4IY3A

Structural and ligand binding properties of the bateman domain of human magnesium transporters cnnm2 and cnnm4
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
147
structure length
145
Chain Sequence
LNMIQGALELRTKTVEDVMTQLQDCFMIRSDAILDFNTMSEIMESGYTRIPVFEDEQSNIVDILYVKDLAFVDPDDCTPLKTITRFYNHPVHFVFHDTKLDAMLEEFKKGKSHLAIVQKVNNEGDPFYEVLGLVTLEDVIEEIIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal transport
molecule keywords Metal transporter CNNM4
publication title Structural and ligand binding properties of the Bateman domain of human magnesium transporters CNNM2 and CNNM4
rcsb
source organism Homo sapiens
total genus 35
structure length 145
sequence length 147
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 4iy3A00
2ZY9A 2P9MA 3LQNA 4IY3A 4UUUA 3OCMA 3FNAA 2EF7A 1PVMA 2RC3A 5KS7A 2OOXE 3FWRA 2EMQA 3KPDA 4FRYA 3FV6A 4DQWA 4P1GA 3ORGA 3KXRA 1PBJA 4HG0A 3K2VA 2YZQA 4L28A 5K24C 1O50A 4IY2A 3I8NA 2OUXA 4L27A 2UV4A 4PCUA 2QR1E 3DDJA 4FXSA 2OOYE 4IY0A 3KPCA 2QH1A 3LFZA 2YVZA 3T4NC 4IY4A 3FWSA 3SL7A 4ESYB 3GBYA 2YVXA 3PC2A 2RIHA 5IIPA 2YZIA 4L0DA 2D4ZA 3LV9A 5K25C 2UV7A 3PC3A 2YVYA 3K6EA 1Y5HA 4GQYA 3KPBA 4COOA 4O9KA 2PFIA 2QRCE 2RIFA 3TDHC 5LXQA 4GQVA 3KH5A 3LHHA 4NOCA 3OCOA 5K23C 3OI8A 4ESYA 2O16A 2NYEA 1XKFA 1YAVA 4P1OA 5MMZA 3TE5C 3L2BA 4L3VA 5K22B 2QRDE 3FHMA 2UV6A 4GQWA 2QLVC 4IYSA 2NYCA 2UV5A 2QREE 3HF7A 3PC4A 3L31A
chains in the Genus database with same CATH superfamily
2ZY9A 2P9MA 3LQNA 4IY3A 4UUUA 3OCMA 3FNAA 2EF7A 1PVMA 2RC3A 5KS7A 2OOXE 3FWRA 2EMQA 3KPDA 4FRYA 3FV6A 4DQWA 4P1GA 3ORGA 3KXRA 1PBJA 4HG0A 3K2VA 2YZQA 4L28A 5K24C 1O50A 4IY2A 3I8NA 2OUXA 4L27A 2UV4A 4PCUA 2QR1E 3DDJA 4FXSA 2OOYE 2J9LA 4IY0A 3KPCA 2QH1A 3LFZA 2YVZA 3T4NC 4IY4A 3FWSA 3SL7A 4ESYB 3GBYA 2YVXA 3PC2A 2RIHA 5IIPA 2YZIA 4L0DA 2D4ZA 3LV9A 5K25C 2UV7A 3PC3A 2YVYA 3K6EA 1Y5HA 4GQYA 3KPBA 4COOA 4O9KA 2PFIA 2QRCE 2RIFA 3TDHC 5LXQA 4GQVA 3KH5A 3LHHA 4NOCA 3OCOA 5K23C 3OI8A 4ESYA 2O16A 2NYEA 1XKFA 1YAVA 4P1OA 5MMZA 3TE5C 3L2BA 4L3VA 5K22B 2QRDE 2JA3A 3FHMA 2UV6A 4GQWA 2QLVC 4IYSA 2NYCA 2UV5A 2QREE 3HF7A 3PC4A 3L31A
chains in the Genus database with same CATH topology
2ZY9A 2P9MA 3LQNA 4IY3A 4UUUA 3OCMA 3FNAA 2EF7A 1PVMA 2RC3A 5KS7A 2OOXE 3FWRA 2EMQA 3KPDA 4FRYA 3FV6A 4DQWA 4P1GA 3ORGA 3KXRA 1PBJA 4HG0A 3K2VA 2YZQA 4L28A 5K24C 1O50A 4IY2A 3I8NA 2OUXA 4L27A 2UV4A 4PCUA 2QR1E 3DDJA 4FXSA 2OOYE 2J9LA 4IY0A 3KPCA 2QH1A 3LFZA 2YVZA 3T4NC 4IY4A 3FWSA 3SL7A 4ESYB 3GBYA 2YVXA 3PC2A 2RIHA 5IIPA 2YZIA 4L0DA 2D4ZA 3LV9A 5K25C 2UV7A 3PC3A 2YVYA 3K6EA 1Y5HA 4GQYA 3KPBA 4COOA 4O9KA 2PFIA 2QRCE 2RIFA 3TDHC 5LXQA 4GQVA 3KH5A 3LHHA 4NOCA 3OCOA 5K23C 3OI8A 4ESYA 2O16A 2NYEA 1XKFA 1YAVA 4P1OA 5MMZA 3TE5C 3L2BA 4L3VA 5K22B 2QRDE 2JA3A 3FHMA 2UV6A 4GQWA 2QLVC 4IYSA 2NYCA 2UV5A 2QREE 3HF7A 3PC4A 3L31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZY9 A;  2P9M A;  3LQN A;  4IY3 A;  4UUU A;  3OCM A;  3FNA A;  2EF7 A;  1PVM A;  2RC3 A;  5KS7 