4L28A

Crystal structure of delta516-525 human cystathionine beta-synthase d444n mutant containing c-terminal 6xhis tag
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
507
structure length
493
Chain Sequence
LWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFNQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQMVFGVVTAIDLLNFVAAQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystathionine beta-synthase
publication title Structural basis of regulation and oligomerization of human cystathionine beta-synthase, the central enzyme of transsulfuration.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 168
structure length 493
sequence length 507
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.22: Cystathionine beta-synthase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 4l28A03
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l28A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l28A02
2V03A 5DBEX 2RHGB 2BHTA 5BW6B 2QH1A 4QYSA 2OUXA 2UV4A 1TTPB 5DBHX 4D9KA 5E0KB 3GBYA 3L6BA 1WTCA 4D9CA 3FCAA 4WX2B 2NYCA 1TZKA 1WKVA 4LI3X 3DWIA 3FWSA 1UIMA 3HMKA 4D99A 3TDHC 3DWGA 3AEXA 5B53A 1C29B 1J0AA 2C2BA 5DVZA 2O2JA 4LMAA 4L27A 5CVCA 1TZMA 1A5AB 5D85A 2QRCE 1P5JA 2Q3DA 2D1FA 1VE1A 3K2VA 5IXJA 2RC3A 1J0EA 3L31A 4L28A 2ZY9A 5I7AA 3FNAA 1K7FB 4GQYA 1QOPB 1TZ2A 3IAUA 3SS9X 3X43A 2CLEB 5J5VA 5I7WA 1CW2B 3KPDA 4HPJB 5B1HA 1WDWB 1UINA 2ECOA 5IIPA 4ESYB 2GN2A 3PC4A 2CLMB 3FV6A 1JBQA 2D4ZA 4FXSA 5MMZA 3PC2A 2UV6A 3SPXA 5EY5B 5D87A 4AIRA 2ZSJA 2GN1A 1PBJA 4D9GA 3FHMA 2JC3A 2NYEA 4L0DA 2ISQA 4HN4B 4IY4A 4OFXA 1RQXA 2EF7A 2BHSA 1FCJA 5I7HA 5K24C 2EGUA 4XUGB 2Q3CA 2YZIA 1K7EB 5K25C 1K7XB 1BKSB 1TJPB 1A5BB 1BEUB 1PVMA 5JJCA 4GQWA 4IYSA 2OOYE 4HG0A 1J0BA 5J43A 3IQGX 1KFCB 2Q3BA 4ZU1X 3RR2A 4AECA 5DW0A 2QREE 3ORGA 1K8YB 2UV7A 4FRYA 5I7OA 3LFZA 2TRSB 3OCOA 4Y6GB 1K3UB 4IY2A 5I6DA 1Y5HA 3PR2B 1OASA 1E5XA 1QOQB 2YZQA 2TYSB 1WBJB 4D8WA 2UV5A 4NU8X 3L2BA 2CLIB 3OCMA 3TE5C 2DH6A 3BM5A 5T6MA 1F2DA 5D86A 1V8ZA 2O2EA 4F4FA 3KPBA 2WSYB 5LXQA 2TSYB 4LMBA 3FGPA 3L6CA 4D9IA 2QR1E 2RIFA 1PWHA 3DKIA 3DDJA 3HF7A 1KFBB 1A5SB 4HPXB 3ZEIA 5K22B 5B36A 1O58A 1K8XB 4IL5A 3X44A 4IY0A 2YVXA 4KKXB 2RH9B 3LHHA 2CLOB 5JISA 2CLKB 2YVZA 3IQHX 2EMQA 3VSAA 2P9MA 1V7CA 4NOCA 1V71A 5KINB 5B55A 1TDJA 4D9BA 2OOXE 1TYZA 4ZU6X 4O9KA 2C2GA 4D97A 4NEGA 4PCUA 1A50B 3TBHA 2QLVC 5B3AA 4L3VA 3I8NA 3FWRA 3PC3A 4D8UA 3SS7X 3VSDA 1C8VB 4GQVA 3LQNA 4IY3A 1TZJA 5C3UA 4JBNA 5HBGA 2QRDE 2J9YB 3AEYA 4P1GA 4DQWA 2YVYA 1XKFA 1TTQB 1VB3A 1K8ZB 3VBEA 1PWEA 3R0ZA 5KS7A 1C9DB 4D9MA 5IW8A 3T4NC 4P1OA 4D9EA 1X1QA 1Z7WA 4ESYA 1KL7A 2PQMA 5I7RA 2ZPUA 2ZR8A 4D96A 4COOA 3R0XA 2DH5A 2GN0A 4H27A 1FUYB 2CLHB 3VSCA 4D8TA 5D84A 2J9ZB 4D92A 3KH5A 3KXRA 4D9FA 4HT3B 3CEPB 3OI8A 5KZMB 2J9XB 1J0CA 4ZQCB 3L6RA 1KFEB 4UUUA 3K6EA 2RIHA 3IQIX 2EFYA 3LV9A 1KFJB 1VE5A 1Y7LA 1M54A 1KFKB 5DW3A 3SL7A 3V7NA 2O16A 1CX9B 4I1YA 1YAVA 2ECQA 5B1IA 5K23C 5CGQB 1UBSB 5IWCA 4HO1X 4JBLA 1J0DA 4OREX 1D6SA 2CLFB 3T4PA 1Z7YA 3KPCA 1O50A 2CLLB 2RKBA 2PFIA 4D9NA 3VC3A
chains in the Genus database with same CATH superfamily
4U2CA 3SSNA 3RJTA 1AKNA 1D1TA 1WX1A 1GFZA 2Q1TA 1ZU5A 2VTEA 3LLUA 1JDTA 4JL5A 3TSWA 5KNCH 4NH0A 1GZVA 2GH1A 3BB3A 2H1OA 1U7HA 3BS4A 2YMQA 4M9CA 1S3IA 3TIIA 3V2GA 4Z7JA 4YK7A 5C31A 2R1UA 3S5UA 4GMXA 3S1AA 1C14A 3TNDA 4JQCA 4N49A 4BE9A 1OI2A 4PZCA 4ENWA 1YE3A 4Q6BA 4PY2A 3WE7A 2CXRA 1NI3A 3K5PA 4MI9A 1OZAA 4W1RA 3QE0A 5E9AA 3TBFA 5BSHA 5JIBA 1AS0A 2CDBA 2B98A 5LYJF 1DHRA 5E0KB 1XMQB 4M0LA 3V1LA 1PKEA 4R5HA 4TT8A 1KVRA 2V6IA 2NNLD 3TXAA 3U7HB 3RJ5A 1O5OA 2PZKA 4OBBA 5BOSA 1RAFA 3KB8A 4C22A 3DT6A 4DLRA 3RLIA 1VYUA 4QQNA 3BXHA 4YRZA 5L7WA 3TW0A 3A4YA 1AJEA 3LBFA 4DNPA 1ORDA 2HLPA 2W6MA 2CD7A 5ADWA 1EESA 1XNJA 3RC7A 3AUKA 1HOXA 3EUEA 5BSEA 2J5BA 1N7IA 5T6BA 1QTQA 1B23P 1O6FA 1EFTA 1INLA 1JSCA 1YC2A 1W581 3I2GA 3DYBA 1ES9A 4WL0A 4EJSB 1IVYA 1TT7A 3I37X 3OO1A 1QLWA 4WKBA 4RWZA 1G60A 1MZVA 5ETJA 1I2MA 1I5RA 1RDFA 2WF7A 4DBVO 4E2FA 3JS5A 2QRHA 2W6ID 4RMJA 4JFRA 4S1PA 5EIWA 5EZQA 1SHTX 1YL7A 5DVZA 5TPWA 3R77A 3TUZC 1T5IA 4JL8A 3SR0A 3ZLUA 1YUBA 2BBSA 2Y2UA 4S2EA 5FOWA 2EKLA 2BFFB 4ZGGA 3IEVA 1KK0A 2B4KA 4NPCA 3KJQA 4GNRA 5H80A 2PWPA 2BGKA 1QHIA 3WRXA 3T38A 4Q93A 5CJPA 1QFZA 2NQTA 4WH0A 4E2XA 5TSDA 1U0LA 4LOLA 4WFKA 2I4IA 2H1VA 4MRVA 1IZ8A 2GCEA 1QU3A 3A6HA 1EE2A 2I5PO 4EMUA 3K2IA 5DXJA 4BYMA 1W93A 2CMKA 2JBWA 2YVLA 1V8PA 1R0ZA 1VC2A 3MWGA 5FADA 5TR9A 3H9EO 1KEEB 4GZ5A 4MVJA 2O8DB 5U9CA 2C0PA 2D7JA 2X9QA 2ZSKA 3CR8A 3GFFA 3L8CA 3MMNA 1JKFA 2IVZA 5KX5B 4LF7B 3GP8A 2HK8A 1J9EA 1M7HA 4OBXA 1F8FA 4Q9JA 1QRAA 3QUSA 4W8GA 1PJRA 3RS0A 4GIBA 2OTCA 3GBPA 3EC7A 3LH5A 3JVDA 3U7EB 2HQOA 4RXUA 2QVXX 3GLFA 1R0YA 4OQQA 3RTEA 2AKEA 4RSRA 1QOPB 3EQ7A 4HZIA 2YHIB 1G8PA 1F8GA 1O5IA 3L6UA 3F3SA 1G2PA 2YN4A 4GI3A 3BWBA 1G5PA 4GOLD 1ZAKA 5DBOA 1U0FA 1XU4A 1DPFA 1HDZA 1URPA 3IPLA 5JI3E 1XZMA 1Z0UA 2H11A 2X41A 3T7SA 2XDYA 3CB2A 3O94A 1IHPA 4IIUA 1GSIA 4KUHA 3FUXA 1XXLA 3S2UA 3F7NA 1R6TA 1YB4A 3RJ9A 3JQAA 3ZDEA 5BWCA 1A7UA 2FCRA 4BZQA 1ODIA 4UXHA 1SQ0A 4BMXA 2XNDA 3SCZA 1E61A 3A6EA 