA 3T35A 1T0IA 1U2GA 1OPRA 2AEFA 2ZSEA 5FWXA 4E07A 2QG9A 2G1AA 2FCRA 5HS6A 1V7PC 3Q1LA 3AMVA 1FU7A 2WABA 3OZSA 4R6WA 4RESA 2Q7DA 1OJ7A 2CXOA 3ZGYA 2Y1WA 4BP3A 3LRXA 1UWKA 4AYTA 3F6SA 4JT2A 2FQYA 1GPWB 1XJ5A 5K0LA 1X86B 1BCRB 3CH7A 1BYUA 4D2IA 2VJDA 5DHPA 1NRJB 3SM9A 5HOEA 1HE1C 5HJEA 5MGBA 2RB4A 1R0YA 4HB3A 3W5AA 1G8JA 4KWCA 2FSFA 4QBIA 1QPBA 5HXAA 1N8NA 1NUQA 1QAQA 2J9RA 3B1VA 4LGYA 5MFZA 4KFSA 5LR6A 4K9RA 3ILVA 3HA2A 2UU9B 3KAJA 2P67A 5B4UA 1YE8A 1UXHA 1PFGA 4XWOA 3LP5A 1T15A 5KTKA 1DKOA 2DFLA 3RK4A 3ZOKA 3OZBA 5JZOA 1YR8A 4PG5A 2QMYA 3TLGA 3CRQA 2XWSA 3A2LA 1GSIA 5C5DA 4UDXX 1R1DA 3TZEA 5J5AA 2EXXA 3SVZA 3L84A 1HETA 1JHQA 3BDVA 1TZMA 3DEHA 3GDWA 3LX4A 4KVZA 3KR9A 4PONA 3OM8A 4JX9A 1SVNA 4ZRDA 4CM3A 1RYNA 5BUQA 5TX7A 1KDOA 3E05A 4HWOA 1YB2A 5B5SA 5DBHX 5CA1A 3FPSA 5LJIA 4KREA 1G5TA 4L5AA 4YMVA 2I6TA 1KEEB 1TCCA 5C51B 2FDCA 3ISJA 4Z9BA 4ZOEA 4AJIA 5JAUA 4JVLA 3AHGA 4K86A 4NATA 4PCAA 1KAQA 3DMPA 4DBLE 4YJ2F 2OAGA 4TGLA 1W1IA 2VQ6A 3AQ4A 3UWMA 3UJ7A 3L6BA 1LPOA 2VSNA 3L8MA 4MV5A 2W2OA 1FSPA 5A1JA 3VMMA 3AU9A 5DGCA 5EJ6A 2QZPA 3DZFA 1DKPA 3G8YA 2H8KA 3M6AA 3V80A 3WZMA 4E12A 4DR2B 4D8VA 2PH1A 1NVUQ 1CLEA 1ZMRA 3E9YA 1HLPA 1NG9A 2ERYA 4LDNA 1KY2A 1GGVA 4PCUA 3C74A 4EG4A 3L5OA 2AOXA 1T5DX 4MHOA 2OA0A 1GYQA 4EL0A 2C5LA 1Z47A 4ZXFA 3JAKA 5AW1A 1NNLA 2QVLA 3PJGA 3MT7A 1CU1A 4ZOLA 4YQFA 2CZGA 1OA1A 4IDNA 3ZV6A 1DTSA 1O6FA 3JQAA 2ZRGA 1XCPA 5AUOB 3BWYA 1FS4A 5CA0A 4M49A 4V38A 3ICEA 3EISA 2PZGA 4RU1A 2HXGA 2CLKB 3MC1A 5KVCA 1KO5A 4AS2A 1GUBA 1IZZA 5CX4A 3RIEA 3T7IA 3QVGA 5EI5A 4EUSA 1FDUA 3EJWA 2QYSA 3NHJA 2HLPA 2AMJA 1D2MA 4R2IA 1WCXA 4CCSA 3JSAA 4J1SA 4WA7A 4O59O 4BNTA 5A4IS 4CCYB 2B8NA 5JZVA 1AGRA 1QZ3A 1P3JA 2HRBA 3STHA 1GITA 2PZJA 3BHNA 2IU6A 3X43A 4E6PA 1YFJA 4V03A 3SC3A 1R50A 5L3VA 1YF3A 4HMQA 2XW6A 3OCCA 2FX3A 4LJ7A 1TF2A 4Q0MA 4R05A 1QFSA 4CFZA 4ZIRB 5F23A 4JB8A 4JJ8A 2DPMA 2VNAA 1L7OA 2Q4TA 3OQNA 3TECE 1LI7A 1UWCA 1YT5A 2H9IA 1YS4A 3K73O 4I5FA 4IDBA 2IL1A 3UY4A 1DXYA 4ARAA 3E82A 1XTVA 4FHZA 4HRXA 3X44A 7GPBA 2ZQ5A 1I10A 5IXYA 3I30X 2AMVA 5LQRA 4UVEA 1MIOB 2GZ2A 2ZBPA 2P8SA 1KE1A 2OOYE 3KAQA 2XRFA 5ENZA 5EWMB 1LFDB 2F9FA 4RH1A 5HK8A 5JD4A 3WMEA 4C7OA 1FVFA 1LJUA 3QNUA 4W5JA 4UOZA 1T5BA 2NZXA 2P2DA 3U4IA 1RKVA 2D2VA 3WGNA 2LBPA 4I0WB 2AK2A 1CULC 4M9SA 5K3EA 5FEMA 1EZ1A 2BV3A 1JTEA 2BMVA 3QVJA 3L49A 3RUFA 5B57C 4FI3F 1TF5A 4N3AA 1TMKA 4DR3B 4PLFA 4BTEA 1SZDA 2C9MA 3IEIA 1SUCA 1GXSB 3INTA 1A7AA 3S68A 3WY9A 5KHLB 1NN0A 1QHIA 4OA8A 2YZ7A 4QGSA 3EWSA 5IBQA 4LMAA 4K3UA 2BR5A 3FPKA 3SICE 3ZE6A 1AQLA 4BMCA 3RFVA 1E9RA 1W29A 3EDQA 3HACA 4N3CA 4ZV4A 3L77A 4NPAA 1JR3E 5CFRA 2EP5A 4JEUA 2WJHA 4HYEA 3L43A 4WKPA 4WZAA 2CNKA 4RD0A 4JI6B 4AJHA 3HO6A 3KVNA 4EJ6A 4RKWA 2V1UA 1U2PA 3R6LA 5A9TA 1I30A 1VCIA 1VP3A 2HMWA 5HE9A 1QLWA 4L3VA 2H9YA 1LRJA 1FBTA 1YK1A 1PJ2A 4HXGA 2Z5LA 2NUPA 5DX1A 4G63A 4E46A 4ZEMA 5JISA 2OV3A 4KBYA 4WCFB 4KPFC 5JAMA 4I1PA 4XA8A 2C3MA 4V39A 3USZA 4AMVA 2O8DB 3CM0A 4HWKA 4OHUA 2G9VA 2PT6A 4XD7D 4MVJH 5TQ2A 3S70A 1WS6A 1YI1A 1S02A 3IIIA 4ZO9A 1PEDA 2DAPA 4DYHA 4AK9A 3JYLA 1IQ0A 1YUBA 5E1OA 3C6MA 3G0IA 1AJEA 3HDQA 1FP4A 4YCDA 5JNWA 3VKHA 5AI4A 2FB9A 5SY9A 1EAYA 4MHTA 4F3TA 1E2DA 2RCYA 5C35A 3D3EA 3BXFA 1VRCA 3PXAA 1TM4E 1WVIA 4UHEA 2FMHA 1T6BY 3GJXC 3HKEB 4CMIA 2PQ2A 2D8AA 3LKDA 4JBNA 4A5SA 1N0HA 3HY4A 3IQFA 1SHZA 1O94D 3CPHA 1U5BA 2FZWA 2LCIA 3ILHA 3AUTA 1UEXC 1KSHA 5LZ8A 3AERB 4ZQHA 3SNHA 4RPJA 3DYIA 1DEHA 2QVBA 3W8NA 3ZHRA 1QDUA 2VJBA 5AUQA 4URXR 2EIXA 5FTJA 1WVGA 1ZP6A 2Q07A 4QPNA 1IY2A 3EA5A 4O4LF 2GRAA 1T2NA 1P0PA 2J87A 1RQ2A 4GS5A 5JSYA 1RJWA 1HM5A 4ZOLF 3GLHB 2WJVA 5C8DA 1UOPA 2O57A 2SCUA 1XWFA 1QS0A 4DEXA 4MI1A 5CA0F 3ENVA 1YDWA 1XMXA 1B8UA 3HNPA 5EKSA 5J4KA 3LJKA 4H9GA 1NP7A 4HOYA 4O4HA 4HWRA 3SWWA 3C4VA 1XCLA 2EX0A 4L5BA 1KMIY 2A58A 1NNUA 1Z7YA 4KYUA 5D51S 5AXDA 4GKJB 5J40A 5HSGA 3EXHB 1SHJA 3WRXC 4AM8A 2I6QA 1LLQA 2Q5FA 4PGFA 4MI9A 5DHQA 5F5XA 1J24A 3H0CA 1LBEA 1AQUA 2QM8A 3A9RA 3GI1A 1MXFA 1DUVG 3IR6A 1MPTA 1X80A 3AF3A 5FA6A 3GLSA 3O1JC 3OO0A 3VH4A 1E1DA 4E2ZA 4Z1MD 4L5CA 5AK6A 2F9MA 4ZK6A 4KZPA 3W4JA 2GXUA 3GP5A 1BSVA 4B43A 1CUSA 4R1MA 1B2RA 1TIKA 5J5VA 4HNAB 3BFVA 5B4TA 3JWIA 2P68A 3LD9A 7REQA 4C06A 2WT8A 2WQ7A 1MGOA 2QRDE 2WC1A 3FWNA 4QPZA 1W6RA 2WTEA 5EMLA 2HADA 4MV1A 2FKNA 1RIFA 1UAYA 2HF9A 1ESCA 1UK6A 3GLFB 4ETMA 1U1IA 4TVSA 3KSBC 4XM1A 2JBWA 4PZUA 4M7PA 4DNQA 5FPSA 5FUYA 2NNWB 2Z6AA 1SKQA 1E7SA 1WKBA 4EG0A 1PKXA 2OZEA 3QI2A 1YC2A 3C98A 1L7NA 1YS7A 3DBRA 4PO8A 2FR8A 5EAIA 5CYPA 5E9JA 3IEVA 4LJ8A 5JS7A 3UUWA 5LOVA 3LQNA 3D6VA 4G0OA 4HXYA 5EHQA 1FJXA 1PJ3A 3P2YA 3TK1A 1V5IA 3ZWQA 1UBTS 1Z34A 1S2DA 1GFWA 4MGHA 2JJ1A 2AR9A 2FVYA 4WOPA 2CE7A 2I3AA 5BPHA 1PHRA 4COOA 1W4RA 2IDMA 3I2GA 