A;  2OOX E;  3FWR A;  2EMQ A;  3KPD A;  4FRY A;  3FV6 A;  4DQW A;  4P1G A;  3ORG A;  3KXR A;  1PBJ A;  4HG0 A;  3K2V A;  2YZQ A;  4L28 A;  5K24 C;  1O50 A;  4IY2 A;  3I8N A;  2OUX A;  4L27 A;  2UV4 A;  4PCU A;  2QR1 E;  3DDJ A;  4FXS A;  2OOY E;  4IY0 A;  3KPC A;  2QH1 A;  3LFZ A;  2YVZ A;  3T4N C;  4IY4 A;  3FWS A;  3SL7 A;  4ESY B;  3GBY A;  2YVX A;  3PC2 A;  2RIH A;  5IIP A;  2YZI A;  4L0D A;  2D4Z A;  3LV9 A;  5K25 C;  2UV7 A;  3PC3 A;  2YVY A;  3K6E A;  1Y5H A;  4GQY A;  3KPB A;  4COO A;  4O9K A;  2PFI A;  2QRC E;  2RIF A;  3TDH C;  5LXQ A;  4GQV A;  3KH5 A;  3LHH A;  4NOC A;  3OCO A;  5K23 C;  3OI8 A;  4ESY A;  2O16 A;  2NYE A;  1XKF A;  1YAV A;  4P1O A;  5MMZ A;  3TE5 C;  3L2B A;  4L3V A;  5K22 B;  2QRD E;  3FHM A;  2UV6 A;  4GQW A;  2QLV C;  4IYS A;  2NYC A;  2UV5 A;  2QRE E;  3HF7 A;  3PC4 A;  3L31 A; 
#chains in the Genus database with same CATH topology
 2ZY9 A;  2P9M A;  3LQN A;  4IY3 A;  4UUU A;  3OCM A;  3FNA A;  2EF7 A;  1PVM A;  2RC3 A;  5KS7 A;  2OOX E;  3FWR A;  2EMQ A;  3KPD A;  4FRY A;  3FV6 A;  4DQW A;  4P1G A;  3ORG A;  3KXR A;  1PBJ A;  4HG0 A;  3K2V A;  2YZQ A;  4L28 A;  5K24 C;  1O50 A;  4IY2 A;  3I8N A;  2OUX A;  4L27 A;  2UV4 A;  4PCU A;  2QR1 E;  3DDJ A;  4FXS A;  2OOY E;  2J9L A;  4IY0 A;  3KPC A;  2QH1 A;  3LFZ A;  2YVZ A;  3T4N C;  4IY4 A;  3FWS A;  3SL7 A;  4ESY B;  3GBY A;  2YVX A;  3PC2 A;  2RIH A;  5IIP A;  2YZI A;  4L0D A;  2D4Z A;  3LV9 A;  5K25 C;  2UV7 A;  3PC3 A;  2YVY A;  3K6E A;  1Y5H A;  4GQY A;  3KPB A;  4COO A;  4O9K A;  2PFI A;  2QRC E;  2RIF A;  3TDH C;  5LXQ A;  4GQV A;  3KH5 A;  3LHH A;  4NOC A;  3OCO A;  5K23 C;  3OI8 A;  4ESY A;  2O16 A;  2NYE A;  1XKF A;  1YAV A;  4P1O A;  5MMZ A;  3TE5 C;  3L2B A;  4L3V A;  5K22 B;  2QRD E;  2JA3 A;  3FHM A;  2UV6 A;  4GQW A;  2QLV C;  4IYS A;  2NYC A;  2UV5 A;  2QRE E;  3HF7 A;  3PC4 A;  3L31 A; 
#chains in the Genus database with same CATH homology
 2ZY9 A;  2P9M A;  3LQN A;  4IY3 A;  4UUU A;  3OCM A;  3FNA A;  2EF7 A;  1PVM A;  2RC3 A;  5KS7 A;  2OOX E;  3FWR A;  2EMQ A;  3KPD A;  4FRY A;  3FV6 A;  4DQW A;  4P1G A;  3ORG A;  3KXR A;  1PBJ A;  4HG0 A;  3K2V A;  2YZQ A;  4L28 A;  5K24 C;  1O50 A;  4IY2 A;  3I8N A;  2OUX A;  4L27 A;  2UV4 A;  4PCU A;  2QR1 E;  3DDJ A;  4FXS A;  2OOY E;  2J9L A;  4IY0 A;  3KPC A;  2QH1 A;  3LFZ A;  2YVZ A;  3T4N C;  4IY4 A;  3FWS A;  3SL7 A;  4ESY B;  3GBY A;  2YVX A;  3PC2 A;  2RIH A;  5IIP A;  2YZI A;  4L0D A;  2D4Z A;  3LV9 A;  5K25 C;  2UV7 A;  3PC3 A;  2YVY A;  3K6E A;  1Y5H A;  4GQY A;  3KPB A;  4COO A;  4O9K A;  2PFI A;  2QRC E;  2RIF A;  3TDH C;  5LXQ A;  4GQV A;  3KH5 A;  3LHH A;  4NOC A;  3OCO A;  5K23 C;  3OI8 A;  4ESY A;  2O16 A;  2NYE A;  1XKF A;  1YAV A;  4P1O A;  5MMZ A;  3TE5 C;  3L2B A;  4L3V A;  5K22 B;  2QRD E;  2JA3 A;  3FHM A;  2UV6 A;  4GQW A;  2QLV C;  4IYS A;  2NYC A;  2UV5 A;  2QRE E;  3HF7 A;  3PC4 A;  3L31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...