3AHHA 4HGRA 5JWRA 4TYNA 3OU6A 1QKKA 3LA8A 5JAQA 2D5AA 2B1JA 1W6RA 1JHUA 4RD6A 5FA8A 1E64A 3DPIA 3UT5A 2GN2A 2GK4A 2FR8A 1Q2XA 5KIAA 1JR3E 4F3CA 4IYJA 1XC7A 1CF9A 2G0NA 1V2GA 6YASA 1P1KA 1UDRA 3LGSA 2OD7A 3AZPA 2HYIC 1YZLA 5K4GA 1P72A 1WE2A 4WINA 3IBGA 1WZNA 3H9BA 1R18A 4LC1A 4Y2YA 3H2GA 3LL7A 1BX3A 5EY5B 1T2DA 1XJWA 3DYIA 1FP4A 4P31A 5EHIA 4C03A 4DT1A 2W6ZA 4MINA 1E32A 2O8CB 3VHQA 4BQOA 3KX2A 5ES4B 3RS5A 1NQOA 2ZS9A 4NMWA 2FRDA 4E4TA 2BGNA 1MC1A 2FPIA 4MV1A 3UJ6A 2BI8A 4ARUA 1QXSA 5TRTA 3ZNPA 1ZXBA 2XRYA 1S7GA 3U7FB 2P4UA 2IV3A 4PQRA 1MV5A 4G1EB 3KB2A 1B16A 4M7PA 3TQCA 2GWHA 1AO0A 4CODB 1YFKA 2DBYA 2XXJA 3EXHB 1L4YA 1DC3A 2C20A 4LF8B 3GGDA 2QYHA 1Z47A 4KBGA 4JJ6A 1EXVA 1J2JA 2RONA 3UXMA 5GONA 3AUYA 4IFBA 1J5EB 4CEIA 3DWEX 3HYSA 3IKLA 4TKUA 2GVNA 4RKYA 1HXHA 2XDAA 4MR8A 4WZ6A 1BJRE 1HF3A 4OA8A 4I1VA 4OM7A 5AUOB 3WYCA 3MG9A 2JIMA 3BGIA 3ZDXB 1ARZA 4I9HA 1C7IA 5DLYA 3SD7A 2HXGA 1V11A 1K7XB 1KARA 5KWIA 4GM4A 5CJ2A 3G0OA 4E2YA 1LDNA 1RI3A 1ZD2P 2QY6A 3MJCA 4DG9A 1PR3A 3GO4A 5FWDA 1P5ZB 2ZITA 3IEIA 5C3UA 3C5VA 3WL7A 5AD1A 5CFLA 1EZ4A 4Z54A 3AR9A 4G26A 3U40A 4Q05A 4RVOA 2QTFA 5IFKA 3ZH2A 3MQ4A 1JWLA 2OOYE 3AFOA 5EPUA 1QWOA 5KU1A 4Y1GA 3IQGX 1J8MF 3QNUA 1E77A 1IDN1 1TUGA 2BLNA 3EY9A 1H22A 2Z1NA 3O8LA 4QJ4A 4WCFB 5C4MA 3SZ3A 1HM5A 1CY0A 2NUAB 2ORED 1FUEA 4J0IA 2QREE 3FIUA 1R0LA 3CWZA 4MEBA 1VG9B 1T5BA 2JFGA 1R50A 1T36A 2EJBA 2VT3A 2YWFA 4N0EA 4OHPA 3VOBA 3U7RA 1VLJA 3FHOA 1E1CA 3PR3A 5K05A 1DCTA 2IEZA 3AJ8A 2QQGA 2ZVPX 3MOIA 4NBTA 1EDBA 1LJ8A 1GQYA 5JBNA 1USIA 1KC3A 1N3IA 2XCQA 4GMKA 1GPNA 1I7LA 2GHIA 1RADA 1FNCA 2G8NA 3FOCA 3L8FA 3RUAA 2CE7A 3EY4A 3EZGA 3LOUA 1NNLA 1LPSA 1VJCA 2GYYA 3OWHA 3WMEA 4F5EA 1ECBA 5HJ5A 4H1WA 5LZ2A 3K3PA 1CQPA 1LRLA 1JLLB 5I7EA 4YV1A 4F11A 1YJ8A 2FR1A 2M6LA 1XPJA 1JRLA 2XQFA 2I7CA 1E2DA 1GPDG 2TYSB 3AB3A 5EOVA 1I7SB 3ER8A 1OHHA 2AF4C 4R9NA 4XW2A 4E0BA 4EKNB 1NUSA 3F5DA 3F5SA 2D3TA 1O2DA 3O26A 2XMCA 3TE6A 1MBZA 1WZEA 1LK7A 2AR0A 4G24A 2PX6A 1UBUS 2WIBA 3H9JA 3NHKA 4LQDA 2PS9A 1M73E 3VYUB 1CD5A 2X22A 2XUHA 4F7WA 4DA4A 4PZEA 4RYDA 5ESRA 3A6FA 3GUCA 3N2IA 2PUBA 4A8JB 3MRSA 2K2QB 4FW8A 5K03A 2VJYA 4HUJA 3S29A 4P98A 4BVGA 3N2KB 5CLFA 2P4EA 3PB3A 2C0CA 2FPXA 1F9EA 4JC8A 2PPLA 4YRKA 3C5EA 3UAWA 3L6EA 1YO6A 2ZS7A 3L4EA 2O50A 3SZUA 3R5XA 1U5BB 1VXOA 4FDAA 4I0WB 4KQGA 2FVYA 2OXTA 1JHVA 3BJZA 4RFVA 4CKCA 1GT91 1ATZA 5G3ZA 4CF3A 5AW4A 1GPH1 4KREA 2GLTA 2UZAA 1K6EA 1NQAO 2P2LA 3MSXA 3RAJA 1HFKA 3TG8A 3U62A 3I09A 2WYIA 2ZCJA 3OICA 1E3IA 3HF7A 2QD2A 1U2ZA 1T8UA 2PA0A 3K9HA 4Q24A 4F91B 2FJUA 3F7OA 4HG2A 2EJVA 4RFLA 1ZMXA 5T67A 4DR2B 1RYMA 4DEVA 4LF4B 3SG0A 1RBMA 1QE3A 5EGNA 2PAFA 1Y8QB 3PXXA 3PFGA 1LW6E 2R1VA 4IP0A 5D3MA 2I87A 3CR3C 3TZCA 5J4YA 4RC9A 5JDIA 4KVGA 1KI2A 2I4LA 1EM8A 4TN1A 4YCMA 4ICIA 3WGTA 1FJXA 3BL8A 1HKHA 2WLTA 2AOTA 3RIHA 4YHHB 2QNRA 2BR3A 1JI0A 2EW1A 2FKAA 5EP2A 2VJCA 4IVNA 3ZZ1A 1WDMA 4LZJA 3SF0A 3JD0A 2RHDA 5H5JA 3WQQA 4JUIA 3MF4A 2DYKA 1T5DX 2IKSA 3W5SA 4R8VA 2VP0A 4DLVA 1JA1A 1J5PA 1RJFA 2CDAA 2CLKB 3JATA 2VI5A 4CTMA 5LVAA 4UBJA 3EA4A 2ZJZA 2C54A 3OFNA 3H3FA 4M3NA 3PTZA 4I08A 4W8HA 5C8ZA 3IL2A 3WHKA 2ZJBA 2WU8A 1TC1A 3ID6C 2QQ0A 3I5MA 3KJEA 3LL4A 1Q16A 2HBRA 3C8DA 5FTNA 4M60A 1DADA 1ZA2A 4M1ZA 1M1YA 2PZJA 1CU1A 2WFMA 1FQWA 4WI1A 2OOXE 5FEMA 2CEAA 3BSSA 4OQMA 2JI8A 3MD0A 3RUIA 3OI7A 1PT8A 3DTVD 3E9EA 2C4HA 2BR5A 3AR5A 4JLAA 2Q28A 1F20A 3MGCA 5EUBA 3L79A 1RR6A 2OWDA 3CN9A 3N2NA 4MV6A 3EIWA 4OEHA 2NIPA 3AB8A 3CGGA 4MWSA 3ZHUA 2YZMA 2IBTA 3MELA 3R7BA 1KY2A 5EMHA 1QFSA 3D3KA 4LXUA 4MI3A 1RKQA 1W0KD 2R8PA 5DMXA 4MR7B 2IOHA 3CX7A 2GRUA 3FMIA 2YH2A 5EQFA 4PZYA 5KVSA 3E48A 1TCVA 4ZOEA 3TW4A 4WJZA 2AFRA 1S3SA 1HNNA 9ABPA 3ECAA 4NY1A 1CR2A 2PT6A 4LQLA 2CXXA 4C5AA 4WKCA 4ALJA 2I9PA 4GEGA 1VDZA 2JJYA 2PVPA 1SA0A 2C5AA 4HADA 1UM9B 2E3JA 3DDNA 4P7JA 1PR1A 3NCHA 1OB2A 1UK9A 2O19A 3QSYA 1PO7A 2CK3D 3I4CA 2FWBA 2V98A 2YVYA 3Q2KA 4J94A 4F3KA 3LUPA 2EW8A 2WC1A 4BGUA 5I4KA 7REQB 3U7QA 3E53A 1ONSA 3ZDDA 1QFXA 2ZRPA 1L7QA 2Q4DA 3NMUF 4F2GA 5FF9A 1XLTC 3I83A 4X8HA 4F21A 7AT1A 2PX2A 4ZVTA 1CUXA 4N8EA 2OBLA 1G4AE 3TRJA 4RJ2A 4BNMA 5KS7A 3PGMA 5IAOA 3NNDA 4G09A 4BP9A 5KNCA 1UUFA 1HORA 4ND8A 4L22A 5IW8A 5BMOA 5CB8A 2BN4A 3MB5A 3ZD8A 1RAEA 3SC3A 3GCGA 1U63A 4L7VA 2ZOSA 3WK8A 2XOXA 4KRFA 4LYGA 3PHCA 2W22A 1KL7A 1RQNA 4D3ZA 2DBRA 4RE5A 2CZGA 3QIAA 3WKEA 1F4PA 1A69A 1GZUA 1NBHA 1RRKA 1A97A 3F5MA 2WF9A 2Z2ZA 1GGJA 3B8HA 1VG0B 1CZRA 2G8LA 3CZMA 4W8OA 5JANA 2GTHA 4XGNA 2SKCA 4Y2JA 2A33A 3N2GA 3R3UA 5ALLA 4F4UA 3KSAC 2G83A 4RIHA 4DG5A 1CRQA 2CLHB 3ZD9A 1W85A 2VNJA 1T4MA 2NUBA 3VSCA 4BDTA 4FYJA 2QIOA 4G5SA 2IUEA 2DQZA 3GPBA 3TCXB 2GEFA 2JGFA 2AR7A 3GC6A 3P27A 4D9FA 3VGJA 4Y0NA 5KZMB 3O73A 4LI0A 4JUAA 1K88A 1GTL1 1RWNA 3ERCA 1Y63A 3DDWA 1S7CA 4TMZA 4MWBA 3X3HA 3ITDA 3ZCVA 5IF3A 4NJEA 1RCUA 1GILA 4GC5A 4NMLA 4GPBA 2F8TA 4X1YA 1A77A 1Q44A 2ZT7A 5JD4A 4YYZA 1CUFA 1BAPA 1DBRA 1EVYA 1N2CB 1EFVA 3LV9A 2ZBDA 3IO3A 1YMQA 3IUEA 1JGTA 4PZDA 3QX3A 1BDIA 5KVCA 4EO4A 4MPRA 1KFKB 1TAGA 4EECA 2J3QA 2IYUA 1NC3A 3HVJA 4BRSA 3AY0A 2PMCA 3LKBA 5IG2A 5HJ7A 1HFEL 4M49A 4B3JA 1FZTA 2ACEA 2Z4TA 4EY8A 4YAKA 3IPXA 3IB3A 