3VI4B 3M4YA 2PD6A 3NP7A 4HF7A 4MVJI 3EIHA 3ABQB 4XWYA 3ZE9A 3L6UA 4BCBA 2A33A 3DDZX 4H17A 1S3SA 1WL8A 5DK6A 4Y1RA 2P41A 4GX1A 4YI3A 3OQHA 3PHJA 1V8OA 1E5DA 5D5QA 1NR7A 3OU7A 1N5JA 2RGNA 3HB4X 3I6BA 1V7QA 3ZCRA 4D9MA 4QEDA 2XWQA 5KOHA 5AFSA 4MKFA 5DIZA 3M2PA 4NX2A 1FTWA 3IO3A 4UOQA 5L3ZA 5ECYA 1NJSA 1SN7A 1FX0B 1NRXA 3ZWBA 2ZS9A 3HU2A 5IKOA 2Z4SA 3MJDA 2FWBA 3Q5EA 4LZPA 3L06A 1DAIA 1B3BA 2I76A 4IKPA 1OI3A 3H8WA 2XCUA 4RIEA 3VJLA 2QKYA 3H2SA 2F48A 6CHYA 1T10A 3ZDYB 3W8DA 1QYIA 2B2XA 4EGFA 5SYMA 1L3CA 1U9ZA 4DLUA 3Q3IA 4ZREA 2ZITA 4IXWA 4I14A 2A94A 4UU7A 1GY8A 2PLRA 3MB8A 1M1NB 4H7FA 4KVGA 5ALPA 1KDVA 3URMA 3PGVA 1NIJA 4AJLA 3MWYW 4BZZA 5INTA 2RAUA 1TJ5A 1XQWA 2RGBA 2C3OA 3KLOA 5E6SB 4QT4A 4BO4A 5H8WA 2JDID 4TN1A 4ZEVA 2B1JA 3EAQA 2YJGA 3WWZA 1F8UA 4FFPA 1USGA 1T0PA 3FMOB 2GM4A 4QG7A 2OECA 4U2BA 4DRYA 4WL0A 1GZSA 5L3SB 3HA5A 4Y0AA 3ZWAA 1KPIA 3L2BA 1Z2OX 4YAIA 2FUNB 5ALMA 5ICEA 2PRZA 2R4UA 3ETJA 4RPIA 3VX3A 2Z5GA 4E5SA 3EGDB 5G3YA 3T99A 5JD5A 3RAPR 1E8MA 3AI1A 1W5SA 2ONZA 4DUZB 4GDFA 4DANA 1WOYA 2PA3A 2J7PA 1BEUB 1I5RA 2BJHA 3CN7A 1KKUA 4L4SA 4UU1A 4YACA 5EJMA 1D4FA 3G8DA 3ELWA 3GJ7A 4FHCA 5HIMA 3KDSE 4B46A 3L7JA 2Y68A 4KPYA 2FPPB 1HFJA 3R7NA 3E3AA 4WBNF 5BN1A 3KKKA 5LA6F 4P53A 3WK4A 5JARA 4BFVA 2NQTA 1IIRA 1SUBA 1TFRA 2NYRA 5LVAA 2QX4A 1WY7A 1X13A 2O2HA 3FLEA 4QAQA 5CGZA 2Q7OE 2HO4A 3VPDA 1JH9A 1ECCA 1ZIDA 1ID8A 1ODLA 3O1HB 3PWTA 1GZVA 2R6HA 1RIIA 2JGAA 8LDHA 2FVXA 4FFWA 5A03A 2BGUA 3UT5A 4A6XA 8AT1A 4EVRA 5EJ9A 2CFRA 3AK4A 1SRQA 4AJ1A 5AW4A 1K6IA 2A0UA 3AR8A 1T2CA 5EHNA 5F1KA 4B44A 3ESYA 1HG1A 2PL3A 2V54A 1PYDA 4X62B 4U7TB 4PQEA 1AU9A 1NN1A 2FYTA 3BB1A 2O5RA 2VF4X 4R2XA 1Y3BE 3NHPA 5DBGA 1X3LA 1X7WB 3GQBB 2VWHA 3DBVO 3T9CA 2DHEA 3WGKA 3AEZA 4HN9A 1C80A 1HPLA 2FW7A 3MAJA 5E4FA 5T3UA 3H5RA 4I1SA 4LWOA 1X8KA 2AG1A 1CCWA 3R7SA 4WK2B 3HBMA 2H52A 1CUWA 1KA9H 1L4EA 2OFXA 3L8HA 5MF6A 1PGNA 3WIOA 3KXLA 4PR0A 2P9JA 2PEZA 5B4VA 4G0MA 4BO3A 1ZGGA 2P3QA 3CKMA 1N2CA 3WL4A 2C5SA 4BMVA 4PYJA 4EHJA 1KJIA 1N5IA 1KSFX 1WPQA 1YJ8A 2CXNA 2V9PA 2AE1A 2ZJ2A 4KRYA 4N82A 4Y0NA 4UTVA 1QH8A 1W9MA 2LP4Y 1ZJ5A 2FWAA 1BS2A 2EYQA 3UXYA 3GAMA 1NDQA 2EZTA 4QPJC 3QFCA 5LOVF 1U2GC 2DKOA 3CLTD 4MUIA 4QUDA 3BSSA 2JJ2A 1WQ4A 3OA0A 1W19A 4IRUB 3GEHA 4LOIA 4PVDA 4X0EA 1M72A 3DLAA 3TSWA 5KYNA 3LC1O 1E2LA 4CQMB 2R1TA 4NJMB 4HQ6A 3M89A 4RE6A 4R1LA 5AW8A 1HDEA 2ZBGA 1LK5A 3RODA 4LYEA 3RC3A 4LZLA 1WULS 2B6NA 1NVTA 4DCMA 2B83A 4OATA 1JAIA 4IJMA 4L3OA 5DRYA 5L3QB 4UAVA 4TWRA 4WZ6A 1UMDA 2XODA 2NQ8A 1KMHB 3HVKA 4NXMB 1YL5A 1TMYA 5HIKA 1OZAA 4TSRA 3VC3A 3OQMA 2PCJA 4F3RA 2WLSA 3R5FA 1RP1A 3NGMA 2NU9B 5FUXA 3SE7A 1V5EA 2CJWA 2WWVD 2DTEA 4GRDA 4MQFA 4D0NA 3D6UA 4IMJB 4CKCB 4EY8A 1UFOA 2MMGA 1Q11A 2CCGA 2YC2C 4LWPA 1F20A 1BGVA 1UXIA 4DLTA 1ZY2A 2DBYA 3D8TA 2HHHB 3G9XA 3EPHA 3NC4A 1REQA 4EO9A 4MKZA 4AF6A 2J4FA 3OX2A 3W78A 2GQ0A 3N3BC 3E2PA 3AV3A 2PFIA 4X7PA 1Z6XA 3UMRA 1C4OA 1YVEI 2JA1A 4YJ2B 2MOKA 1EVEA 3A1VA 3PC8A 1U0GA 4JLJA 1T5IA 1LPMA 1Z35A 3EC7A 5LC1A 2QD4A 2B78A 4CLXA 4ZZ3A 5JFOA 1VL8A 4UEKA 5EYPA 1J4AA 4MKRA 2NUAB 4JI7B 1O6GA 4CCWA 4GPTA 2O54A 1ISGA 2YVZA 2FGJA 2QT0A 3C3XA 3VH2A 4ZYYA 2VCYA 2ZTVA 1U2TA 3IAM1 4FBMA 4FOOA 4WT7A 3K16A 3NORA 1AT1A 3FXAA 3KPBA 2C7GA 3GLUA 1K8YB 3K7EA 4UD2A 2PZMA 1VHDA 1KFKB 3BQNB 3MD0A 1JLLB 3LLCA 3OP1A 1ZGAA 2WIBA 3CPEA 3QH4A 2B36A 1R8SA 3ZEAA 5E7IA 3TZKA 4JJFA 3MXOA 4LSGA 2D3TA 1T8SA 1CS0B 3MMNA 2D4ZA 2XQIA 1UPCA 4KNYA 1A96A 2O3TA 5D7BA 4IS3A 5JWHA 4G1EB 4DDWA 2XUKA 4RKFA 4FNOA 5THQA 3SE0A 1K5HA 3SS8A 2JGJA 1TO2E 1Y3IA 3F7TA 2K2WA 1BS1A 1VZ2A 3L0DA 2JFNA 4HGOA 2XUZA 1DIAA 4PX9A 4LQDA 1UR5A 2FMTA 3ORGA 3BKWA 4WZBB 2AX4A 3ZQUA 4NNPA 3V3TA 3VZQA 1L4HA 1PQUA 5ELXA 3B3FA 5EIHA 2GASA 3UIEA 3NTLA 1VG0B 3UAGA 2XNSA 1YZHA 3HJHA 2PLWA 1ZGHA 1ATZA 3Q5DA 4JCCA 3TD9A 2JLSA 3TOXA 1YDMA 1WP4A 4CV2A 1TA9A 5JR3A 5ALIA 4PLVA 4HQRA 3C8DA 2W2TA 3AWDA 4FBGA 1B76A 4PNZA 4D8YA 3ZIUA 3ZLJA 3F4KA 1DC8A 1KAEA 3ADBA 3ZKWB 5EIBD 1ZDMA 2C9ZA 1EBBA 1D7AA 2XUAA 1KH2A 1WZIA 1EZ4A 3CQ9A 3JW8A 3Q9NA 5F5LA 3FCXA 1FRNA 3O3NB 5HGJA 3R3YA 5KKAA 3EDOA 1C7IA 3VPXA 1YA6A 2IUTA 3Q6IA 1Z6ZA 1T0UA 1P80A 2QTCA 2CVZA 1UBOS 1Y7IA 1IUOA 3LK6A 4M8LA 1P2VA 5M34A 3RBZA 5KDDA 5JNUA 3HNOA 5HKOA 3TZHA 1DMSA 3OQPA 2ZUFA 3SJAA 2RDMA 4ISCA 1CVLA 1EYZA 1W4LA 2OQVA 2CVHA 4KQXA 2BZ1A 2Q9CA 2FLKA 1VMIA 2X2OA 4NZNA 5H0IA 4JBYA 5AKYA 5E4YA 3RM3A 4CM1A 5CB6A 1NOIA 4BE4A 2ATEA 5K7SA 2WSLA 3FOAA 4JLSA 3IOCA 3L7CA 1K92A 2J3KA 2AX3A 1RFGE 3F6EX 1T5OA 4H7IA 3WJAA 2WAOA 5HWSA 4J29A 1LDGA 1Z75A 2RHMA 4ZQBA 1FVOA 1XZPA 5DFAA 3QVVA 2HRZA 3GBVA 3N70A 1F60A 3AETA 1LJLA 5CCDA 4RK4A 4YUAA 1V7ZA 2D13A 4OREX 2FX2A 3TLGB 3DBIA 4BNDB 4BS9A 1DKLA 1XEFA 2HSDA 3F8SA 1T35A 4QARA 4D97A 