1SIUA 4H4CA 4JQYA 4ESVA 2V45A 1Y6ZA 1W46A 4ACBA 3CLKA 2FUNB 4Y6PA 2WAXA 3URKA 5IFLA 3P9ZA 3PJRA 1SXJA 4JXKA 4Y2GA 3KU4A 1GUDA 3IEPA 2ILVA 3IMKA 3NWBA 5CH3A 3MUOA 5DRTA 5FWAA 3RK0A 4BP1A 3RTAA 3E3LA 4H6PA 1IONA 3O84A 3P5BA 3QVGA 4IUYA 4RQTA 3TRIA 1DKPA 4AKIA 3GJRA 2VRNA 3FG9A 16PKA 1HKUA 1EU1A 2LGJA 2G4CA 3HGTA 4OXIA 3QM1A 1E3WB 3O1IC 3D5QA 3UPDA 1SPBS 1TAQA 4HRYA 1P8AA 3MT8A 4MGKR 3B36A 3UKDA 3BJMA 3WQRA 4C7KA 4YFYA 4I8IA 5J4LA 4PHCA 3I9V6 1PK9A 1I2BA 2ACVA 2PFIA 2D5LA 3R7NA 5BYKA 4HDRB 1ENOA 4DB2A 2ZAOA 3MM4A 5EERA 1O96B 3VR6H 4WVLA 4B7XA 1BDJA 1MVOA 1U8AA 3VC3A 1X9GA 5HZKA 3TLGA 1OFIA 1FDUA 4HQOA 2CXNA 3OQ6A 5JV5A 4N18A 1DE0A 2ZT8A 1YNSA 3UO8B 4D9HA 4LGMA 2A9OA 1RJ9B 3TZLA 1LLQA 4J0FA 4IOJA 2X6QA 3LA6A 2VYVA 3IQZA 4RADA 2WHXA 1NBMA 1M66A 4X97A 3S68A 2EW2A 2JA1A 4X8LA 2DBZA 5BUSA 1YS4A 1WU7A 1JBEA 4FT4A 2IYEA 3TUIC 2E5FA 1E62A 2ZTMA 1GNSA 1WTCA 1HA3A 3DULA 1JKIA 2GZ3A 2BM9A 3LPAA 3B7PA 3H99A 4R98A 4ETNA 4PYRA 3RUDA 1RJEA 1NHWA 4O5AA 4P3YA 1Y89A 2ZBGA 4MQEB 4R51A 5IHXA 5C9ZA 1SUWA 3Q3JB 3SYLA 1BU8A 1P1BA 3IKMB 1YS7A 2VDPB 4U2FA 3ZX5A 4PZPA 1KWKA 4DDVA 5AUPB 3HB0A 1FX1A 4HMQA 1NATA 4J6EA 4OX9Y 2BJHA 5CA0B 4BVEA 3GRKA 4TWAA 5GWXA 3HFSA 1GLVA 3FYDA 3GGSA 4LMAA 4K40A 4D7AA 2HA6A 3CXRA 3L6OO 3W1EA 5C52B 3WK5A 3PSAA 1CR0A 2FW0A 1TIPA 3NW9A 5D85A 5FLEX 5TMBA 4Q01A 2Q7OE 4QVIA 1LPBB 5BN1A 3ZU6A 1HGXA 1XG5A 5G0SA 3TD6A 3V32A 2VUSA 3RADC 1P5HA 5IJ0B 2AJDA 2Q2WA 2IYNA 1LVHA 5HMMA 3NALA 1Z83A 2OCYC 2QZJA 2AXEA 4G1UC 1RJWA 5JNUA 3VYVA 5BR1A 5IXJA 4JVLA 5MHTA 1Y9ZA 1XDBA 1WLSA 3UTDA 1R3UA 1HLDA 1G98A 1R8JA 5F5LA 1CF2O 4PSCA 1RLJA 2Z58A 3R3HA 5L3SB 4AKGA 4JLKA 1EA7A 2VSXA 3ABZA 3KKEA 4BNDB 3GLGA 1A5TA 5BSRA 1XZNA 1X1BA 4GX1A 2XNCA 3EZ7A 3UFBA 2YW9A 5DN6D 5HMLA 4UD2A 1QX4A 4FOPA 4UTPA 1NRXA 1S89A 3EK2A 4UULA 1GYQA 1NAIA 5TQ0A 3SS9X 1CDZA 1EWYA 3ZK9A 3RYFA 4JLOA 2Z9CA 3K73O 2VHJA 4F72A 1GEEA 3GROA 4DLNA 1DUVG 2Y1DA 5JO9A 1XTRA 3EXFA 4JYZA 5FBZA 3R09A 1G6Q1 4C4ZA 3AHGA 2R8OA 4AL4A 4J0HA 3EHDA 3OX2A 4BVBA 1EP2B 4NJMA 3PI6A 4O0MA 2C9MA 1AUPA 5AR1A 5ALNA 1SULA 1CERA 5I7FA 3RVLA 2G0AA 5GZ6A 3LSYA 4R1MA 1UEIA 1FNNA 2P9GA 3H5IA 4CWAA 1A8IA 3KZMA 3KVRA 1P6QA 2V9PA 5JPIA 4XR9A 2VRCD 4UZFA 1K2WA 3F73A 1ZGJA 5J1TB 3LHFA 2JGRA 3UAXA 4JBGA 1AMOA 2CFCA 2WJ4A 1EGMB 1Q0HA 2AJCA 1AUVA 2IXBA 3JCZA 3QKRB 4JVSB 1HE5A 4K87A 5AKIA 2P69A 5JWHA 4ALKA 3VBCA 4YGYA 2OKGA 5CYPA 2X23A 2IPAB 3D3JA 4RHTA 1T0IA 2CYBA 2EFGA 1D8TA 3HCAA 3AILA 2OBXA 2R1TA 3E9YA 3INGA 3D2AA 4L5JA 3I04A 1RXVA 1EX7A 1PG0A 3LT4A 1NJ2A 5JZMA 5M5BA 4FD2A 1A8PA 3BZUA 2C5FA 4G67A 1ORWA 3TKAA 3RVNA 1EVZA 1F8YA 4D45A 5FIUA 5AWFC 5KQLA 4BFVA 3G0HA 1QE5A 3DCYA 5AK0A 1TL7C 3LKDA 4F97A 1VXRA 1N9ZA 4QUBA 4CEHA 1RHUA 4EJFA 4Q19A 4M0CA 4UQLA 5EJ5A 3EBPA 1IEQA 4OXXA 3ZCTA 4L0DA 1PSZA 1D4ZA 2XMQA 1A8UA 2BFAA 1TC2A 1TO1E 2HMVA 2A7XA 1XD9A 3A32A 3DHNA 4NNJA 5GOZA 1P33A 3MUNA 1CLUA 2Q3MA 2QRJA 3L4BA 1PEAA 1NQWA 4XYBA 1PJZA 1S2NA 4ALIA 3OIYA 2AJBA 1FCJA 2OZPA 3KQWA 4UFPA 1ZU4A 1QG4A 1VL8A 5KWSA 5HOEA 4CMBA 3LQ1A 5CDSA 4YMGA 1YKGA 3HYNA 4DR1B 3DEJA 4RTPA 3AU8A 3QMWA 2AVNA 1LC0A 4HMPA 4RZ2A 3GJ6A 4Y2TA 1UAGA 4OI0A 4NP6A 4ZZ1A 4NCAA 1H1LB 3H4TA 4O8ZA 3EFHA 3I28A 1Q1EA 2ADMA 1BIFA 2KW5A 4M37A 3ZJTA 5HPYB 2EC5A 1J0XO 2NNWB 3HCDA 4RMHA 5ESXA 1BU5A 1CUUA 1E8NA 1GPAA 3CKKA 1XQVA 2LDBA 4Q7EA 4AAYA 1V5FA 4TROA 4MGHA 2GBIA 4JT9A 4RTOA 5JVDF 1R8XA 3SQXA 3HN6A 3OF2A 1Q7GA 3EVDA 4A8PA 4YRIA 5B57C 6ADHA 2IYFA 1OFVA 5KUTA 2YFKA 2JLSA 5DLEA 3HY3A 5SV2A 5GJWC 4LUCA 1V2HE 3WFZA 1GZ4A 1JPJA 3FNRA 5GY7A 2C77A 3EIQA 1BGWA 3K94A 3OHPA 4OKIA 4XLTA 1S01A 4AJNA 4UHKA 1HLGA 4DA8A 1N5DA 3LV8A 1DX6A 4PTZA 4TGLA 1Y5RA 1GVNB 2A9RA 2JNWA 1R9NA 1SY7A 3HDJA 3LFZA 1U1EA 1WMFA 4P92A 5JSKA 1DAHA 3F3KA 1TYEB 5I4CA 3DLAA 1B0PA 3ETDA 2HO4A 4YB8A 3L01A 3H6KA 4FBGA 4IX9A 5CP8A 3AJAA 4V2UA 3V1KA 2VDOB 3GLUA 6Q21A 5JJIA 1Y7TA 4RGVA 1ZONA 2C7BA 3NBXX 2PKEA 5CAEA 1R4AA 2BE7A 5IAKA 2XSZA 2FWJA 3BTOA 4X6XA 5ALWA 9LDBA 5LLTA 2XQIA 3PC6A 3SNKA 4WBNA 1IRIA 3H5RA 3OZUA 3L1HA 1HZZA 1G8MA 1GYRA 3DV0B 2M6RA 2XLBA 5I9MA 5AHRA 1KQGA 4TM8A 2CHVA 1FSFA 2O7VA 4X60A 3W2IA 5INTA 2HU8A 3FKQA 5KQMA 4KHPB 3A3NA 2OGWA 3BFVA 3FDZB 4IIDA 3R4VA 2LWIA 2AX4A 4DR3B 1YZUA 3MPUA 4FP9A 3K9GA 4TV8A 4ZA2A 4AWAA 4G8BA 4F2HA 3FZQA 4BFWA 4JC5A 1VSBA 3BPSA 4URUR 4B2PA 1NWCA 2DH6A 1JFFB 2YYYA 3WK6A 3K6JA 4BYGA 3L8MA 1KIFA 2FRXA 2V6BA 4GAEA 4GD3Q 5NLLA 3GLIB 5D01A 3QEBZ 2P8JA 1NQ5A 3NU1A 4WOCA 5HQJA 1BTOA 2GEJA 5KYYA 1P0IA 3WLNA 1SM4A 4BV3A 3O8NA 1NMXA 1XZJA 2FE1A 1E5LA 2SHKA 3KYBA 5JECA 2C78A 2FZCA 4QBGB 2CLSA 2TSYB 2V5AA 2GJAA 2C4MA 4IJVA 4TL6A 3ZV6A 1E58A 3DO8A 1LLDA 3A4VA 3CNLA 1QAOA 3HDYA 4ZEMA 5T3YA 4DPMA 3WP0A 4MVJM 5DNWA 4ZYZA 1T4CA 1TX4B 1IIRA 1OLSB 2ZBPA 4EHJA 2RIFA 3BZWA 3ODPA 4GNKA 4P7BA 3VKGA 3KQVA 3PQCA 1I3CA 1MABB 3LF1A 1LBQA 4TL7A 4FDMA 5CMLA 2I76A 2IXDA 3L0PA 3GCWA 3VGPA 3L04A 4G5RA 1YE5A 2TMDA 4K86A 1QCYA 4HPXB 5IP5A 4R8MA 1NVTA 2JLAA 4JJKA 3ZEIA 2ZE7A 1LV7A 5DM4A 4HY3A 3TOSA 4RPKA 4YJGB 3LO8A 3LHKA 5FKJA 3DNMA 4HDMB 2PNJA 4ARZB 5HYVA 1K08A 4IZOA 4HDKB 1NMZA 1VI2A 2Q46A 2F67A 4CNBA 4JI7B 2H54A 2IZ5A 5E9JA 1Z8DA 2OXFA 3ORFA 2LR0A 4QVGA 5E6SA 5AVSA 1ZRSA 2AE2A 3QRWA 1GUAA 3NT4A 4JP1A 4MS4A 4L95C 4Y0VA 1A72A 3HUFA 1AMNA 3C6MA 3M6AA 1TTTA 2NUPA 1SIBE 5FULA 2QKYA 5KSOA 4QXMA 1N5OX 3VRHA 4N5HX 4KUEA 1G7SA 4BQFA 2NO6A 4ZJZA 1VJRA 2DWQA 2GGSA 2I4TA 2AWNA 2VQ3A 4KFSA 5MN4A 2RH8A 1R4MB 5EWJA 1XLTA 4P3KA 1SZDA 1UK6A 1ZC4A 1AGPA 3EW9A 3GA7A 2X1HA 3HHEA 1TK2A 3TNFA 4EI9A 3RYCB 3DM9B 1J7JA 4P4SA 2ZR9A 3DXXA 4G86A 1WV1A 5BNFA 3RS2A 1RC0A 3O9VA 2ONKA 3FNHA 2BP7B 4B74A 4ZYXA 1CZNA 4L6CA 1BQ3A 4QDKA 5J5CA 4UNRA 3GJTA 3OEYA 3RQIA 3L84A 2ECPA 3IOCA 1G9SA 3UC9A 3GJXC 1A50B 3A05A 4RGYA 3V1TC 1AZSC 3STHA 4CKEA 5A05A 1RRFA 5EPEA 1SU6A 3FYSA 4I50A 2QLNA 1N8NA 1MO3A 4ILEA 2VXOA 3URMA 5JTTA 2I34A 4LG1A 2O2ZA 3AVXA 3Q87B 4NYIQ 5B3AA 3WYBA 4A10A 4AD8A 1JIQA 3SX2A 1YCGA 4RIGA 2PCJA 1AUXA 1OBCA 3M70A 3OMLA 4ENQA 2HZBA 2P1DA 4IY3A 2PMBA 3QE3A 5JCJD 5FD8A 2DT8A 1HI9A 2W2QA 3UA3A 1C50A 2WABA 4BKPA 4BWVA 4GI1A 4O6VA 4FINA 2VJBA 4YGXB 4CLOB 1L4GA 2B94A 3ZY5A 1Z2DA 2Q4OA 4PPYA 4TT3A 4FE4A 4LY9A 5HEKA 2DKFA 1P4AA 5DV9A 3E3NA 5BSKA 1E4EB 2VPXA 1S2GA 2YHAA 1YVPA 3DW1X 2QAJA 1B0ZA 1YIDA 1G18A 1P9LA 3DLTA 5HIAA 5JQWA 3TM5A 1O0CA 2XVMA 3P45A 3P9CA 3GI1A 1SCNE 3RT7A 2NTYC 2D2IA 4TLEA 1BX0A 4LYFA 2G80A 4Z7QB 3CTPA 2GK6A 2B2NA 5EJ6A 5LYJB 1RPTA 3NBAA 1XEWX 2C57A 4KITB 1E2FA 2AK3A 3OCXA 4JLWA 4ESYA 1YAJA 4FZVA 2CSXA 3RYTC 3ISJA 1XD2A 4HS9A 3QEAZ 2QUBA 3A1EA 4D44A 4OF4A 3JASB 4X0EA 1DZ3A 2WB4A 4COOA 2R5WA 5TIIA 2B1GA 3I2HA 2Q1SA 2X2OA 4FI3F 4OA5A 3OT5A 2QUKA 1X2BA 2GN6A 2MYPA 3FCUB 3KPUA 1VPLA 1AE1A 3H18A 1AZWA 1ZUD1 4H27A 4K1XA 4W7HA 1CRWG 1WVIA 1TW2A 3AHDA 1DV1A 3AZOA 1BO6A 4EM6A 3L7MA 4JI2B 2VJQA 3CNEA 1ACLA 4FFPA 1L1EA 5D84A 2JFQA 3LWBA 5SZIA 3GJ8A 3ES9A 3KXRA 4C4TA 4EPVA 2I7VA 3BICA 2PJDA 4HAVA 4DCJA 4F9EA 1KE1A 1EFHA 2DM6A 5L7TA 2GJ4A 3AJRA 2VQ6A 1XOIA 5TQJA 1S9DA 1YACA 1Z6XA 3BJIC 4REMA 4DJ5X 4FHDA 1E7YA 2X8JB 5CYGA 5CD9A 4CCAA 4BASA 3ITNA 3HVKA 3OWXA 3PFCA 2YBDA 3RC9A 1WUKS 4RPJA 5BWMA 1K6XA 4XJSA 4CIBA 5T4FA 2EEPA 4IWNA 3FNBA 1JILA 3OZEA 4EFKA 3T1VA 2F00A 5F76A 5KJEA 1JPNA 4DLLA 2OZVA 1RWWA 1KKMA 5GIOE 5IZ4A 1SUAA 1E3SA 4MDYA 4RNCA 4UMVA 4JIMA 5FRDA 1Y82A 3FGZA 2OCXA 3N6VA 2AFHA 1DAKA 2VFAA 3RG8A 3U39A 4RHUA 3VU8A 2A2ZA 1IEVA 3DMRA 1ZM4A 3UA4A 4I1YA 4YIHA 4H7EA 3L77A 2Y1LA 4F85A 4LAFA 3VPAA 1ISMA 4NYMQ 3WKAA 3B6IA 1YC5A 1MENA 4DLXA 1QPZA 3ZYCA 3VU9A 2UZ3A 4KQ6A 4ZYUA 1Y4ZA 1CNMA 5EXEA 2DB3A 3W5IA 5M04A 3Q40A 1Z5VA 1YJXA 2ZBFA 2QTVA 3K09C 1E0KA 4GBGA 3ZQJA 2XH8A 4MRAA 3W3AH 3QIVA 4OREX 4K0KB 3PNVA 1D6SA 3NHMA 1R37A 4ZN6A 3GZJA 3H5OA 5GAJA 1KTVA 2IP1A 1JG7A 3DE4X 2J45A 2GCGA 3BWMA 3DOCA 4DCSA 3FN4A 3HU5A 1K8RA 3IRUA 4ETMA 2FOLA 1QP8A 3O2JA 1HSZA 1Z7YA 1WU8A 1ZVKA 2VPWA 4WW0A 4E5KA 3DDSA 1HE2A 2WHEA 1EIWA 3UKOA 4ZJUA 4MRMA 5LBIA 5CBPA 2XXAA 2CLLB 2A1UB 4ZCPA 3A28A 1PNRA 3HO6A 4PLGA 1SKMA 1E9DA 2B1QA 2WU4A 2IS4A 4S2UA 4D9IA 2OXEA 3VU3A 1T43A 2V03A 2RJNA 4WN9B 3BGWA 4KVZA 2L69A 2EFDB 3PEFA 4TV9A 5A5VA 1H23A 4Q47A 1T5HX 4WXRA 1OF1A 5E3JA 2Z6VA 3R5FA 1Y5LA 1EFRD 4UHDA 4NARA 3UICA 1XRSB 2A14A 4UVHA 1FL9A 5TMDA 5T4EA 1DUIA 3N07A 3QV1A 4TS1A 5CPBA 2C7GA 2ZRNA 3M5PA 4XB1A 4B3MB 1U0NA 2FSIA 2J59A 2VHUA 2ZRCA 1PEYA 3LT5A 4GPAA 3H5LA 5ILGA 2PMFA 4NHOA 1GNLA 3TKLA 1RABA 4IINA 1U7UA 3ROFA 3GJQA 1H9CA 5G41A 1E5VA 1PGPA 3NHFA 4W5TA 5JXWA 2NADA 2F48A 2V7QA 3W5DA 3FTEA 2FGJA 4O3FA 1JZSA 1QB7A 1W9MA 4Q02A 5A0TA 3DZJA 4AXXA 3GGJA 4KE9A 3D43A 4MS1B 4H2DA 7ADHA 3I6IA 5IS2A 3LHSA 4ARVA 2ODTX 4IIJB 4ID3A 3LBYA 1PG5A 3KS9A 3TDHC 3PC8A 3TCNA 1C1XB 1PJ2A 4BNVA 5FV4A 2EBWA 3TOZA 1IFXA 3D3QA 3KQYA 4Q4HB 4Y1RB 4DRZA 1Z6QA 2JIPA 4TUYF 3UJDA 4ZHQB 5CEFA 2ZUBA 4RZXA 1CWUA 5EPOA 4GM1A 3UHAA 2IY7A 4LZPA 4B0PA 1TYAE 1UT8A 1IXRC 4AFNA 4O4HA 3P4YA 2XNJA 3HWSA 4S3MA 3DBLB 2YDYA 3O38A 3QYJA 1US8B 3PGXA 4BNIA 5K01A 3AY3A 3ZPXA 5FOUA 3DMDA 2HI0A 3LX6A 1U1CA 1AKUA 1H2EA 4XVRA 1XA4A 3HABA 3DOHA 1VBMA 2JATA 2WT8A 4J2OA 4ZOBA 2QTTA 2D1FA 4QHTA 3UW1A 1UMDB 3QLTA 1T9DA 3W3ZB 3I3OA 2UZIR 2NSLA 4AX8A 1KIAA 2HEIA 5DWDA 3DP9A 4QBFA 1M2JA 1Z4NA 1J0EA 3EWNA 4TOIA 5BN3A 1NLMA 2VHQA 2J0SA 3HYLA 1YQEA 1XZCA 5I7AA 4M54A 3ENVA 3TI7A 5GZ1A 4N48A 5EC8A 1MX9A 4FJ1A 2HXYA 1GAQA 3I12A 1DJMA 4BNGA 2D4HA 1L7OA 3IERA 4DYVA 4LHXA 2W4IA 2Y0CA 4RETA 4CQMB 2GAJA 2EF1A 2WWHA 4EP1A 1FTNA 4EUHA 3HU3A 1RM5A 4MJ3A 1TU4A 4MW0A 1YWGO 4UMEA 2Q4BA 2NXWA 4MYSA 4G63A 1M6VA 5CLJA 1Y7IA 1FLAA 2Y0EA 2W6IA 2X4DA 1SN7A 3DM5A 4A16A 2RC6A 3BCUA 3Q5GA 3QBVA 1A8HA 4Q3NA 2WNIA 2XDQB 3DZKA 4W5WA 3CUTA 4YCBA 2V3CC 3JALA 2CXPA 4HPJB 4R1OA 5JSZA 2VDVE 3W8NA 5EP1A 3X2SA 1JWBB 3LC0A 3PT9A 2H7VA 2HDNB 3B1FA 3HR4A 2AW3A 3DF9A 5AW0A 4M8KA 1E18A 2VO1A 1MC8A 1BWSA 3BSWA 4DBZA 5CEEA 5IVKA 2UUAB 2UZ1B 5HQ3B 1E3DA 1MOZA 3CCCA 1LLCA 3DOJA 4BZWA 2J46A 1GR0A 2PZLA 3DBHA 4BMNA 4O2BF 1TFRA 1Z16A 3EFBA 4F46A 1CFJA 3DKRA 4B6EA 1Q1QA 2JGMA 2DFKB 3GLHB 2ZWIA 1BN7A 4Y2VA 3C4JA 1E2KA 1R3DA 2C92A 4H0FA 3NBFA 4L9SA 2VDKB 1D09A 2VPTA 3KKNA 4EHIA 2FSHA 1WW3A 1DUSA 1NVKA 3HZZA 4KGXA 3R7FA 2LXNA 3C48A 1EFCA 1PX2A 1P2DA 4H3KB 4D4KA 1AQUA 2RI0A 1Y42X 5HVNA 1DJNA 1LI5A 2I62A 2IA5A 3CUUA 4LVUA 1XEXA 2PMDA 4CKWA 2BLLA 4L75A 1H9AA 2XE7A 2FN9A 4KQ2A 2Q0SA 4HAXA 1K4YA 