5JCJD 3MINB 3VYUB 3NHKA 2E4VA 2ID7A 2NXWA 3CJQA 1L5GB 1N7JA 3AEXA 1UMCA 3AR7A 3PPIA 2GF2A 2ZB3A 3K96A 2L19A 2HA0A 2EW8A 2GAJA 5C4GB 1G2OA 3QV1A 5L7YA 1TTPB 2VJCA 3OKCA 4G1FA 3AIMA 3LUGA 1TQDA 1KRHA 1PJQA 2CHQA 3LQFA 4JOSA 2XWPA 4CV3A 1Y9AA 2VPYA 2VTVA 3T3GA 5CEEA 4OQ4A 1GQRA 1RKBA 2YOFA 1G8PA 2QLBA 2LE0A 3LYHA 4KWTA 3X2SA 4BFUA 1G21B 3AJDA 4B3MB 1ISSA 1MH9A 3SZGA 3TD2A 2MSKA 4QOHA 3LA8A 3UMGA 3ZWCA 4CF3A 1G5QA 5IJ0A 3VOBA 4WOCA 2OP0A 1IN8A 1CERA 2ZREA 1NLUA 4R6XA 3IAM6 2IELA 1OHHA 2JA3A 1TYCA 1YJXA 2AXQA 1KK3A 1MVOA 1VKJA 1E18A 4TRJA 2O3UA 4YONB 3OIWA 3PXUA 4OQXA 1AHNA 5CR9A 3C87A 4BMSA 1TJYA 2PD4A 5HBRA 1YRQA 5K8TA 3Q3GE 5JROA 4Z0HO 3GROA 4FGJA 3ESDA 1NBAA 4LCJA 4O4LB 3P8ZA 1H2EA 4A26A 1T2VA 4AYWA 4NFYA 1G8FA 3WLOA 4OHYA 4ZOLB 3EPKA 3JQAB 5CB4A 3R44A 2O05A 1QVWA 3N5CA 4R9UC 2ZAIA 5CA0B 3BL8A 2V7VA 3R9WA 1RWNA 2V8OA 3ES9A 3KYDA 4FEEA 2XKKA 2WMOB 4F9EA 4Q9DA 3ZDZB 4K0RA 1WIWA 2XNKA 3SDBA 3R0JA 3V6LA 4MVCA 2VKQA 4COKA 3QVGB 4PE5B 3IULA 1LPPA 4BRWA 5EUQB 4HRAA 3PJRA 1EWQA 3H87A 1C7JA 5DXFA 2I3DA 4OHRA 3UV7A 2RK6A 1KOLA 4YEDA 2QGFA 4CQMD 2YOGA 2EP7A 1K4MA 4DGSA 4DIKA 1PJRA 2WSBA 4C21A 2PUAA 1WE2A 2G9UA 1VIVA 3B7WA 3BE5A 2ZE8A 3RIXA 2XV1A 1E96A 2HNKA 2X8JA 4C7JA 2B98A 4TSFD 4ZCIA 2FP4A 1OFTA 1YBFA 3VU1A 2R96A 3HP7A 5KTRA 2B8WA 3GFGA 2J3LA 3QENA 4MRMA 4DCOA 1OFUA 1BQEA 2PQ6A 3MRXA 4YAEA 4DUGA 3OTOB 3B60A 2UVDA 4EABA 3LFHA 4II2A 4G9BA 4I6JA 2AJBA 3EFBA 4QHTA 3GRKA 2ORYA 3VH1A 1Z2PX 5LDHA 3EF3A 4UASA 1EWRA 1TGYA 2WZDA 1ZO8A 2P9YA 4AY6A 3OUTA 4DA8A 3R7BA 3U3RA 1YDGA 4QO8A 1E92A 2IYPA 4MGIR 1JW9B 3NHBA 1W36C 1SEPA 4F11A 1KDTA 1KPGA 3IURA 5K8LA 4UQOA 1VC2A 2A0FA 4IUBS 3SQNA 3W8RA 5C18A 4OJQA 1Y48E 5BVGA 2O3QA 2FR8C 2O4CA 4W5HA 5JO9A 3I62A 4O6VA 2UUPA 2WD8A 4XW2A 3W3AA 5DASA 5FWAA 1G55A 3AVTA 2MR5A 4MITA 3UJBA 3OBBA 4QDTA 2XB2A 4F96A 1OLSA 2QF7A 3ASUA 4D41A 3WISA 3QJGA 3LU1A 3UC9A 1Y89A 1NI4A 1P7ZA 5BUZA 3WJ7A 1LGYA 1KZ9A 4LDZA 5EXPA 3THSA 5IN4A 2H5JA 1DIGA 3K53A 2H1CA 2PUDA 1PEYA 2EIHA 1D2CA 1DO8A 4IXMA 4OYYA 4RM2A 5IFLA 1XLTA 1PFYA 2JK0A 2CLCX 2NUPB 2QYHA 1H6CA 1GTZA 2FUCA 2HA4A 3HCRA 4KRXA 2RGNC 4B6JA 3PXEA 3DM9B 1TD1A 4H0NA 1Z63A 4BPRA 2C4TA 1TA0A 3GRZA 3TD6A 3I9JA 4B33A 4JR2A 4PRLA 2P69A 2ZZKA 2J31A 4LMRA 3ID6C 4GI3A 4IX1A 4QICA 3SF8A 5LMUB 2PUFA 3DTVA 4P58A 3FPHA 1QO0A 3EFHA 2QTRA 3LT1A 5ADWA 4QYSA 1FP4B 3O5AA 2B3DA 3BCHA 5BR8B 2OCXA 2DY0A 2QRNA 4OQMA 3UGJA 5K8VA 3X1ZA 5I7EA 4EPXA 1NQWA 2C0QA 3H5IA 3HYSA 2IS6A 5GJWC 4E5MA 2V4UA 4PZ9A 4FLMA 5E4TA 1WKVA 3M9LA 1U5BB 3OX1A 4QYIA 3WXMA 4MYSA 4DMRA 4ZJZA 5JY1A 3M6FA 3W34A 1L8XA 1FDWA 4LY3A 2V6MA 2HTEA 1M76A 4P22A 4MVJM 3PFNA 2X5NA 4OQQA 2ZRMA 5F21A 4DM7A 3ESBA 2X3YA 4MPJA 4QE3A 1AZSC 1SUIA 2D1RA 2E4XA 3FX2A 4R8RA 1QX3A 3A05A 1QS0B 1XXHE 2KE5A 2QVXX 5AKXA 4K9DA 3RU2A 2W93A 3CB4A 2EARA 3KL4A 2OXRA 3O8DA 4WBNB 2VSXA 4NY1A 2C5BA 3IVMA 5LA6B 4Y0VA 4JQCA 1YS1X 2HDWA 3D8UA 3IQDB 4DSOA 5AIBA 3O73A 4F21A 4V1CB 1NMZA 3ETGA 2YR0A 2A14A 4LOJA 2J9LA 3N2ZB 4IAOA 4N1AA 4P4SA 5K8UA 1YXMA 4KN6A 4MP8A 2VT3A 2G71A 4MWBA 4QOEA 4KX3A 1JKFA 1KHTA 4DEYA 1B2LA 1SK9A 1GSHA 1W4CA 2I8AA 3G59A 3JSXA 3B7PA 2P30A 1L5NA 3A7EA 4I4NA 1Z7BA 1WZUA 1XD2B 3ETLA 4Q4DA 3R76A 3ZWWA 2GB4A 4LRTB 5KBYA 3THYA 2C77A 4B4VA 3AR4A 3BA6A 5G1PA 3RVPA 4KH0A 2IV3A 7REQB 4Y18A 4QGHA 1O87A 4KVAA 3DGEC 3W1WA 3MWDA 5JAPA 4MDYA 2QLJA 3NZEA 2P77A 2L0XA 3QU7A 3N0TA 2GILA 2XXAA 2RGEA 4UQPA 1UFVA 2XBUA 1S9HA 5DZSA 1NLZA 1XZKA 3B7GA 3PKZA 3U2QA 2DFNA 3M2TA 1W36B 2IYXA 2J3HA 1PNQA 1FFAA 1SIOA 2QB5A 4FMBB 1NI5A 2OP1A 2POQX 2VHTA 1A76A 1ZK1A 1BWQA 1X7HA 1Q7RA 2EBUA 4HQNA 5FOXA 4OFWA 3DBRB 5EE1A 5AOCA 1AXGA 1Z6PA 2AI3A 2XY4A 2CHFA 4F72A 5LOVB 3CFYA 4L08A 3WYFA 3QW4B 5TDHA 2OORA 3ONDA 4JC8A 4AJOA 4EGSA 5JI2E 4LF4B 4GIBA 3L18A 1L1RA 1IZYA 2YICA 2PS0A 3P27A 1D1QA 1N4AA 1UXKA 2XYRA 4GMKA 3L0IB 1ZEJA 1XNJA 3ZH2A 1ST3A 5CPBA 2FW0A 1WXDA 4R9VA 3UWOA 1EWVA 2VK8A 4PC7A 3VR6H 3WRVA 1F38A 2XB8A 5KNDH 1E9CA 3A1FA 4ZYZA 2ODAA 3B5IA 4ZMSA 3H3JA 3RW9A 5JLJA 1O96A 1MJGA 3I2JA 1P45A 4D6PA 4J1TA 1Y6RA 1LF5A 4IGAA 4FYWA 4HYYA 1Y3DE 4KO3S 2BKVA 2JIPA 2FPMA 2HA6A 2FEOA 5JBNA 1G3RA 3TZCA 3U3MA 3RIHA 1CKEA 1KFEB 3I64A 4JT4A 4E2YA 5C5IA 5JHGB 5LU8A 2VPPA 4ZN6A 3E3NA 3ZN2A 1PTJA 2Y9PB 1MTOA 4U3JA 4BO5A 1XZFA 2NTNA 2QHXA 4D9FA 3WWPA 1JP7A 1QF6A 1RM0A 3AQIA 4YNBA 3LCUA 5JU6A 1NV9A 4NP6A 1PSDA 4D5GA 1NW3A 3PEEA 1KXZA 5H02A 1C29B 1S6YA 4NZOA 5DHFA 1FLAA 3CVYA 3HB1A 4C88A 1XROA 3PI6A 2A30A 3HR4A 2FY8A 3X1MA 1R3UA 3SC2A 2PYZA 2ANCA 3PFCA 3UHPA 3ULKA 3W1EA 4AB1A 4X45A 3BGOS 4Q47A 3FD8A 1OYYA 5T41A 1KP3A 3BWVA 2E1RA 3G1WA 2I6UA 1I1NA 2B21A 5TPWA 3PGMA 4BNGA 4KUGA 3HQ4O 4Z99A 4OB7A 1GA6A 4O0MA 5B58T 4AFNA 4YRCA 1OW3B 1H9BA 3PC8C 3DHYA 3G5MA 5BQ5A 1M1YE 