1J97A 2Q3FA 1PFUA 1P18A 1TB4A 2JZCA 4HN4B 2Q62A 4RS4A 1TTHA 2IHTA 3UJ3X 1T8YA 1G7TA 1BDBA 1GARA 1QVVA 1O8CA 2IJGX 3LMKA 4K9LA 4RDCA 5EUCA 2OXRA 4PRZA 7ABPA 5KTYA 2QWXA 4EKYA 3VJRA 4GKKB 4EHDA 2PRSA 4ND3A 3SFZA 5CT5A 3OEHD 1MV8A 3QZUA 4PXYA 1B1CA 1USGA 2WILA 1NP3A 1OR8A 4RDIA 1NW8A 5KVQA 4ND5A 2BGMA 3BWVA 1A4UA 3GELA 1MB4A 1YQQA 3WL6A 1RPNA 2BRUC 1CR1A 3M3DA 2YKGA 2I2WA 4RD3A 4YT4A 2CCGA 5IAJA 1WDTA 1UEXC 5JJCA 3G7UA 2B69A 4GQWA 1S1MA 2V6GA 1M6HA 5I9BA 1QTNA 1C4KA 4O08A 3R9IA 3EGOA 5FBRB 3PQ3A 5KSYA 1YUNA 2Z57A 4QPZA 4W1QA 3U31A 5J2TA 3F67A 5D6OA 3IVAA 2Q3BA 4B4UA 4DV3B 2WWYA 3SIPA 4ZZ3A 3MNFA 1ZD1A 2IHYA 1E66A 2H85A 3PE6A 1V3UA 3M83A 5AQ1A 1BW9B 1HETA 3BREA 5FEUA 4UATA 3E8SA 4GGMX 1MQAA 2XWSA 4HKTA 1X7YB 3T94A 3UK2A 3I53A 1SVMA 2KB0A 3UUGA 4ZVVA 3ZE1B 5EFZA 4JN6B 4RVUA 1W6UA 4ZFNA 2JJQA 2C8JA 2A78A 4GGOA 3CFYA 1VRWA 4MA5A 1G5RA 4DF3A 4B8YA 5CDTA 4P0PB 3FY4A 2QAIA 3BD7A 1ZCFA 1O95A 3S2SA 3CURA 5ALOA 3ZU3A 4JLPA 4M1SA 5HKKD 3E81A 3KJNA 2I6FA 3N6XA 1CUZA 3A2NA 1F51E 4V03A 5DKFA 1RPAA 4MP6A 1OTXA 3JRXA 2B5OA 1X1RA 4DIMA 3G2OA 1MB9A 2M32A 2CJXA 2Q9CA 2FFRA 1QHHB 1WA5A 1EPUA 3UAOA 2BFBB 4D4LA 1FTWA 5L3ZA 2PR2A 3NOOA 4KGVA 5CR9A 3TSOA 2ZRMA 4B34A 4EUKA 1SUEA 4X3CA 2FA9A 2QE7D 4Z8XA 4B3BA 3W90A 3TNJA 4YUXA 2Y67A 2HNBA 4IJWA 4OJQA 4TKVB 4BZZA 3L7YA 2DFNA 2JVIA 3QPUA 4R2WA 3VSBA 1OWPA 5EHQA 1WXQA 3PQEA 3JRNA 1GIAA 3KBBA 2ID4A 3C6KA 2JLWA 4HLCA 4MUBA 4Q48A 4W9RA 5B64A 4LCBA 4CVNA 1E89A 4N6OA 3NHYA 3QKUA 1U94A 3G2IA 3I45A 1W47A 3IAM1 5GADl 2AIRA 2PSFA 1Z9BA 1C9MA 3T9FA 1PUIA 3TL3A 4II2A 2Z6UA 2WIJA 2JFOA 5FL3A 1ML4A 2GMWA 1QQ7A 3IX7A 4NR0A 1DNPA 4HQKA 1XQWA 3MJDA 1WCYA 3OX1A 4NC9A 3LQYA 4O2AA 5EXSA 3EGDB 4EQ6A 2PN1A 1R9JA 1C1HA 1XEFA 1E4OA 2XKAA 3U4MA 8ABPA 3VPHA 3BQ9A 5AXCA 4V24A 4PSVA 4N0DA 1T29A 3W1VA 4ZAVA 2X5OA 3IURA 2DHRA 4BVKA 3OURA 5G4KA 1K27A 3HTXA 1HTTA 2FPSA 3U13A 2KI5A 4RKFA 3NJ8A 1BS2A 1K8XB 1TO6A 1T91A 1NVAA 3EGCA 4R3NA 4ZRNA 4P3XA 2ZQYA 3W2EA 5G40A 4XWWA 2VHYA 4J3JA 3QOWA 4LWOA 5HE8A 2BMDA 3VHXB 4KR3A 1I6WA 2ZJ3A 5LXTF 1LSOA 1YDHA 4KH1A 1OI7A 3DDOA 1KIMA 2ATCA 1C9NA 5KAMA 1UPTA 3IV9A 2BFMA 5GM1A 3RIMA 3C1OA 1QIHA 3GRAA 3QU4A 2NPFA 2A92A 2JFYA 1T5SA 4NBLA 3MUFA 4B17A 3EBOA 4Q1DA 4Z0TA 5EZ6B 1GLNA 2G25A 1Z13A 2OHGA 5G0VA 2IQIA 5BQ5A 1TD1A 1MW9X 1TZBA 1W29A 2QMYA 1SXIA 3B13B 3K6RA 4GYYA 4X3PA 1NJGA 2IUUA 1SURA 3AG5A 3BIXA 3EMBA 4R16A 2E21A 1GFIA 1YZQA 1CS4C 4INZA 1PR6A 5C0OE 2FE4A 5K0LA 2ST1A 1S8OA 3I04M 2JFXA 1TEXA 1GRCA 1QC5B 4N1AA 5ENDA 3ZUPA 4LOKA 1OH6A 3ZVMA 1XR3A 1D2MA 3JWHA 2G4VA 4ZOLF 5SZJA 3LPCA 5HK9A 3A14A 3LY7A 4QU9A 1UZNA 2W8BB 1KP2A 1N9KA 2X3YA 3FSGD 4YROA 2RBEA 1RYBA 3L7IA 4JMPA 1G20A 1LDMA 1GAEO 2GRJA 2RK3A 1DSSG 3FB4A 1C41A 2H1SA 3F8TA 3HZOA 3JAWA 4L3VA 1BVUA 3A9WA 1UK8A 2Z1MA 4L07A 4PXSA 4EHAA 4X65B 5EXXA 1MT0A 3BULA 4ZYVA 2G3YA 2WA1A 1NX9A 3GT4A 2VOJA 2BBOA 1PT9A 1AKRA 2XUAA 2P5YA 4CF6A 2C2ZA 1BCRB 1H66A 1WQ4A 2I80A 4Q3DA 2I4MA 3WYNA 3ZDQA 4DZRA 4PV7A 2BBWA 2J67A 3KELA 3DHWC 3OSZA 2EBHX 4QELA 3OWOA 1Y6QA 4DLUA 1XKFA 2BWJA 3KZVA 1S4MA 5FUXA 3REFA 1PDVA 3LCMA 1M2FA 2CHUA 2Q07A 1KSHA 3A6GA 4XIYA 4UHHA 2HJRA 2HWXA 5ANRB 1PSWA 3H9GA 1Z56C 1DLJA 3II6X 5BQ3A 1N6HA 1GV0A 1U7OA 2PGJA 3ENQA 4YC7A 1C30A 3A7EA 4PX2A 3SSOA 5CDYA 4KG7A 5JG7A 3H5AA 5BWBA 4IQGA 4KQFA 4MCJA 3RUEA 1XE3A 4PO1A 4Z2AA 1JXMA 5JYCA 2IHZA 3EYAA 4EG5A 2VSFA 1NUTA 4R7TA 2VNAA 3HZHA 3OECA 1CJBA 2G40A 1KPIA 2I4RA 2PZBA 1M1NB 4XM1A 4YFVA 2F9FA 1NBWB 2IBSA 5G0WA 4LDPA 3VYTB 3W9SA 3PEWA 4C5CA 1SVKA 1ODJA 3NHZA 4MWCA 3E70C 4KPGA 1E3JA 4MVCA 3VR6A 1SQSA 4GHWA 3TIFA 4AJ1A 2H4FA 4K6KA 2XTNA 3L49A 3W06A 1QV6A 4KMSA 2I2BA 4U02A 2ZIUB 2HDWA 4GMDA 1JDVA 3CLUD 4KQ1A 1XN1A 4JROA 3B6EA 4PX9A 5DULA 2FX2A 3LO5A 4TLDA 5JJ5A 4WOKA 1J0CA 2HV9A 4MUHA 3B52X 4N12A 1QK4A 4BMZA 1J42A 4BLPA 2OCDA 4PPNA 4EPRA 3PCTA 1ZMBA 3BH0A 3HCPA 1I4LD 1SBQA 2I03A 4OLFA 4AN4A 2IIQA 4YEDA 2XBLA 4MCAA 1J8QA 3H3XA 2IHBA 2JIOA 1JA0A 2WRZA 1QRTA 4DGSA 4KOEC 5JS1A 1PP4A 1N3YA 1VL5A 2UYYA 3PQFA 4CPDA 4D5GA 1RHJA 1UT5A 1YKSA 3JR7A 5FTMA 5F4BA 4JP5A 4C1BA 1MIOB 3E2MA 3JYHA 2HWKA 4L2IA 1RD4A 1T2VA 4JR1A 3PDIB 3B3GA 1ESCA 1LDBA 2W0MA 3I0ZA 4R7ZA 4F60A 5BVHB 4DV7B 2IEGA 2DE0X 3ABOB 3NI2A 3TMYA 2W6OA 1SD2A 3AKCA 2GUGA 4NKRA 1CX9B 4GBMA 3FR7A 4GEKA 4R8SA 5DNYB 3SVLA 4IXDA 2UUCB 4MZXA 5EP4A 3P71T 1JUDA 2QRVB 3CM0A 4KK3A 5CXXA 4Q9DA 2D06A 1BMDA 2B4YA 5K23C 1KDVA 4M1TA 1VLQA 3GVCA 4B6PA 4EJ2A 3T9DA 2IYYA 2VDNB 4QPDA 1V8BA 2B34A 4OQNA 3WIEA 4D2IA 3RFFA 1MO5A 3C7TA 3ORQA 4B3RB 3MUEA 1ACMA 1ESMA 1W5EA 2OK7A 1B15A 3I4LA 2HAEA 3OLZA 4XQCA 5DXAA 1PYOA 2FZEA 5KYKA 1K66A 4MW4A 1MAHA 1MH9A 2VJMA 3HVUA 1VE7A 4FFSA 5JAOA 1KWGA 3PGA1 3LG2A 2FWMX 2QTLA 1R5OA 2J87A 3NAZA 3VYWA 5C80A 1AQNA 3U9TA 4G0UA 1KRWA 1QTRA 2JFNA 3IAXA 2IH5A 1IQ0A 2JKVA 3ZV7A 4ED9A 3H13A 2H18A 1MG0A 1T8SA 3K8QA 1IZ7A 1FYFA 1MOPA 1YR9A 4MWZA 1N0UA 3OD1A 3PQ8A 5LD2C 3DXZA 2W58A 1ITZA 3LSTA 3PHJA 4AJHA 4JXXA 2VK1A 4UOZA 2GZMA 3MPOA 4OCZA 2WUEA 1WCIB 4DXAA 3JTMA 4KLNA 2J9LA 1V35A 5IF9A 4W63A 3SX0A 1KEVA 1MOSA 3DWFA 3KHTA 2QZSA 4NBWA 3V34A 1THTA 4IDQA 1IN5A 1FFHA 5HTOA 2CVOA 4AT1A 2C8KA 2H4WA 2QG9A 1HYHA 2XGOA 3L07A 2DXIA 1J7KA 4D9JA 4RGBA 2HJHA 5A0VA 5IRCD 3RT1A 3G5UA 3NWPA 1GRRA 1Z74A 2VPPA 3S2IA 1IVNA 2O5EA 1T3TA 1KAMA 4Q9AA 3DOOA 4WPGA 3ZR4B 3VDXA 3PLRA 4RO0A 4UOQA 2Q8PA 4NG4A 5K0EA 1DMSA 1R27A 4R1NA 2ZRJA 4ZO8A 3WLMA 2P1ZA 5EJAA 4QG3A 1R8QA 2IZ1A 3GJ3A 3G8AA 1WG8A 1H0HA 4WCFC 4YJ3F 3INTA 2QRGA 5JEEA 4HDNB 2G5PA 2Z0MA 1ZLYA 5HF9A 2YQ4A 3V7FA 5ARBA 1A7AA 5CB6A 2ZM6B 1S8AA 2BC9A 3M33A 1R66A 4CUKA 3SQLA 1XCPA 3LC1O 4C4AA 1IQPA 2FR0A 3NRCA 1V1MB 3QWHA 3WK9A 2L18A 4AZ0A 1FMTA 2WSSA 4KQCA 4PM4A 5JZBA 1XKLA 2DERA 4UUOA 1Q2UA 2D00A 1UMKA 2PH3A 2I8CA 2V7BA 1QJCA 1W88B 4ITUA 4MI1A 3A27A 1WTAA 2VF8A 1R6UA 2A58A 2NO7A 2ODPA 2XMDA 3K2QA 4KPUA 5K51A 4L8LA 3TW6A 3BWEA 3ON5A 1P5JA 4G0PA 4FMDF 5D1HA 1PZGA 5DHAA 3ZBUA 3K1AA 4FC6A 4QUDA 1KZ4A 1FFBA 1W76A 3BJEA 3EXAA 5JVDB 3A6KA 3Q15C 4FBMA 4RE6A 2XIJA 4TVBA 1PL0A 3C3EA 4M53A 4JS0A 4U2KA 3DHYA 2ZYRA 1YJAA 1SIOA 3DGFC 4U7HA 3TZBA 2GEVA 1H8HD 3UMBA 2RC3A 5ALSA 5IT9A 2HW8A 3LPMA 4C0BA 5COQA 4QYIA 2FQ1A 3S1AB 1Y1RA 2OVBA 2O2XA 3ER6A 2HPHA 3B1ZA 4JD5A 5IVDA 2CJFA 4QM6A 4NONA 2R66A 3EOBI 3GMIA 1MDBA 3AFMA 3IV7A 4DNFA 3FR8A 4BGVA 5MGBA 5IT0A 3MS4A 3CLHA 5ALKA 1NX6A 1ZOIA 3KT6A 3IAS1 4J0QA 4MKFA 1M1XB 2ACKA 2O7SA 1BE6A 2VR1A 3WI7A 4D3DA 4WWHA 2OYCA 4FMCF 4GKVA 2A9FA 4EH1A 1P0MA 2Z3VA 3KEOA 4GQAA 4LRWA 3P0IA 4BPRA 1JF8A 2VJKA 3D8NA 1G7RA 1XTIA 3PRKE 5AW5A 4CCYA 5C46F 1W4CA 5KTPA 4P5DA 3CLSD 4DIOA 5IKEA 3U44B 3FYHA 1S2DA 1Y6RA 4F4JA 5UKDA 5K3AA 1FPQA 1CUBA 5DEOA 3A4MA 3QTLA 4A03A 1VP9A 1I6LA 2V7UA 4X3OA 3SIWA 3ESRA 4D0LB 5IX8A 5JXGA 3OESA 3W6UA 2Z8YA 1Z45A 2C9ZA 3ASUA 3QYPA 4UTNA 4J03A 1P29A 1OXMA 4E51A 2ORVA 1ZVJA 4RBNA 3R9WA 3VZCA 2OV8A 2Y93A 3G8BA 5LUAA 4XUDA 4RY8A 3ABIA 4CKXA 2B25A 4K6MA 2NM0A 1NVXQ 4WFJA 1EXNA 4RF4A 5TEWA 1XNRB 1PU2A 4IDCA 1ODCA 3R6WA 2BRUA 4ILKA 2BH2A 4HWPA 1TVEA 3WLLA 3BGSA 3QTBA 2D4ZA 5FI0B 1FP7A 4FXSA 2V58A 1NY6A 1YXMA 2H00A 4OB6A 3H2YA 3I23A 4U2DA 3TJZA 2V54A 2BSAA 2BFEA 3DQPA 3TTVA 4DGQA 4C4XA 4TN5A 2VATA 4UM7A 1EAMA 3VX4A 1FSSA 1O7JA 3QX9A 4IQ8A 1GVHA 3KXLA 1J23A 3QWBA 5DN6A 3HO8A 5IANA 4WIAA 3HJAA 4F1KA 3MYYA 4V0NA 2MU1A 3V4FA 3JQ6A 2QAGC 4H16A 4LXIA 5AVZA 3HGMA 4FHZA 3THYB 3A3KA 1FRFS 4XSVA 1LZKA 1NLUA 1PWYE 1PZXA 4G9GA 4MA0A 4EW1A 5I7SA 1UAAA 5BT9A 2QD1A 3L8YA 4OVKA 1S5PA 3JQPA 3KSMA 3R9KA 4WSOA 1N2OA 4QLBA 2Z5GA 3SQMA 5KNBD 3R5JA 3AVTA 3FOZA 3CC8A 1NWHA 2V7TA 3IE0A 3JVUA 4J1NA 4OQZA 1JHZA 2E4VA 2EJCA 4QBHA 4QJ5A 2AMFA 2FPUA 3TBKA 1FIUA 4GMHA 4A8HA 4BUZA 4WBSA 1E9FA 3E7DA 4JY7A 3H8WA 5FNVA 4C88A 1XNHA 3JQAB 5CB4F 2CNNA 3WB0A 3WGMA 2VRCA 1BKSB 1RI2A 5AVVA 1EWRA 1KMNA 4FR2A 4EY3A 1G1AA 2D0OB 3S81A 4AK9A 4CI9A 2VK2A 3DDZX 4G0VA 4HMOA 2F1IA 3WWYA 2B5WA 4CCWA 3OZTA 1ULHA 3G13A 3ET4A 5ITSA 4J8PA 3P97A 4TMVA 1UBRS 2G04A 3K0EA 1CZLA 1DAFA 4S1NA 2DC1A 4EGFA 5B6PA 2ADFA 2OB2A 4UFNA 1KFCB 1PJAA 1T3ZA 2F3PA 4RHCA 4RIEA 4U5QA 1LVGA 2VTVA 3Q85A 3QK7A 2WG0A 4D26A 1JDJA 4L08A 2BFWA 4PVCA 4WAUA 4IIVA 2PT9A 3ETNA 4RULA 1FP4B 5JAIA 3KYIB 3IUMA 3MCUA 3NDIA 5C4IA 2NO5A 1CY7A 2P62A 3BC1A 4FRYA 1GZ5A 1NLYA 1OV4A 2ZIXB 3CONA 4W9NC 4U7WA 4HDOB 3UW3A 3LJKA 1QDEA 2QGZA 3ZGXA 2OHXA 3OZXA 1BMQA 5EIBD 1VLVA 3CISA 2EFCB 4HUQA 4PNZA 4QGAA 4Y6GB 1A82A 5BV8A 1V3TA 5FPTA 4ZWNA 2DPHA 1F2TA 2PO7A 2JGIA 4DQLA 2XYPA 2BHRA 1KZ1A 3PU6A 2YYZA 3N2EA 3OUTA 4GLOA 1ZWLA 5CJJA 4GBJA 4MI6A 4CM5A 3P2IA 5LIRA 4YUVA 3FTNA 5BQXA 2PU7A 4BJ3A 4UCXA 1QLJA 3O92A 2A94A 3ZLBA 2WMDA 5EMNA 3BA1A 4BN4A 3CRNA 3B1VA 2PEZA 3OCJA 1TVKA 1U1IA 1DLIA 4KXWA 3W5BA 3FHCB 2P1RA 2C2WA 2AK2A 3DCJA 4DMMA 1OA0A 3MINA 2P35A 4M21A 1QH8B 2OLJA 4F3YA 3KALA 3LBNA 2WU1A 3VOTA 1DG3A 5FWXA 4KIFA 2HLNA 3TE5C 4D0RA 2BM0A 1SIWA 1JHMA 1NYTA 1J00A 1QR2A 1ZPDA 1BH2A 2Q5QA 1G63A 3C45A 1CE8A 3Q3CA 4MITA 3N0RA 4HXGA 3W4KA 4O4LA 2XVZA 1QQTA 1REQB 4IV8A 2ZJ4A 3ZHTA 4Z3KA 2YFQA 5KOJA 2YS6A 3GFPA 2JAQA 4YJHB 2R8YA 1Z38A 2QF7A 3C7AA 1XEAA 2CXSA 5IVHA 3B85A 3NHJA 1YI1A 2B36A 2YWGA 5A62A 3LDHA 1X0VA 1LI4A 4OHOA 2WT9A 2Y1KA 4KQMA 4OLBA 4ISCA 2FRVA 2PYIA 4NU0A 1LLUA 1X1TA 1KBQA 1M8PA 3T7IA 2GR9A 3NDPA 2J9RA 4F5ZA 2FDCA 2CDNA 3MEQA 1Y6FA 2ZIAA 3DF7A 1TECE 2RGBA 1ZXLA 2IU4A 3GRPA 3LCCA 5KDLA 3IAS6 3G9TA 4R69A 1O54A 4HBZA 2JHCA 2V7GA 3LW7A 2NQ2C 2C88A 2QJWA 3NGMA 1QRRA 4OQDA 3B82A 1VKZA 4FOSA 5U4XA 1RU3A 1JSXA 5FOXA 4BVHA 2HR1A 1G6OA 4OI1A 1A2OA 1NDQA 2ATIA 3CB4A 4MV3A 4OV6B 4EAAA 3UZUA 3Q12A 2GXQA 3AB7A 5FBHA 4AY4A 1Z39A 5TDHA 1EVEA 5EVJA 2F2TA 3C3YA 3AM1A 2LIVA 2Q6IA 2HDHA 4E14A 3FTQA 1HK7A 1KAEA 1ZIDA 3KB1A 2GTIA 3DFKA 3OG9A 4GR9A 4JGIA 4CQMD 1VE3A 1TYDE 3C3CA 3QE9Y 1P2UA 1XHEA 2PA3A 1QV9A 4EY6A 5BUQA 1UMBB 4RANA 3BMNB 3I6ZA 3EODA 5FTJA 4FSDA 1DT3A 2C5LA 3IQHX 1MC5A 2EMQA 1OYVA 4MMXB 1TM5E 3DT9A 3PX7A 3FJYA 4JVMA 1VCIA 3AWIA 3K70B 1D2EA 4NOCA 4GI5A 2PY6A 3H75A 4OHRA 4KNWA 1L5FA 4OXRA 3AVYA 4N39A 3DZGA 4QUKA 5TPZA 4CG2A 1YFZA 2ZUUA 1SCIA 2ZJAA 5CNMA 2BFFA 1ZBQA 2AXPA 4C0JA 5EJEA 1NVVQ 1TYZA 5EFOA 5DLDA 5AESA 3K6SA 2XT6A 1R16A 2F1RA 2IF2A 3ZVRA 2HPZA 1CG6A 2YJ5A 3FLEA 2WJPA 4IBOA 4JP3A 2ZSFA 5B58C 1SEVA 3WL5A 1LV8A 3FB1A 4LX0A 4TX1A 3DNFA 1WNTA 5AHXA 5HF5A 2HSWA 3PHLA 4BB9A 1LF5A 3LS2A 4GMFA 4PQYA 3OM8A 3VZSA 3WBFA 4KBYA 3S1SA 