2XNHA 1CZRA 1G5HA 2X22A 2MSDB 2ZJ4A 3IUMA 2EL7A 3GZNA 2VVTA 4JUBA 4U5QA 5DB4A 4DSTA 1NMSA 2YHIA 2BR3A 1DG3A 2VRWA 1PLJA 3T7TA 1PR3A 3KJNA 1QHXA 3IQHX 1BDHA 3I0MA 3KLBA 2HK7A 1SOVA 2O7NA 1BN6A 3EASA 4GP6A 4IOMA 3LBNA 4R2JA 4MUHA 4ZT7A 2HLHA 4X54A 2BKXA 3CW2A 1U9JA 1GA1A 2BGJA 5JD6A 4FEYA 2PZKA 3BTSA 3HFSA 3V7UA 5JAIA 3OTIA 3LT4A 1GTL1 4M99A 1Q0SA 2BSQA 3RHZA 2PS1A 4GC5A 4X1IB 5IASA 1NJ6A 4HWSA 2LD4A 3BIXA 3T4NC 4X41A 1IN4A 3PRHA 3RRYA 2OFFA 3E03A 2ZWAA 3P9IA 4RAOA 3ZWXA 4HNQA 4MULA 4K6OA 3HXMA 3JX9A 5ED0A 3SM3A 4CYMA 3UT5B 3AILA 5DVZA 5ALYA 1IK4A 2HV9A 2ZBUA 1CE8A 5GPBA 3TR6A 3KE8A 2VJYA 3KZXA 1R6BX 2R2AA 1S8NA 3KLPX 2MSEB 2QJOA 1I6KA 4PZDA 3E9DA 4U6QA 2PE5A 3SQLA 3IMGA 5CMLA 3IPRA 2Z56A 4LSMA 1OVMA 3EXEA 5FO1A 4MUYA 4ZI5A 3UPDA 5CT4A 4YV2A 3O4GA 3Q3VA 2NYCA 5HF6A 4CMHA 4EHDA 1GZDA 4HUQA 5KJCA 1UP6A 1H8ED 2YWFA 2IX9A 1VCOA 5FBHA 4YRJA 3TX6A 2OYSA 4HX5A 4M0LA 3CRVA 3KLNA 1KS9A 1R6XA 1XHLA 4A03A 2AOUA 1JLMA 1QLHA 2BSXA 4JUIA 2AA3A 4CTMA 2VHYA 3JQ7A 1DQNA 1N2CB 3ICPA 2PKXA 5EPEA 3C8MA 3I5XA 1U65A 2HOQA 4KI7A 3V1LA 4QNMA 1FNMA 5GADl 3ZJ5A 3M9XA 1N2ZA 1H3FA 3M1AA 3HBNA 2B61A 3W6UA 3K5PA 4P4NA 1ND5A 1X1QA 3PJFA 1IJKA 3TTYA 1N32B 2AHOA 1UK8A 1RVV1 4TMVA 1UJMA 2GLUA 2YCBA 1TKCA 4RA6A 2F1OA 3DAYA 2X76A 5JTTA 3FJ1A 2PUJA 4M1TA 5K2MA 4G0WA 2R1TB 1QGED 1URPA 3HE3A 2ID8A 3HG7A 3IV6A 3KBOA 4XH9B 3ZBUA 1PF7E 5G53C 3GG2A 4BQNA 3BH0A 4AN0A 4EI8A 3SI7A 4QBGB 1CQIB 1RDFA 2Q3MA 2IIVA 2IS4A 3ZHTA 2GESA 2AGVA 2G04A 4FMPA 3FMFA 5AM5A 5H9WA 1MDBA 1B0AA 1HX7A 3RB8A 1UMDB 3BXGA 3NBUA 3Q2KA 3A2MA 3G7SA 3L4BA 4UDOA 2WHRA 2X5OA 3CE6A 3IXLA 1JZSA 1YMVA 3KEFA 4M76B 4MRPA 4N8DA 2DFKB 2HMUA 1IBMB 3S99A 2Y0BA 2NSDA 2FMKA 4X44A 1KYQA 3DFZA 1WTCA 3HCCA 4B2YA 4AY4A 4MQFB 3P9SA 1PEAA 4FFBA 3BD8A 5E9AA 5A2QA 1DEKA 1HR0B 2VAMA 2Q3CA 5KJEA 3NNDA 1UBSB 1JXOA 1LW7A 4YJ3F 4AQYB 4RVCA 3EB9A 3O2QB 1M2FA 4KQHA 4MQ5A 5HEKA 1SOWA 4BEWA 1REQB 3PPVA 4OFZA 3ORFA 3WGYA 1BWSA 2GEFA 2H2GA 3FTDA 3HCAA 3BEDA 5IUKC 1SKYB 2XF2A 1NJ1A 4MVWA 3EE6A 4J90A 2A86A 3NH6A 5F33A 4AZ3A 1E1CA 4LK2A 3PI7A 2YJ6A 3I8SA 4B3GA 1MQSA 2QVCA 4E33A 1T36A 1FPQA 5BOVA 1KDYA 1Y1LA 4DLWA 2ZIVB 2CSXA 1N2GA 3A4TA 3WIVA 1X1BA 2C7PA 1TEVA 4KAAA 3ZD7A 2YY6A 2JFOA 3V9AA 1QHGA 2QUHA 1W5AA 3DO8A 4JR0A 1R9NA 2EFGA 3D4OA 3WMRA 3GNLA 1Y9EA 3T5BA 3BE6A 4P7KA 5PGMA 3UGKA 1SVKA 1Y3FE 1C3OB 2ZJOA 4EI2A 4NE7A 4OXIA 4UE2A 1W36D 1LSSA 4TKLA 4P1ZA 4LDJA 1O8BA 3DB1A 3QUAA 4IHJB 3ND7A 1JQLB 1JVSA 2H48A 5BSKA 5HFAA 4XARA 1JU3A 2HT6A 3D64A 1RT9A 3OPNA 5AJYA 1CQJA 3DV0B 3NJRA 1ZNXA 3K6KA 3WK8A 3O9VA 2AF3C 2YINC 4MUJA 3VR4A 4EKIA 3DE5X 2P1ZA 2IXEA 2CY0A 2IQ5A 5K23C 3WWEA 1IM2A 3GCGA 3TZ6A 4XM2A 3JD4A 4UBMA 2RGUA 2JJ1D 1T4MA 2UZ0A 4U63A 2VNIA 3F6CA 4FZ5A 3WFIA 3D5TA 4IUDS 1QE3A 4WHMA 4LXYA 3A9TA 4YRRA 3ROKA 3RRMA 1RRFA 1RWXA 2CHGA 2H5IA 3KR0A 4M46A 1X1EA 2GPAA 4EP1A 4XRGA 2XE8A 4X7MA 2V97A 3X1DA 1X0XA 2IP1A 1HT0A 4RYLA 3OOEA 1UANA 3WGIA 3DWEX 2BFOA 2F64A 2MYPA 5AKIA 3P4XA 4DW8A 2CXXA 3R20A 1MRSA 4O08A 3W2GA 4B09A 2WUGA 3UH1A 1XAHA 2ZJ0A 1R5BA 2IEYA 1PFWA 3I04A 2NT3A 2BHRA 2P4HX 4Q7JB 3BHMA 3OCXA 3P2IA 3W3AH 1CY4A 1UC8A 4PLCA 3PL5A 5G4KB 4B82A 4CKZA 3B6JA 5HZKA 4ARZA 4Z5XA 3BZUA 4KQ2A 2JVKA 3V8NA 3IAS6 1I0ZA 3GLGE 4RZUA 1H4SA 3JAWB 1GPMA 2R8OA 2HLNA 4I55A 1DT5A 4G8BA 4WKBA 1BHSA 5ALEA 2CYCA 3H9GA 3GRUA 2ODEA 1I4DD 1X8LA 4ZZ1A 1JE1A 1N25A 2DHCA 1LDNA 2W4IA 1DRUA 3GFPA 3GFOA 3GLVA 3IBGA 1I3MA 4EG1A 5B6JA 4AI6A 2FAXA 4AWBA 4CMCA 4DA4A 2XAAA 4L2IB 5MN6A 1U2RA 2D54A 4ZEOA 1DHTA 1VYVA 2OAEA 2SNIE 1NBMD 1UXGA 3DE6X 4ZJYA 1M67A 3WR5A 1OBVA 3LQ2A 3NS7A 4BB5A 5BN4A 4RGYA 3FW1A 1H4TA 2WUFA 4G36A 1CWUA 1YB4A 5D86A 1NMYA 1X42A 1C1XA 2MMCA 3FDXA 4EZBA 2P5YA 2XQKA 3OA2A 3IQGX 3KZKA 1E9SA 2H4XA 3KUXA 5FTKA 4KUEA 2ZJ3A 5TGDA 4V0ME 4CHTA 4EHBA 1R4AA 1UQUA 3CLSD 4MA4A 3TCXB 1Z06A 2V59A 3BB4A 3S2UA 4FWBA 1RYHA 3C4QA 2XGMA 3V42A 1IY1A 1KIMA 2QRQA 3VKUA 1PTKA 3I3SR 3DAFA 2UVQA 4WSOA 2JCSA 1OLXA 1XTBA 4HAVA 2R4QA 2VN8A 4LHYA 3KJQA 1JALA 3HDHA 4U2EA 3VZCA 3ZCSA 5MMZA 1H5NA 5DTQA 4NOJA 3ZQJA 5FHQA 3S2EA 2BCGY 1Q92A 1T5LA 2G70A 2YW2A 3ENWA 4L8YA 3TQTA 3W4KA 2AJDA 2YJTD 1D4AA 1AS0A 2QBYA 4N41A 1P73A 4Y9TA 2BMJA 4FDMA 3HK2A 1K5DA 3HZZA 1HK7A 4D79A 5AW0A 2QUBA 3QEJA 5IIPA 2FPIA 2Z5FA 3RV3A 4A10A 4AJPA 4CBVA 5C80A 1EH5A 2XZTA 3TGWA 1L4UA 1U0LA 1L1FA 2PSHA 2C8KA 2IEDA 2GO7A 3SMQA 2I2FA 4C0QC 1OT5A 2FWPA 3GJ0A 2JZCA 1E0JA 1RYMA 4I4TA 4BC1A 4HVAA 4IFIA 3QZUA 3O2SB 4HMOA 5AICA 4F9GA 3H05A 1FMFA 4LWQA 1PUJA 4CPDA 4P4GA 1KI7A 1WXHA 2OO5A 3R9XA 1JILA 4ZVLA 2YWDA 1LQUA 4YAUA 3VYTB 1SWVA 2ZI6A 4LOKA 1J90A 1ZM3A 3GIDA 5HJ7A 1YIDA 1CZLA 3QY9A 3FUWA 4WFQA 4IINA 1GTRA 4E7PA 3H5WA 2VYQA 4AU1A 2HWWA 1IUKA 3DE1X 3U60B 4INOA 4Z6KA 4ND8A 3EGIA 4KQCA 1PO7A 2SECE 3F7OA 1NKVA 3EIQA 1P39A 1G66A 1VJ5A 4AIRA 4FS8A 1YTLA 3UJNA 4FJ1A 3U9LA 1ZM9A 4F84A 1QVAA 3QLTA 4WY8A 3DB2A 3MM4A 4A8JB 4LJRA 1XWWA 3KETA 1QU2A 3MILA 3T3OA 2X8WA 3HCFA 4WW0A 3FFBA 4MAMA 4BOYA 2FDRA 3RS9A 3ICCA 5EP3A 4XVQA 1KNQA 1NF2A 5A5FA 2BM0A 4WJZA 1T9HA 2XCIA 2L18A 2QRHA 3ZCVA 1AQNA 2X8JB 1R18A 2Z4TA 3KQQA 4PYNA 4QJIA 2QW0X 2GHTA 4EHKA 1G9TA 2OGWA 3FFXA 4PR3A 5J59A 3CW9A 1HWYA 4UBLA 3VDMA 1SVMA 1W44A 4KFRA 4EKNB 5KQMA 2DWCA 4GI1A 3VNUA 4QREA 2PYIA 1ZRHA 3KZNA 3MCUA 4MWSA 1A4XA 3S2GA 3AR5A 2W58A 4BVAA 4DGQA 2O2YA 1QM5A 2IYTA 2NVWA 1P1CA 2NZJA 3RYHA 4AZSA 3N5KA 5DBFA 3M6XA 1YDFA 2ZIEA 1IBRA 3ANYB 2D74A 4EKDA 1U8FO 1FFBA 2Z4RA 4I55F 5ERYA 5DNAA 5F2KA 3KC2A 1NVGA 4HFMA 5I7WA 2WPNA 5BNWA 4GRAA 1BE0A 2QUJA 3QYFA 4RS3A 4BBZA 1PWXA 1Z6GA 2JIZD 5JVDF 3BRSA 3FI9A 1BJTA 3FZQA 3X1KA 2RGDA 1NAHA 1L9XA 2Z1MA 3IEXA 2PQ0A 4R5MA 4JT9A 3TW8A 3GUYA 1YE3A 4Y2XA 4W63A 2YZ2A 4UNQA 4RF3A 4GPEA 1E1YA 2OORC 1G2PA 2AUMA 4BCCA 4RANA 4ZCPA 1OLSB 1F17A 2H5LA 3DT6A 4LRYA 5EP2A 3CS3A 3V8PA 3MS4A 1RW4A 2JFPA 5H80A 3UK1A 1L7QA 1NI4B 1NUUA 1NX6A 2GM9A 4MUNA 4RSHA 4YRLA 3D9QX 4A4DA 5M3BA 2FH5B 3X3HA 5DLPA 2UUAB 1JIUA 1XNRB 3C5WP 2Q27A 1C3XA 2GRUA 5AVJA 3TLZA 1DAMA 621PA 4FU0A 4OIFA 3GPBA 4PYLA 4I66A 4JR1A 1CG6A 5IC5A 3PPXA 2PNFA 4J1TC 1YJ5A 4WNCA 3DKIA 4OHZA 3WLIA 4BVHA 1LDEA 2GOYA 1X77A 2QMHA 2I5PO 2VJPA 2ZRBA 3IP9A 2G6BA 2QR2A 3D1JA 4JP8A 2OMKA 4TT3D 3TNLA 2Q46A 2I3ZA 1V3VA 3WKEA 4QVGA 4LPKA 3CY6A 3SF8B 3W0LB 4DLSA 1CZNA 2HIMA 1LBIA 1PTJC 5D5PA 2C99A 3BYZA 4G0VA 3SQXA 1GJRA 1GZ4A 3OJOA 2V65A 1E7RA 4BFSA 4G84A 2OV1A 1C8VB 1JIKA 3LT2A 4R41A 4P5EA 1JHXA 1LPSA 3PVSA 2W2QA 3A1SA 2PGIA 3S7ZA 5EIAA 5KTMA 1WDLA 3O4VA 4BL5A 3I6IA 2NN3C 2BFCA 1K6XA 3S81A 4QYIB 4BVEA 2PYDA 1VJGA 2RHTA 3TBFA 2GPJA 2CN1A 3BVPA 4TZ6A 3MXTA 1ISMA 4TYYA 3FYUA 2A84A 3O4RA 2N1MA 3IAEA 1U7WA 2QL9A 5EHGA 4KR0A 1RJ9A 3WL5A 4E30A 5JNTA 3E5NA 3DBHB 4OEHA 2Q5QA 2WHYA 2FWJA 4ALJA 2I29A 2CNOA 1YV9A 3K0AA 4CIWA 1X1DA 1KU0A 4HR7A 4WMLA 2AYXA 2RSLA 4C1BA 2XDWA 2B82A 3FNHA 3NUZA 2WF7A 1Q0QA 1G9SA 2QREE 3QEMA 4FYIA 5D6OA 2O6LA 1I0IA 2KSQA 1E7MA 4R1SA 2ZI7A 3YASA 3GP8A 3KFVA 5DYYA 5FX2A 1Q1EA 2WJYA 4P4SB 1U6KA 4ER7A 1MJHA 1U3WA 2OO7A 4MUEA 4B7AA 2MYTA 2QTAA 2IBMA 3PRJA 1Z0DA 1E20A 3R0VA 1I13A 2VL7A 5LQMA 3WKAA 3S4YA 3TOSA 1W0KA 4MINA 3I01M 2JGEA 1SCQA 3PG5A 4GDMA 4ES6A 1XZGA 1TYEB 3WE7A 4GE3A 3EMDA 2WMDA 2YNMA 3L4EA 1CB0A 1UC9A 2G1PA 4RVDA 5CG1A 1ZAKA 1E9VA 1XUOA 1QYCA 5HUHA 2QT9A 1RQ7A 2RG7A 3H4MA 1E59A 4TMXA 3MWDB 1NV8A 3UUGA 4XDHA 3WO1A 1ISJA 3G17A 4UZEA 2DGDA 3BUSA 4BO1A 1ZRNA 2B1QA 4LF8B 2XXAB 1SMKA 5DV9A 3SEFA 1VPVA 3ZWMA 4AKTA 2D2IA 2R6DA 3TLJA 2F17A 5IMBA 2H1IA 3JQCA 1NR1A 9MHTA 3L7LA 2WEKA 4B5LA 2FWNA 3BMQB 3K09A 2DWPA 5AM4A 5AVOA 3ZZMA 1T4DA 5HS4A 3O8OA 2XNDD 3S1AA 3GLIB 1MQ9A 1ZL2A 1K8RA 4HV4A 3O92A 1CB7A 4TMFA 1TLTA 1L4NA 2AB0A 2IZ5A 5AJVB 4POOA 1ZH8A 3DFMA 3L8CA 5HQJA 1Y6GA 1H6DA 3GUUA 1MDFA 5E3HA 1TIBA 1M3SA 5AUNB 3DLCA 3KV3O 3ON5A 2D3WA 1G98A 5BW8A 2GPSA 2NAPA 2YXEA 1OHHD 4XOIA 3L0ZA 4RV4A 3H9JA 1XEWY 3IT1A 3RRFA 4X64B 3A6LA 3T94A 2HEIA 3AY6A 1C0LA 1AIPA 5EERA 4Y1FA 4BNIA 2H2HA 1O96B 1W76A 2GKOA 1V43A 3P9QA 4GZLA 3LKZA 3T0FA 2CT8A 4FZVA 2YDYA 4NK4A 3CF0A 1ISFA 2ZRNA 2C94A 2ZYWX 4HGQA 3TLMA 2Y1KA 3T7DA 5BT8A 5IULC 3N7UA 4A7PA 2FF5A 3FSRA 5A0FA 2IBTA 1ESDA 1A72A 4S1VA 1EWTA 3RV4A 4G07A 2GDJA 3TINA 3GLRA 3BL6A 4DREA 2AHRA 2Q6TA 1MRNA 2YFHA 1ZRMA 2XDAA 2BM9A 1HSZA 1TM1E 4L50A 1U3CA 2NG1A 3L4BC 2FPXA 4U8GA 1AQYA 2FTKE 4KQ1A 1GVNB 2DKNA 4RH3A 4YJ3B 2Q5CA 1JJBA 4WESB 4P3XA 5DM2A 4TRRA 4M0PA 3PUJA 4HEHA 1I4TD 2CL6X 3OIDA 1Q7EA 1UINA 3LY5A 3SBEA 4AZTA 3EGOA 1UKAA 3K30A 2IVFA 4Q4AA 4BQQA 5KI6A 3K6JA 4DCGA 2R84A 4N5MA 1CUGA 3ZHYA 1FYFA 2IKSA 4DCUA 3BAZA 3MYYA 2DZDA 4E14A 1Y9DA 2JD0A 3SC2B 3ZDDA 1WF6A 3MUEA 1NPYA 2BUCA 2CUKA 3ASVA 2YV5A 2WAAA 3LBIA 2H9AA 3O38A 3W77A 3ZY5A 2OM2A 1I24A 3VFDA 4LXIA 4YP7A 4A0RA 4IEFB 4DIDA 1JG4A 7ABPA 3DVAA 1IBCA 4B6PA 1SKBA 4A8TA 4B74A 4EYQA 2P0AA 3REGA 5FTMA 2XTMA 2JW5A 1E2IA 3W5VA 2VHVA 2BFEA 1BU8A 2BFNA 3GZNB 1R88A 4M1OA 4NSNA 1TECE 5FOQA 5AO9A 4D9NA 1KSJA 4PAOA 3NG1A 2RE8A 4BO0A 2Y1XA 4DUGD 1OXMA 3KYJB 1FC0A 5CEJA 4OLAA 1YB7A 1E2GA 1LPAB 4GLFA 3RVMA 4CG0A 2Z8XA 2QPOA 4V0RA 4MWGA 1LDMA 1A8QA 3DAGA 1Y7TA 5CP8A 5ITZA 4MUGA 1FJGB 5AKZA 2UXCB 2G82A 4WLUA 4K81B 3UK7A 4A3SA 4QG3A 4G67A 2P7HA 2H1FA 1GADO 2P4UA 3DF7A 3QEOA 1Y5MA 5GQSA 4MZXA 4AYXA 1VE3A 1ZVKA 2W37A 1Q15A 4M1MA 3LXXA 2FSHA 1F3LA 1WB4A 2R8BA 4P3OA 4DQKA 1T8WA 2BBTA 1NBHA 1J70A 1QFJA 4ML3A 2GN8A 4U9IS 5EJ2A 4BVGA 1CE8B 3LV9A 5EJFA 3QKIA 4HXFB 1YB1A 4C7BA 5ALXA 3AYXB 4MV4A 3TPZA 2LRHA 2QX7A 4HLQB 4J07A 3EXEB 2WHQA 4IZOA 5CW1A 3VYWA 4C76A 1I5OA 1PE0A 1YKFA 1K75A 1Y4AE 