3WGIA 1KEEA 1F38A 3VVLA 1EVJA 2O8DA 1XRPA 4EI8A 2QLMA 2VVTA 3Q8XB 4G07A 5E2AA 5KX5A 5AJUA 2IIPA 4H0CA 3DW3X 3TOVA 2C2HA 3U2QA 3HCEA 5D3MB 3MZ0A 1M10A 3SX4A 4DS3A 4FCCA 5A4JA 3K05A 3OLQA 1JG6A 1EM8B 2J5XA 1FU4A 3ORSA 5BNZA 1RWQA 4JLNA 1GSAA 4LJLA 4OGKA 2YHIA 4PINA 1H3FA 3FPLA 4TYYA 1W96A 3NC1C 4RM3A 1YGYA 3SZOA 4P4TA 3G8YA 2YJGA 1TTQB 5AI9A 3DFMA 5K0TA 3NGXA 5ECGC 1EWVA 3ILSA 2ES4A 4GSYA 3CJTA 1Y8RA 3DSRA 3MT9A 1MPXA 5M2QA 4W5QA 3GZNB 3RIEA 1V4BA 3EARA 1NPDA 5HHTA 1U99A 4WTOA 1H4QA 2IELA 3QELB 2F17A 4REQB 4DLSA 1JAIA 2UXBB 1N7JA 1W19A 3HQ4O 3DVQX 4WOJA 4N9QA 1NZDA 2H1IA 1OD6A 4D9EA 4ZOQI 2A0UA 2DFPA 2D0PB 2XYVA 4FB5A 4XRGA 1AXGA 1M1YB 2RGDA 3GHYA 3B7GA 3FYTA 3TLBA 4W1SA 4PBRA 5ER6A 1Z34A 3JQ7A 5JXJA 2PZAA 3CNHA 3G6KA 1NVEA 3G0IA 4N5NA 5GP1A 4EQZA 4IDEA 2WDZA 1MA3A 2I7XA 1LY1A 2JLZA 4ASUD 5HKOA 4V0LA 3O2NA 3FNIA 1FS5A 2FZGA 1A9QA 4RQAA 3V8QA 3VHRA 2BFCB 2FWPA 3C15C 4DIUA 3B5IA 4NNPA 3OT1B 4D8VA 4DMGA 1X8LA 4TUYB 4F2WA 4RVGA 4DOMA 2GWRA 1XQ6A 3FNGA 1QYXA 2RGYA 4N0PA 1UQRA 2J9ZB 3TOCA 2GI4A 2FMFA 5JCJA 5KDOA 3MTGA 1IJKA 2G72A 3FGNA 1Y1TA 4D6XA 1M3SA 3BKXA 3AFNA 3RTBA 4DIKA 1P9RA 2MSKA 3IEUA 5F51A 3LYHA 2QTRA 5ALUA 4A27A 4UUUA 1ZHHA 4NENA 1KAHA 4MYHA 5E3HA 3ZK8A 2X0EA 4I5DA 5BVGB 2Z95A 5L6MB 4LF6B 3BGVA 5ED4A 3SXUB 2XWBF 4XCQA 3RIGA 1J2TA 2JBHA 3EZYA 3BIWA 5C8XA 1ZIOA 3VNSA 1DVRA 2KJQA 4RJLA 5FYQA 3ZH9B 4ERNA 2YV3A 1V25A 4M0MA 1TAHA 3VH4A 3ZI4A 1T6ZA 3OZVA 3WISA 1M54A 2OHVA 2QGFA 1AZTA 2AE1A 1IOLA 2EX0A 3JPWA 3PR1A 3SL7A 4QGBA 3RVPA 4C06A 4ENTA 4ZI7F 1ZGHA 2ZBRA 4S24A 2YZGA 5JD3A 1VJTA 4KRXA 1X7XB 4ND8B 2RK4A 4IIHA 4OK5A 2CDRA 4OM8A 2LCQA 1YAVA 4ER6A 3SKYA 1TUBB 5BXQC 5CVTA 2HRDA 4KACA 1CUEA 2O2SA 1IU9A 4PG7A 4CLRA 1E6CA 3NTQA 3SEFA 1EEHA 3UK6A 2CNBA 1ZR4A 2EV9A 3HA5A 3SMVA 2WJ3A 5E38A 2FXVA 2VPQA 2ZWAA 3VH2A 1LB1B 1K8QA 2D1TA 2DKOA 2VF2A 3B9BA 2MSLA 3GLVA 3MAGA 3M9WA 2BAGA 4HJRA 3K8ZA 3ZIDA 4UXJA 4ZRDA 3U26A 1SOAA 4B83A 3KU1A 4GRDA 3AIIA 3TQTA 4EAQA 1OLXA 4WCFA 3IHTA 3LUCA 4MQ6A 1ZJJA 1FDTA 1VCOA 2HMSA 2VSNA 4H77A 5K0FA 3VC7A 2OILA 1IG0A 2PWAA 5CLQA 1S96A 2AQ8A 1TA4A 2OYSA 1CQXA 3KPCA 1DRJA 3CH5A 3DEAA 1VL1A 3IP9A 1PR2A 2AC2A 4FTWA 3I01A 1J25A 2AUMA 3TLAA 2LZ0A 5MFZA 2KLBA 2IW1A 3D1LA 3NEYA 2YNMD 1FS4A 4PCAA 3VR3D 1YZ3A 4NJEB 5IM4A 2PMWB 2PKCA 5DGTA 3ZD7A 5GJCA 2CT8A 2YWHA 3Q98A 3BF8A 4F8YA 3A58B 4P0TA 5L8VA 4BPBA 5LMNB 5DPMA 4JNKA 5IT5A 5H3LA 5CH5A 2QTHA 1JTEA 4CTOA 3EAQA 1I13A 3AR8A 3Q4GA 1J20A 3P8ZA 4FGKA 1U0HC 4GSKA 2J7KA 3AY7A 4H3SA 4NNOA 3UMRA 1TD9A 3UEOA 3FYUC 4GR5A 2JW5A 1XQXA 1Z5UA 1G8AA 4K2HA 5JADA 2GK7A 4O29A 2CUNA 3DHVA 4QFBA 3A2MA 5HDQA 1M5TA 1IWPB 3KZCA 5GPBA 4JWTA 5ITWA 1C9KA 4P33A 1LBHA 4BLOA 1L5WA 2W6JD 1JSLA 3KR0A 4TL8A 4DBLE 3H0CA 5IDWA 2ODNA 4FEGA 2RCNA 2F4VB 3LECA 3H2IA 4YT2A 1S1CA 3G2HA 3G0BA 4EEXA 3N3AC 2OB1A 1K6MA 1P7CA 2ZYWX 4B71A 1DOZA 3DEHA 3QVGB 2WIKA 3CLUC 1XRQA 1YR7A 4NZYA 4B8ZA 1ECFA 2QLBA 4CMKA 1U1GA 3DWGA 3WV5A 2WDPA 2NZUG 4DHEA 3DTNA 3HVRA 3N2KA 2G5GX 5BV1A 3L4JA 3D0QA 3GT0A 1FSPA 1F5NA 4Z7OB 1G21E 3G9UA 2PE5A 3TH5A 3AEXA 3EBLA 3ETGA 2RAUA 1D4OA 1U5BA 2IGTA 4RKEA 1CDOA 1TA0A 1IY2A 4BO4A 2BFDB 4KMOA 1NSTA 4WD3A 3IMEA 1XROA 1TLFA 4B1FA 1MJGM 1RKBA 1XBTA 3K53A 2YMLA 2AEEA 3QVVA 2BFOA 4UPVA 5IVIA 3T1HB 4ZEVA 1FP6A 2Q0HA 2QRCE 3OJXA 1SCUB 2FOIA 3CTMA 4IHAA 1YL6A 4JU9A 1AV6A 5EIOA 1EFRA 2OZKA 4A4DA 3VAAA 2R44A 2EHJA 1R9GA 2YC2C 2I2FA 2P2NA 3EXG2 3KWMA 3PXAA 2XB4A 1F06A 4M22A 1VE1A 4YMHA 3HXMA 2BSXA 4LJAA 1Y8QA 1PVOA 4RESA 1XD8A 1RWBA 1NBIA 4MR9B 2XZTA 3PXUA 4FQ5A 4P53A 1RKUA 1N6LA 3OAAD 1FBNA 1X74A 3STTA 4U7PB 1O94D 2CD9A 3ZBTA 4KAFA 4AF8A 1QAQA 3G0GA 4ZV9A 4MDHA 3V4RA 4Q3EA 5M29A 1Q0PA 2ERCA 4JJ8A 1S8NA 2ZXEA 2RGNC 3ADCA 4LE0A 1RMTA 3IESA 2O20A 1VBFA 2YFYA 4OQEA 4GF5A 4AYTA 5JRZA 5JFGA 2CMGA 2ZB7A 1FQJA 3QVTA 1UDWA 4LRUA 3NP7A 3SAJA 2EFJA 2QAGA 2ZSAA 5B4TA 2CC2A 5CM2Z 1A9PA 3TCKA 1IAQA 3RC1A 1PGNA 3ETCA 5DGCA 4DJFC 3ICVA 4M8NE 2MWMA 4ZT6A 2NZYA 3OE1A 4JA2A 5CK5A 4GWKA 4HB0A 3LPDA 2HV8A 1FXWF 3BYZA 4TRRA 1J1ZA 1T0JB 4G0MA 4Z99A 1CJSA 3UVEA 3L4KA 1QVWA 1MN6A 2VNSA 1SG9A 4IS2A 4AP9A 5C7IO 4W5NA 1YJCA 1WUHS 5DHTA 3EH2A 3R40A 3BD6A 3U4IA 1RM3A 3GG9A 1L4FA 4MTCA 2WKWA 3DO5A 1NOJA 5HW0A 3QPDA 3GH1A 1JYSA 4I4TF 4Q3BA 3EQZA 4ZTBA 3U81A 3EVFA 4W5OA 4P86A 4U5XA 4BO2A 2C29D 3EGEA 3T5GA 1OC2A 5EZYF 3EOAI 3LCJA 4YYEA 3H6GA 3LQKA 3MB8A 3FF4A 3HKBB 2JA3A 3USZA 3G5TA 1G3IA 4EW3A 2WFAA 2PKXA 2AB0A 1NF2A 2DUMA 2OAGA 3L93A 4TYQA 4C4YA 3IQEA 3TSYA 5GGYA 2BI7A 2JLBA 4B4KA 1MNAA 3H4IA 4IIYA 2YJZA 3ZHSA 4KOAA 4QGFA 3T6KA 1RLTA 2EFHB 1Z4QA 2XUIA 1BVYF 3V4ZA 1IXKA 1J8FA 2ZYTX 4HI0E 3SJUA 3UGKA 3ZBQA 3OQOA 3HUEA 1AURA 3AO0B 4CLXA 1ZN7A 3HCFA 3HXKA 4XPZA 4A0SA 1RBZA 2HB6A 3G2KA 7REQA 1JHAA 3VKFA 3OIVA 4W9NA 2ZYUX 3VVBA 1OVGA 4AP6A 1HDOA 3X2FA 4GP9A 2F3QA 5KJFA 3RYFB 1MW8X 3W2TA 3PNBA 2WA2A 1N7GA 4EARA 4E5YA 1P2SA 1ZL0A 4WDRA 4DSTA 4TL9A 1XIVA 2ZBUA 1I4DD 3T9EA 2CE2X 1A2KC 3OBIA 4DN6A 2R0QC 1RPZA 1PDWA 2ZU6A 4RV5A 3C74A 5EIXA 4HBGA 3FNFA 1ZJYA 2IEBA 1K7EB 4ND7A 5CEJA 5K25C 2BMFA 4CR6A 1J2YA 4JZKA 3K0KA 4B81A 1WY7A 2FETA 4C43A 4O02B 4OHZA 5LXTB 4YBRA 1Q12A 3N6RA 4LGCA 4IWYA 1JXQA 