3FDZA 5CYGA 1V37A 3H99A 4WWHA 4C08A 1EA7A 4DY6A 4KACA 4HUQB 2YQZA 5HM6A 3SJZA 2I6XA 2QDXA 5EXDA 5EHIA 4FYPA 3R7FA 2REOA 3FRHA 3V4SA 1U9IA 3JQ7B 4FILA 3H2BA 3V4OA 4FRYA 3T7CA 1TM2A 3FH0A 5EZ6B 4UEJA 4TYPA 1YQXA 3DHEA 3DP9A 4Z8YA 2C2WA 1PSZA 1OU0A 2CMFA 2FSUA 2OHJA 5EXXA 1JJFA 4AO7A 4AWXA 3R5XA 2CL5A 2WWXA 1TEZA 2PZEA 1SG9A 4XIJA 3ZBPA 1JKXA 3AL2A 3R6DA 2OXEA 3KQNA 5A7FA 2O2XA 1WEKA 2ALJA 2BFFA 3Q72A 4FX5A 3BJRA 4E7OA 4RA6B 4AKHA 5KQSA 5B6PA 1IJFA 3BWCA 3KFXA 7MHTA 1XKFA 2A4MA 5EWJA 1PZMA 3G8AA 3ZR4B 4H4CA 1CHDA 1EM8A 2PGDA 3S1SA 1MN6A 3FOZA 3OEWA 4BRSA 5CFPA 2H8GA 4ARIA 4CMEA 4QGBA 5FB3A 2V03A 2E4ZA 1SZCA 2C3YA 1T2DA 1U8AA 2BFPA 3F9CA 4D8TA 2I65A 3I2KA 3G0HA 2D1TA 4ZVPA 1M5RA 4FHFA 4PIVA 3HXOA 4XGNA 3OE1A 4N4AA 3ROTA 2E55A 4GGMX 3OH8A 3LQKA 1GCOA 1CJSA 2XUQA 5BSEA 5K25C 4FFBB 2WY2D 3WGZA 2NT4A 3THXA 1XN1A 1C9YA 2O2GA 3I6QA 3IVAA 2E49A 3UB4A 3VNBA 3RSLA 3VYVA 1FS6A 4DR5B 3QBTA 2JASA 3TB4A 2FQWA 4CLOA 2BEWA 3ESZA 2O3JA 4RFVA 4PHFA 1NWCA 1M6YA 4DAOA 1OWMA 3NHRA 4NENA 2RAVA 2EDAA 2HNBA 2JHPA 4AZ3B 2IYSA 1E1CB 3AVVA 4C0XA 1M73E 1NUHA 2G28A 2VDWA 4J7UA 3KOOA 1NTRA 4G0QA 1TC1A 4IX9A 1JEEA 3KLMX 2OLEA 4ZVUA 1AK9A 2PKYX 3ZHQA 4DARA 1S7GA 1BW9A 3EDRA 4RV9A 2V0NA 3OQ6A 1VPWA 3HUEA 1TQ4A 1JEQA 2BTQA 2VPXA 3J81k 1VCNA 3NOQA 1P61B 2ICAA 2XECA 4KHZA 4IIJA 4CR6A 3ND5A 1NVAA 1KQOA 4C3OB 4KGDA 1OX5A 4J6FA 2VQSA 4IMPA 4NYIR 1AF4A 1MV8A 1EFCA 3G9TA 1TAGA 1M74A 3WYNA 3F71A 4K7JA 1H0RA 3N7TA 1IQRA 3CRZA 3NASA 3SU8A 2AEEA 4N39A 2J0SA 4XCXA 2YJ5A 2OO5C 5ECGC 3NBZC 3ROPA 3OLXA 3LF2A 2CZQA 3T34A 721PA 3GCZA 3D5QA 3DMFA 3RANA 3I5UA 1CQJB 4A0SA 3U6BA 2XGSA 3E61A 3HWSA 1E9EA 5K1ZA 1A1SA 1FSSA 4I36A 2JCGA 4YCAA 4EYKA 4CU5A 1PX2A 1JR3D 3VBEA 3KPYA 2XMGA 5JZSA 4W5QA 1FFXA 1M2OA 4ID9A 4W1SA 3RFCA 1P2FA 4KN8A 4F04A 4CZ2A 4DDTA 4I1UA 1QCYA 1Q1NA 2I6FA 5DNWA 2EEZA 1IU9A 1FYVA 1DG9A 2V9CA 2XADA 3UK6A 3F5DA 5HRAA 3P20A 2YHAA 4Q1AA 2QTFA 4ZOQI 4UCXA 3IT0A 2F3RA 3QVUA 5AXCA 4W5NA 1VJRA 3U3JA 3BFPA 3KYCA 3T9FA 3VKVA 3HB9A 4FR0A 3STYA 3TWOA 3BSWA 3C8ZA 1TO1E 1Z07A 3B9RA 1UZNA 3KXPA 1YHZA 4OI4A 3S2IA 3TLYA 2F90A 5ES4B 5LU9A 3HXLA 4BASA 3QPCA 5E7MA 2QIOA 5EE0A 3E3LA 3RC1A 1L4YA 2YC4C 5IC6A 3AR9A 4PFSA 3ZS9A 5DLEA 1V11A 3ZG6A 2F8TA 3A04A 4JZKA 3G8CA 2FN7A 3QJYA 5CX1A 2ZTLA 2ORVA 4GXTA 4KC0A 1N9KA 1B8NA 3RC9A 2QA5A 4I55B 3N7AA 4TTVA 1N9ZA 4RBNA 4DVGA 2NWQA 4KITB 1E89A 1P7PA 3T5PA 4NFSA 2NVUA 3ZZ1A 4DWJA 4YQYA 4DPMA 1X87A 3O7WA 3IR7A 4DCJA 1UFQA 3GJYA 3EHDA 2C2OA 3E8SA 1KK2A 5JVDB 1J2UA 4CQNA 2WR8A 4PQYA 4FOTA 4H15A 3DKRA 4XGQA 1T1RA 1MB3A 1PL0A 1TZBA 3WK9A 2AR0A 2VYVD 3GT3A 5EMKA 5EEHA 2HUPA 4GZ5A 4TTSA 4KIFA 5CU7A 1QE5A 3FY4A 1RKQA 4IHKA 5WRFA 5CNIA 1C1XB 1V35A 3FFAA 3SQMA 2ATXA 2FPWA 3PUHA 3KTAA 3E5MA 1QE0A 4IEIA 4LMBA 5BOSA 4H1HA 2Q0HA 1MABA 3R5HA 4H3HB 4JWKA 1QSGA 1NN3A 5COAA 3DE4X 2J07A 5B1YA 3GCWA 3H1EA 3KJFA 4O4JA 3DLIA 3P19A 1YA8A 2IDJA 4WECA 4BAZA 4JLKA 3U7GA 4CIBA 2ZI3A 3FKSA 4NC9A 1BZYA 1C2YA 2QS9A 3ZYZA 1YU9A 1O77A 4FC7A 1XEXA 4EFNA 5LQCA 3IQEA 2IS2A 5F7JA 5CAEA 4RELA 2QBYB 5HZMA 1U11A 5C4IA 4YP6A 3C6KA 4D43A 4EQ6A 1JQBA 2FW8A 4XIFA 1Q3HA 2RGAA 1DTEA 4JEIA 2QNRA 2P9QA 3SF0A 2J5RA 4J0GA 4BX0A 3V2UA 4EPYA 2YY7A 1OIXA 2PGNA 2PV7A 3E0QA 4P9NA 4CG1A 4O33A 4H3VA 3DVLA 4FFMA 4IDOA 1V8ZA 1GPUA 3SSOA 4CODB 1C2TA 2OCBA 3JWGA 2N46A 5DH9A 5HQ3B 3TF5A 1B1AA 4BBPA 4BVFA 5B1SA 2AQ8A 1TNDA 2I1QA 2JGNA 5B7QA 2W6NA 1HLFA 4ZT2A 2O8FA 3DHVA 4UREA 2VTDA 3FF4A 3JZAA 4IIJF 4ISBA 1MB2A 1LH0A 5LWHA 1IH8A 2IUSA 3BK2A 3PE4A 5JBIA 2IXBA 2BAGA 1A0OA 4URVR 3VAYA 3GMDA 1D1SA 4J4TA 4YP5A 4Y98A 4H7HA 1UKYA 1KOGA 1PT8A 1ECLA 2YS7A 4PZCA 1UJNA 3FYUC 3KSDO 3GRFA 4QJ4A 3LBFA 1XGKA 1XRQA 1FTYA 2ORWA 3NVDA 1BOOA 1PV2A 2AV6A 2VLBA 1VM6A 1U1FA 2PBLA 3IYLW 1DO0A 3D2BA 2OTCA 3LUFA 1B4DA 1ZK3A 2WFLA 4GL4A 4LOAA 4MCIA 4B7UA 3ORQA 4BJ5A 4Q4LA 4YT8A 1IHYA 2VDVE 2H59A 5LPNA 2D2XA 1M0EA 5F9FA 5H7XA 2PEYA 4H59A 3WLEA 3KKEA 1P3Y1 1PZGA 1EBFA 3H17A 1FRVA 3EZFA 3FM9A 4C2UA 3WX0A 4PWYA 3DGFC 3ANNA 3UCFA 1JA1A 1VIYA 1DT3A 3CRNA 3IALA 2PMDA 1TB4A 2R25B 4NI5A 1MW9X 4R01A 3EVEA 1B6SA 1G0OA 1VL6A 3JR7A 4MS4A 2C42A 1I7QB 1XOIA 4C43A 1XVUA 4F06A 1QC5A 4FVTA 4UKDA 1OBCA 4PXSA 2W6OA 5KHOC 3W6ZA 4YO7A 1N6LA 4JLDA 2FETA 3AUKA 4ENVA 4GL2A 1AKNA 1T6YA 3W7AA 2GWHA 1VMAA 4XI9A 2R6GA 4HDRB 3M3PA 2QGZA 3UOAB 2YNMC 2BE9A 1QOQB 4MVXA 1EBUA 2CKDA 2VJMA 4IYSA 4U0JA 3RYHB 2IX3A 3ZXIA 3U16A 2JCYA 3CISA 3DZDA 2LGJA 4DFDA 3PZRA 4DV3B 1GSAA 3K0EA 4FT2A 3K0HA 2FUG6 4U1RA 4YJHB 2WQ6A 3FOEC 5JMWA 3FLAA 2XCSB 3SR0A 5AM0A 2Q7XA 3DKVA 2RGYA 1U8EA 1ZOLA 3FROA 1QRDA 3FGNA 1RSZA 4HNRA 4L1KA 1CP3A 3R3UA 2OZKA 4DF3A 2E5WA 4L16A 1EVQA 4H6XA 3ZKAA 3H5TA 3TW8B 3UMJA 1ONOA 3T0IA 1JKMA 4LFCB 2ZUEA 2JK1A 4KAFA 4EMUA 4FJ2A 5AI0A 4TVBA 4YCMA 2C1EA 1AM4D 3FTCA 4CGZA 1FUEA 6PFKA 4V0QA 2C5HA 3NVMB 3UWKA 3AF4A 4RX1A 3SZLA 2X13A 3S1LA 4A6PA 1V1RB 4OGGA 5KQGA 2CDCA 5J4LA 1X1CA 3K6RA 4ARBA 4R40A 1F2DA 4JDUA 1L5RA 2GBIA 2GPBA 4C89A 1U8CB 3HZRA 2VYND 4CEHA 4DDHA 4AG6A 4KN9S 2J0EA 5DP1A 3MHPA 4QTUB 3ZWKA 1G3QA 2QN2A 4O4JF 3CUSA 3TQQA 1KC3A 4P08A 2I87A 3IP3A 4MGEA 3U1VA 4Q4HA 2VJLA 3JV7A 2DP4E 1RBYA 4FHGA 2QG4A 1C9NA 3UT0A 4W8HA 4F2DA 5D8DA 1KDPA 1Q17A 1LS6A 3KPJA 5C8ZA 4O4IA 1TYZA 3VR4D 1EFHA 3CUTA 4RORA 4GSKA 10MHA 1AUPA 2QI9C 3QVSA 1XQXA 2CL7X 5KYTA 4UULA 4K88A 1HYBA 4D57A 4Y2VA 3WKCA 3CHYA 2AOTA 4NBSA 5E2AA 4BEJA 3HGTA 3IUSA 3ZC3A 4E09A 5DHRA 1E3IA 4L28A 5CDYA 1NXTA 4WPGA 1J42A 4G6ZA 5AVKA 1RXWA 2BUBA 2EBWA 5D3ZA 2XOEA 4D25A 1BE8A 5K6AA 2N75A 3N8IA 4MQMA 3EZLA 4NKRA 2G0AA 4JA0A 2PUBA 1ORTA 5JXJA 3E1SA 1FFYA 4OYLA 3Q3EA 3JCZA 1JDNA 5FUVA 2RFLA 2E3JA 2ZROA 3EZ9A 4PLWA 2Y76A 2H00A 4G1CA 3L0YA 1C1YA 4MPDA 1I0LA 4BBJA 1JRLA 3NXKA 1Y98A 1IULA 3QOWA 2HJHA 3JD0A 3LSTA 4E22A 4R16A 5BSTA 4LY0A 1Z5WA 2J5BA 3K0AB 4Z3DA 3EZ6A 3QX8A 3VQTA 3BEOA 4DILA 3GB9A 4RY8A 1QHYA 1YZNA 2GHIA 2HPVA 3QEMB 3DEIA 4DR6B 3P71T 4ZICA 3U56A 1IBLB 3OZDA 1UKBA 4MP6A 2C07A 5E2BA 3TSZA 2AFHA 3GEMA 1F0PA 4YDQA 1WU8A 2HDHA 4GYKA 5CB0A 2YXPX 2HYDA 3DO6A 1U99A 2QAJA 4GHWA 1I1HA 2Q3FA 2QSJA 1F9AA 3QF7A 2PKRA 4NICA 4C0SA 3IS3A 5JYBA 4KWIA 3U4HA 1P5RA 2GZSA 5IABA 4AG5A 2OHIA 4LZNA 1IQUA 1Y5IA 1TW3A 3DVRX 4Q34A 2UXDB 4LE0A 3TW6A 4KL8S 1VPLA 2HU8A 5EMJA 4UHFA 4DIEA 3VNSA 4X93A 1DRKA 2WIAA 3DL2A 4PTYA 3CRRA 4WFKA 5HZGA 1DQSA 2O7SA 4JUCA 1NBEA 3AR2A 3HJCA 1G6HA 3I83A 3QPVA 3L7AA 1QMPA 3U3XA 4YYEA 3B2QA 2UYOA 4R0NA 4TS4A 1IHUA 1TZCA 3FWPA 1JBQA 1ECGA 1JEOA 2C9BA 2VOEA 3GO4A 4GOLD 3L6EA 4CKWB 4XDGA 3T12A 2PT5A 5C7IO 2J9ZB 5F98A 2SKCA 3EW9A 3L7IA 5C53B 2AK3A 2W42A 1IY0A 1CUHA 3PDJA 3PNYA 3S1AB 1YZFA 2B4RO 3MTAA 3WV4A 1I01A 2X7HA 4X90A 4YY3B 2YBEA 2IY9A 1SM4A 1A88A 1U9IC 1AY0A 2OAQ1 4B40A 4EQZA 2ACVA 1QH1A 1YE5A 2P1DA 2EKBA 5BP7A 1ADGA 2YY5A 2A1TR 2ZIXA 4G23A 4GRIA 4EKYA 3VMFA 5ALDA 4OIMA 4N12A 1KS2A 2QMOA 3NDPA 3G6WA 2DLNA 2X8LA 4BNXA 4TXMA 1F2TA 1RQPA 3GUVA 4ZDIA 1KP2A 1Z5UA 4E03A 2C7RA 1T1GA 1KK0A 4MAAA 4KYIB 3K8OE 2HK6A 3QUTA 1LVUA 3LYAA 4ZI7A 2WMYA 2WDZA 1DPGA 3OFNA 2ISSD 2J3MA 2LZ0A 3OPMA 4MLPA 4P2GA 3W6OA 1GEEA 1HDZA 2WUVA 4LECA 2DQZA 3IESA 1ZD4A 2OCAA 3HMQA 1W4ZA 2VAWA 4WX2B 4BLQA 2UV8A 4HDKB 2VZLA 3CLRC 1YFKA 4D9HA 1T29A 4CMEC 1G1MA 3MERA 3O8LA 5C4MA 4F92B 1I2AA 3PB3A 3LZDA 3ONVA 1CVIA 5KNCH 1V4VA 2JGIA 1OZFA 4EFDA 1QTRA 9ABPA 5DPMA 4RHUA 2X41A 5H59A 3WG9A 2C2BA 1CY0A 2JLUA 3C97A 3CZQA 3IILA 4O4IF 4OOFA 1AKWA 2YS6A 1C7FA 4Q4AB 5AI8A 1IN1A 5FLYA 4RFSA 4UHJA 3WKDA 1M2VA 4LNAA 4EMTA 3ND6A 1P62B 1T6NA 5DSXA 5F1PA 4UE6A 1P74A 5B1HA 5J4HA 1JU9A 1LV7A 2ESRA 1XMPA 1RCUA 2FE1A 2Q49A 3IVGA 2OKCA 9GPBA 4AROA 3UMSA 4QA9A 3ZDRA 2HL6A 4XR4A 1XVVA 1MFZA 5B7PA 1E5XA 5J2TF 1VE7A 3CXUA 3HBJA 1PV4A 1QMGA 1WUYA 1YRHA 4YO8A 1C41A 1ORVA 2V0GA 3LCRA 2O1EA 5K0FA 5FV4A 5K03A 2KM1A 4ALLA 3TB6A 4EHAA 4IIGA 1XQYA 2TRSB 4MDEA 2FPRA 3ENQA 1MC1A 4ECAA 4OQNA 2GO1A 3AHHA 2P91A 3QQ5A 3MCAA 4LWZA 4A1OA 4DWOA 1UM9A 1JIIA 2I4IA 2N3ZA 2W43A 4QZVA 1QQAA 5G3ZA 2H1RA 1BIFA 2PU5A 1EFTA 1GKKA 4QXQA 3AW8A 1YI0A 2B9EA 2FJPA 1I94B 3L7KA 3DL0A 5ITZB 1RTTA 3F9RA 1NBWB 5AW7A 4R69A 5FBVB 3T3NA 2RHRA 4M0DA 2NMVA 2WVHA 1NA5A 3RVSA 3V7WA 3RLFA 1NYLA 3B1YA 1ODFA 4DCVA 1L5FA 4Z49A 1EIZA 3H6KA 4UAUA 1XZEA 3F3SA 5D3KA 5KVQA 2ZFUA 5A5GA 1E79A 4J43A 3KEMA 3DNPA 3WJ1A 2ZJ1A 3FCYA 1S1MA 2FZVA 2O1XA 2PZ8A 3MB5A 3SYRA 2A3RA 3KNZA 3TTXA 1F0YA 2I3BA 1F48A 2MR6A 2ONYA 4TLCA 5AOAA 5EL0A 3C0KA 3DCJA 5THXA 3ZJYA 2OPHA 4I9FA 4AUEA 5CJ2A 3MFYA 1G8SA 4QPCA 1UOOA 1YJCA 5AKKA 2RH9B 1QIFA 2WMNB 2XNCA 2J32A 4BDSA 1EP9A 1YOVB 1IDN1 2FX5A 1M8FA 1PUXA 4XGKA 2PPLA 2PRJA 4M6WB 4Q48A 3N2GA 4IIYA 3JZFA 4P31A 1N8SA 3H2ZA 1WX1A 3L7OA 3OP4A 4KDFA 4LYDA 3ZV4A 1SIBE 3L0OA 5DIFA 4AUNA 3PU6A 4BLOA 1UDXA 1LNZA 3EY4A 4E6EA 2VH2A 3TRKA 4LHWA 2V7QA 3BBPA 2D0PB 1NT2A 4J0EA 2CMHA 3DDWA 4L72A 3R7DA 2BFFB 4GQBA 5EJAA 5CA1F 1JWLA 3KUDA 4A23A 4RHXA 4XCQA 2D4HA 4X24A 2A59A 1GPH1 3C5CA 4D98A 2VK2A 3H6HA 3LQ1A 4AS1A 1GCUA 5JPCA 5CLLA 1G8HA 3HDYA 1XMSA 1JQJC 1JTVA 1K7EB 1UBLS 5CYOA 5DTRA 3VDNB 2I9KA 1KEVA 1LDBA 1XZJA 1VPTA 3PBKA 5IJXA 4KBFA 4ZI7F 2XAUA 4RYDA 3VPBA 3M4JA 2FK7A 2WJ6A 2XE7A 4MW1A 1ZMOA 2ZETA 4JKYA 2FNAA 3EDYA 5D6NA 5K4AA 1NQXA 4EOGA 3U13A 2ZP1A 3RE1A 5IJWA 2HWYA 3WNZA 2IYFA 1I2ZA 4C5BA 1S01A 1DXQA 3Q8LA 5L95A 3W5UA 1N3YA 2YN4A 4CI9A 4D4KA 2G1JA 3HVUA 5EHXA 4KPGA 4MUFA 2JLZA 4QGGA 2IHTA 1O6CA 3K5HA 1PYGA 3BCSA 4MARA 4URWR 5K45A 3THXB 2C88A 3B20A 4E2XA 3CUVA 1ZCZA 5K3DA 2Z3WA 3FSEA 4MKGA 4NG5A 3MCTA 2BEWB 1GGFA 2W4MA 1DAGA 2VHUA 4ILEA 4J16A 1CRPA 3LZCA 