5LZ5A 4DLAA 4IYRA 5A7GA 4N7JA 1VE9A 3DLHA 1L8XA 2K2WA 4WESA 3O4HA 3HEAA 2ZUDA 2H5IA 2V0CA 4HAYA 2YL2A 3H9CA 4INJA 4WXPA 4BLRA 5FQNA 2PBLA 4DQ0A 2YCBA 1G3UA 2Y8EA 3ZXSA 5DX0A 1T1IA 4HG0A 5IKXA 1KU6A 3AETB 4GZLA 5EZ5A 3WDKA 3DBVO 3E5MA 5ALGA 2XGGA 3BT7A 4I6EA 5I8ZA 3WICA 4QOEA 2FEOA 3C3WA 2F1JA 1H4TA 1L1RA 4EKGA 2YWXA 1E3EA 1BKDR 2ODEA 2AZTA 4J3NA 3C0KA 4OQFA 4DTIA 1OTYA 1ZN9A 2LE0A 4J49A 2DWPA 3AVUA 3G9QA 2VJDA 2XBMA 1I7DA 3NTOA 3G85A 4MS3B 4NOLA 3KHKA 3TXYA 5I01A 1W75A 4P3OA 1FJ2A 5JQGF 4FNOA 2YYSA 5H82A 5BN4B 4CUJA 1N2CA 3IVGA 1X42A 3OCOA 1ORRA 2QUHA 1A9XB 1MD9A 2QR3A 1L5SA 2ZSBA 1H3NA 1NL3A 2QLFA 1OIXA 1ZRMA 4Y18A 1T5LA 2VYQA 4IY1A 4GXRA 5ERYA 2PHZA 3RUFA 3FTPA 1G4UR 4BLSA 1VRVA 1QYVA 2IW3A 3KD2A 1ID1A 4HDCA 4K6GA 5F33A 2Z2YA 3OEHA 1LNQA 4HVTA 1AGRA 2OK8A 4RAOA 2AC7A 4DY4A 3KB6A 2FPGA 2PGIA 3T5DA 4D8WA 4ZANA 3JSXA 1DIOB 2UV5A 2IYPA 4J4TA 3NRJA 1XWFA 4DQUA 4ZDKA 2L2QA 1QO0D 1CY4A 1BC5A 4LIPD 1F8XA 1SK8A 3FDFA 5A3JA 5CFNA 4L7QA 3LGXA 1CP2A 1AGXA 1GHTA 4FGZA 1ZHOA 4KW7A 3TJMA 5CXSA 3AHEA 1H2WA 4LBZA 4YTEA 3ZXXA 4Y9SA 3TAHA 2AWOA 2OGUA 2XD9A 4NPHA 4RA9B 4WZAB 3E5NA 4YRCA 2GYWA 2O0HA 4D4MA 3KPBA 2NPOA 5MFPA 4PFKA 1CETA 1U5AA 2QTNA 1IM8A 4LJKA 5JZSA 4ZCRA 5B2EA 5CDGA 1ESDA 4HDRA 2C3YA 4QDXA 1NZJA 4IG9A 4D3XA 1O96A 4LDJA 1PR5A 5ITZB 4R1QA 1U2RA 1W0CA 4Q9KA 2R5NA 4E5PA 4QPCA 2CCJA 3QF4B 1HR0B 4OGFA 1T34A 3P9KA 4M1OA 5DYYA 3IP7A 3CZAA 1I2CA 5JPDA 2SBTA 2HHJA 2H3HA 3JU3A 5HKKA 1RJ9A 1A5SB 1ZFNA 2WBLC 4ZT7A 4H6VA 3SMQA 4O2LA 5CAEB 4FFNA 2Q4RA 1F0NA 3E7XA 2O8EB 2BBTA 2R6AA 2FMIA 5B36A 3V5NA 3I92A 3FPFA 3TPZA 4BBPA 1N32B 1VPDA 1LK5A 2P3SA 1E79D 3SI7A 3N8GA 3WJ1A 4XYLA 1KDPA 1Z6PA 2ZWPA 2AOVA 4IL5A 2C9CA 1W4ZA 1TUIA 5A5FA 3X44A 1SPXA 2YVQA 5A3QA 1XALA 2QE7A 1ORIA 1N0WA 2XECA 4LRTB 1QSGA 1RXIA 2PU5A 2RHWA 2XODA 4D6PA 4BFSA 5IABA 3OBBA 2O14A 2ZCVA 4HGPA 2HJSA 2Z8YM 4WT7A 1B43A 1SVOA 3EZNA 2W6CX 2GASA 2G4LA 3MCVA 4OP2A 4E12A 1JEQB 3ZWMA 2WJIA 1OXXK 1RACA 3EDRA 3PEVA 3VC2A 1YONA 4QUHA 3ZHOA 3BCRA 3IQWA 3OOSA 3VSAA 1KORA 2XUFA 2BVNA 1ETHA 2PGXA 2G70A 3LP8A 3PL5A 3WP1B 3ZNNA 3ND8A 3TX6A 2CVHA 2P9QA 5CA0A 3GRZA 4DLBA 1QFJA 4NLLA 3PXBA 1P80A 3OP1A 5EIBC 4URVR 5LOVF 3EVTA 1HBJA 2CVFA 3P4UA 3HJUA 2PKRA 3RVBA 2XUKA 1K68A 3W8EA 4D79A 3O03A 1NHGA 1WABA 2CVPA 3HACA 1H2AS 3VOSA 5IH7A 2NU7B 1IATA 5IJ0A 4ITRC 4JOSA 2RJOA 1T3SA 1HMPA 3IC5A 3IIEA 4EF6A 1AKYA 3IALA 5LZ8A 4RQUA 1XVLA 3D6TB 1C3EA 1I4TD 5FFMA 1N2ZA 3REQB 3PSHA 2BGWA 1NI4B 1Q95A 3CH4B 1CUDA 5JE8A 4ARAA 4CLEA 4S1TA 4ANFA 1IXZA 1VIDA 2FPPA 3GAZA 2B37A 4KQ9A 3O0TA 4YMUA 5L3SA 5CRIA 3KFLA 2YYAA 4GQVA 2RG1A 4FGSA 4JGBA 4K5QA 4GH5A 1ZL2A 4QGSA 3NAMA 3T5BA 1GITA 1NSFA 3X1ZA 4JBNA 1FDRA 5HBGA 1PS9A 3DXYA 2IH2A 4UCQA 1BMTA 4ZVPA 5EYPB 1VKHA 1Z7EA 2YS7A 2GSDA 4N4AA 4P34A 3TRHA 2M1XA 5D3KA 1ADGA 2FF7A 2UVQA 4I2NA 1ZISA 3F96A 1JDBB 3EDQA 2OV6A 2Z8XA 3L7KA 3RFTA 2EFEB 3VTZA 2XY4A 2VCHA 3H5VA 1Q7TA 4EG3A 1XAIA 2Y4NA 3IFSA 4L51A 4JYBA 5JZVA 1OFHA 1EG7A 2J0UB 1YVEI 2Z09A 3RFUA 3OA2A 4QFDA 2ZT6A 4F9FA 4C7OA 2WYVA 3HEMA 5BWOA 2DTXA 521PA 1SZCA 4IJ5A 4YP7A 3Q3IA 4DUPA 1U9JA 3G1TA 3WMFA 2HQBA 5D7BA 3R41A 2HMTA 4ZAYA 2AKAB 4HDQB 1LFDB 2XUGA 4AJKA 5AOCA 2F64A 2FQQA 4UHJA 2HFKA 1U2DA 4WQMA 2ZM5A 2OQIA 2B4AA 3PA8A 2QRQA 3ZQ4A 1BXRB 4L9RA 5T41A 5IKPA 4OB8A 4DUZB 3HGQA 4D96A 1VI5A 3QKRA 1DG1G 1DRUA 3FSGA 3R0XA 3NWEA 4YJ3B 2O2GA 4C7VA 3EZLA 1L7MA 1B8PA 5D5HA 1LDGA 3SBDA 1KJWA 3C3AA 1YRBA 1OQAA 2I1VB 1BX1A 1JMYA 3CBGA 5DK4A 1FUYB 4CKEB 4FKZA 4G8CA 1JT9A 1N57A 3KK0A 4PLCA 4ROSA 4UUMA 4OU5A 1WETA 4D8TA 3AT1A 1Y9DA 3ZLTA 3AF5A 3WXBA 3EA0A 1IMOA 3NTRA 4X66B 2HTFA 4MVWA 2JLQA 4ND1A 2WY2D 3OZIA 4PSUA 1TQ2A 2XF2A 4A6EA 1GTSA 4N41A 1Z4LA 1NMEA 3SLRA 4B48A 1KZHA 1HDRA 4O0LA 1E2HA 2ZVJA 4LJ8A 5T8KC 3G5LA 1RQ2A 2GYUA 4ZJYA 1TUEA 2P3LA 3ANLA 1QVZA 1SBHA 3OJ0A 4FMDB 1CFZA 4L85A 1AD2A 3UQYS 5BSVA 8OHMA 2RE8A 1A9RA 2EFYA 4H4EA 4LY0A 4XUEA 3BK2A 4YUYA 1YHZA 3SEAA 1Y7LA 2QS9A 1Q14A 3BH6A 4Y67A 1KMQA 3A6PC 2Y1EA 3A6LA 3W5VA 1ECGA 4TWJA 5BN5B 2J32A 2O16A 2ZAMA 5JY6A 5K8TA 4OP1A 2AQIA 1BRMA 3AW9A 3JZMA 1OWNA 4PHTA 3WL8A 2WOJA 4C6HA 1U8YA 4X1IA 5FWNA 1XKTA 2VN8A 3FYUA 3K1ZA 1YCFA 4UDYX 1PSDA 3O8RA 2QZ9A 4BAGA 1EK6A 1ZEJA 2EXXA 2QORA 3HYTA 3JQQA 3KLPX 2TMKA 3OPXA 2G28A 3PC7A 1VTKA 4MUXA 5E3IA 4EBFA 2YJ4A 4I1PA 3LQ2A 3LFTA 4FMCB 4AO7A 3FNEA 2VS1A 1DEOA 4NCNA 1XD2B 4HH0A 4HFRA 1Z7BA 1UBSB 2J41A 2RG7A 4JB3A 4V0MA 3ZVKA 4LHVA 2GYVA 3IQDB 5LA6F 1AO3A 1FUKA 2DQKA 3K9CA 5HS6A 2WT4A 3GEHA 4BV8A 1I6KA 3TECE 2BTQB 2HRCA 1RHQA 2QX6A 4O2RA 1RZ3A 4WZZA 1D6JA 1VSVA 1T3LA 4HWSA 3AR6A 1JKMA 1IB6A 1I94B 5JMWA 1Q3KA 3R8FA 1QHYA 3C7KA 3M1IA 4HAOA 2PUWA 3ZW8A 4XKJA 1QHGA 1Y9AA 2Z04A 1DRWA 1PFYA 2FZWA 4OXNA 3GGGA 1NFRA 5CCEA 1W5BA 3F6YA 4DWJA 1IZ9A 4KO1S 1QK3A 1RYZA 5CNIA 3BRWD 4YLGA 4NICA 3KAJA 2QRPA 4PNPA 2A0KA 5ALTA 4XDGA 2PFGA 4K6HA 5FOSA 3FVTA 3RE1A 5ICSA 2XCRB 1E69A 1WO8A 1MGPA 1AU9A 2BHTA 5ARCA 4MIKA 1U0OC 3AY6A 4PCLA 4KO2S 3ESQA 3O3OB 4CGYA 2HYDA 2WG1A 5EVCA 4EHFA 1N5JA 3H1BA 2GUWA 5JTUA 4L3WA 2CF5A 2UV4A 4N65A 4DMCA 3ZDFA 1IB0A 5FPHA 5KOHA 1RKVA 1MJFA 1OX6A 2QVBA 4OU4A 2FMHA 5HM6A 4CQNA 4F6RB 5EG5A 1WMAA<