2ZK7A 2NU7A 3AJ9A 4J75A 3NHMA 2B4TO 1UBKS 2GKGA 3B5EA 4B84A 4NBVA 2QSUA 5K8CA 2YRXA 1BH2A 1XZHA 2VDWB 3FIJA 1ENYA 4TN5A 3O3CA 1FX1A 4IIHA 3RGWS 4N03A 4YJDA 2DBRA 5IVDA 5IJ9B 2OK7A 3AM3A 4J0FA 2QPTA 1OTXA 2YQ5A 3QWAA 4YCSA 1BW9B 2EW1A 4RVHA 1FQJA 2M6KA 2YNMD 3PNKA 1SU6A 1WSAA 3BT7A 1JEYB 4B6QA 2NAFA 3LW7A 1JEQB 1SUAA 3SBDA 3MPOA 2GCNA 1TVEA 3DVQX 4G4GA 4IIJB 3R75A 1W35A 1U2ZA 2AG0A 3FRIA 3OO1A 5JQWA 2VNSA 4G2NA 6GPBA 1JE0A 4YGYA 1J22A 1K4KA 2IZ6A 4NU6A 2P4SA 1MMFB 2HJGA 1KARA 1QHHB 4PF1A 3TAUA 1PJ4A 2QQFA 4FINA 3TIXB 4DM4A 4DQXA 8GPBA 4CKBB 1SOAA 1WXEA 1D03A 1USUA 2ID4A 3DR5A 3QMVA 4HCJA 4TLLB 5ER6A 2X6RA 3ZNOA 4B2LA 5TXGA 4C05A 5M2QA 1J5EB 1F8FA 3SZOA 4JJZA 4UUAA 2HJWA 2OFOA 2ZE5A 3IKMB 1CJMA 4ND3A 3Q9UA 4WI1A 3DXZA 3PYXA 2OT3B 4HN4B 1COWA 3JQ6A 1S4MA 1XVIA 1P2UA 3C8HA 4IPTA 4R1PA 1U4SA 4S1WA 5FAKA 1XALA 1XHEA 3P32A 4J0JA 1G291 5A4FS 4WBSA 4RK1A 3RSZA 3WMWA 5AVYA 4K1LA 2I2AA 2NSYA 1M6NA 3M6IA 2CNWA 2F8LA 2QNIA 3D3JA 1MHTA 5D7NA 4L8FA 3SOPA 3X1XA 1YB5A 3AHIA 4BCDA 1RPTA 4GZ3A 2AFIA 1I3CA 4TLMB 5AI6A 2OBLA 3PFIA 4EWLA 2H17A 1IZ7A 3PUXA 3A6JA 4M0CA 1KXJA 2A0XA 3G5AA 4REQA 1JKIA 1AXEA 5H4HA 3MTDA 3MMSA 2OXTA 3W79A 2YWXA 3WGTA 3K05A 3QJ5A 2FRDA 4B4KA 2YW9A 3PC4A 1G7SA 3Q5GA 4WK4B 5CLGA 3C3AA 5A04A 1D2RA 3LDFA 5FJJA 4ZDWA 2OFWA 3BZBA 1LPBB 1HV8A 5G0SA 3FB1A 1IN5A 2QD2A 2YVLA 3NKLA 4Z4GA 1MZVA 1SB9A 2IKQA 1DCFA 3BCRA 5E95A 1EHCA 3ZQ6A 4YPFA 2VA8A 3LOQA 1J9EA 2PDAA 1V11B 3BD9A 3MRSA 2QLNA 3B9BA 3OQIA 1X9HA 5CX1B 4KJZA 3SR3A 3PEYA 1GGNA 2OG2A 3PNSA 2H63A 3EPLA 3RIYA 3WNBA 1K7FB 3WYCA 4MUMA 3FPCA 1AA9A 4A91A 4CNBA 1CR1A 1CRLA 4I19A 4EY6A 2TMYA 2RCNA 4FYYA 4BQOA 4BO9A 4D4JA 4EO7A 2PSFA 2W6QA 1F7VA 2ENWA 1DV2A 1FXWF 1Z88A 1T9AA 1QQ5A 3JRXA 4UD6A 2ZIAA 1Z28A 2Y66A 1VJ1A 3F3YA 4RHCA 5TPZD 4EW3A 1DBWA 2XZDA 1N2EA 4E70A 1UZMA 5IT4A 1DJPA 3HJAA 4JLOA 2QK4A 1GGKA 2G9NA 1ZNZA 4ND1A 1EB9A 3KTAB 1RFLA 4XDYA 1R10A 4RJKA 5D84A 5BOSB 4WXMA 4B35A 2F43A 3DPUA 1MABB 1OOEA 1VRWA 4L22A 2JZOA 2QV7A 3A27A 4MDFA 4IUCS 4K8RB 3KPCA 4O4JB 3K6EA 1T4BA 2F7SA 5K24C 2XR1A 4XTCS 1W73A 1E66A 2QW8A 2QZSA 2P79A 2QLLA 1P2SA 5LL6P 1Y8RB 3K3PA 4DE5A 1XEXB 3EPPA 1PFQA 3ORYA 4JP3A 3RRBA 5CAEB 4E1VA 2IRWA 3WZ2A 4C0KA 4ASUD 4XVCA 5IX8A 4EQ6B 3ZNNA 1IXZA 1MCZA 4OFBA 3ECCA 4KYVA 1K3UB 1UKCA 3P0HA 4OMDA 4YP1A 1WM1A 5AKHA 3WLMA 2QQ5A 3AJEA 3K0CA 3GLHE 4PC1A 4ABYA 2C4KA 4F45A 1BROA 3LUAA 1MAAA 2Y93A 1BXKA 2NO5A 3ETNA 3QTBA 3VI3B 3UB2A 1A5ZA 1D0VA 3JD1A 1E2HA 3VA7A 1WDKA 4RULA 2YRWA 4YMUA 4HATA 2ZM5A 1R6AA 3VAZA 1ADCA 1OPXA 3LX6A 4D74A 1SKUA 3HM2A 4RIGA 2UYHA 4L9RA 3GL9A 4IG4A 1OH7A 3C1AA 3DMYA 2HU7A 5K6AC 2ZDGA 2Z9CA 1MAUA 4IVPA 4DV5B 2QR5A 3CIFA 4QHYA 1EINA 1CFZA 3CTMA 5JLAA 4BFYA 3OT5A 5IM4A 4CKEA 2XA1A 1OFHA 1ZD3A 4NYMQ 5D3MA 4G4JA 1KBZA 4NECA 3CVVA 1BAPA 1YU6A 5DU2A 2NLOA 1ZH6A 1R0CA 2C5FA 3R09A 2ZYIA 3C7AA 3SEAA 4DSNA 1L7DA 1ZVVA 3IQIX 1QPGA 3UW1A 3HI4A 1JR2A 3DV2A 3OTHA 4ZDKA 4O3MA 3U4DA 4P33A 5IHPA 3N8KA 1OI7A 2Y67A 4MQ4A 2P11A 4BKOA 4TM8A 1QX4A 4Q82A 2JHFA 2X5KO 3D7RA 4ZVSA 2FG5A 2FOIA 5A3VA 3H1TA 3GLFE 1U0SY 4LRUA 1PQYA 4KQ9A 2WIDA 3L1VA 1SK8A 2QX8A 3DDOA 1M66A 2ZSUA 1BA3A 3HPQA 5ER9A 5LWQA 1V96A 2EJWA 3CLRD 4MYCA 2XGOA 2HHAA 3A4LA 1FP1D 3NXSA 2GBCA 4EUHA 3GLGB 2LKDA 4KE9A 4K87A 5J3JA 1H93A 2IDKA 3D1LA 4FTWA 4U2CA 1RYBA 1ATIA 1SVWA 3I12A 1TVMA 4RC9A 1TQ8A 2DTDA 3GVHA 3MRVA 5IDQA 1VKHA 2VJMB 4QUKA 4U2DA 5IAAA 3B1ZA 3LRTA 2FZ5A 5JMOA 3ED5A 3KKZA 3OZAA 4JY7A 5FTWA 3UUEA 5IUNC 3NAQA 3ZV7A 5KC9A 4JT8A 2WP0A 3PWKA 5LFAA 4F5EA 1HQYE 2IPLA 3P0FA 3KKMA 4HEQA 4ID3A 3PQDA 3V34A 1II0A 3CX3A 1JI0A 4MJXA 3SIPA 3U5ZB 4KFTA 4OF4A 2FSGA 2PRKA 1LQ2A 2Y2UA 3NONA 2A1IA 2X77A 5J23A 1FL9A 3MQFA 2JBHA 3UBTA 2GA9A 1AX9A 2HA2A 1Q14A 2A9PA 3MCWA 4ZMRA 1N34B 4QYXA 2EV9A 3UAXA 3C3DA 1GUZA 1QQBA 5AKLA 3O26A 4IBOA 2C2KA 1C9EA 3UW3A 3Q6NA 1NDUA 1NVXQ 3U9TA 2ZQYA 3CZRA 5KWVA 2UYCA 3TW0A 3ET5A 1QK4A 3AP1A 3NEJA 4XRRA 3QBVA 5AIAA 2OUXA 3PS9A 4C4SA 1DAPA 1Z39A 2O9JA 3ABIA 3LMKA 1PG0A 1J8YF 1Q7TA 1ODTC 4JGIA 3BWDD 5JQGA 4Z2AA 1GCIA 3E70C 3V3KA 1EFRA 5PNTA 1SHKA 4D0LB 1D2GA 2O7VA 3G3EA 3SX4A 5JT1A 3ZI4A 4B7CA 5IF3A 5FFMA 3Q85A 4TROA 3ICWA 4CL0A 4MRSA 4DQDA 1ZU4A 3WDKA 3WL7A 1CQPA 3E4DA 2QUIA 2IEBA 3OI8A 4MVJE 2P90A 1NBOA 1A77A 4O4IB 4XEUA 4HJRA 3G5LA 4LNUA 3ZK7A 4F2HA 1LX7A 4Q3CA 1DLJA 2A9RA 5JCPA 3NQ41 1SG6A 1XK7A 2D8MA 1JIVA 3B51X 3Q2IA 4L6IA 5FHRA 4F3KA 5LP6A 3COJA 3HV0A 2C9YA 1JYEA 2AOTB 2BEVA 2CXSA 2I7TA 4PHHA 1KVQA 4G9EA 4YB8A 2B35A 4B85A 4DIBA 2E85A 4PGAA 5CFZA 3TPFA 5J2TB 1Z12A 1QDLB 5IPFA 4LGCA 5FUQA 5HDBB 1TCUA 4YV7A 2DUMA 1XJWA 1AMNA 4I3FA 4KKVA 2BC9A 1NVMB 2JJMA 2ZBEA 4YALA 2VAPA 5EFZA 5E6RB 2DQKA 2GSWA 2OC9A 4QXPA 3FR8A 1S8OA 3EQZA 1V3TA 3L07A 4Q4JA 3V8MA 4RUK