3LV9A

Crystal structure of cbs domain of a putative transporter from clostridium difficile 630
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
130
structure length
130
Chain Sequence
FEFEEKKIREIMVPRTDMVCIYESDSEEKILAILKEEGVTRYPVCRKNKDDILGFVHIRDLYNQKINENKIELEEILRDIIYISENLTIDKALERIRKEKLQLAIVVDEYGGTSGVVTIEDILEEIVGEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Putative transporter
publication title Crystal structure of CBS domain of a putative transporter from Clostridium difficile 630
rcsb
source organism Clostridium difficile 630
total genus 40
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2010-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 3lv9A00
3OCMA 3SL7A 2YVXA 4IY2A 4L28A 1XKFA 2RIFA 2P9MA 3FNAA 2UV4A 4GQWA 3FWSA 4L3VA 3FHMA 3OI8A 4IYSA 5KS7A 5K25C 4COOA 2D4ZA 4FXSA 4DQWA 4P1GA 2NYEA 1YAVA 2ZY9A 3ORGA 5IIPA 3K6EA 3KXRA 3PC4A 3HF7A 3KPDA 3TE5C 5K23C 3LHHA 5LXQA 2QRDE 4L27A 4IY0A 3PC3A 2QRCE 4ESYA 5K24C 2QR1E 3L31A 4NOCA 1O50A 4GQYA 3LQNA 3GBYA 5MMZA 1PVMA 3PC2A 4PCUA 4IY4A 2RIHA 2YZIA 4O9KA 3L2BA 2YZQA 4L0DA 3FV6A 4HG0A 4FRYA 2UV5A 2YVYA 2PFIA 2YVZA 3KH5A 2QREE 2QLVC 3KPCA 2OOXE 2EF7A 2EMQA 2QH1A 3TDHC 3DDJA 2OOYE 2UV6A 3LV9A 2OUXA 2RC3A 4UUUA 3FWRA 4IY3A 4ESYB 3KPBA 3LFZA 4GQVA 4P1OA 3OCOA 1Y5HA 3K2VA 1PBJA 3I8NA 2UV7A 2NYCA 2O16A 5K22B 3T4NC
chains in the Genus database with same CATH superfamily
3OCMA 3SL7A 2YVXA 2J9LA 4IY2A 4L28A 1XKFA 2RIFA 2P9MA 3FNAA 2UV4A 4GQWA 3FWSA 4L3VA 3FHMA 3OI8A 4IYSA 5KS7A 5K25C 4COOA 2D4ZA 4FXSA 4DQWA 4P1GA 2NYEA 1YAVA 2ZY9A 3ORGA 5IIPA 3K6EA 3KXRA 3PC4A 3HF7A 3KPDA 3TE5C 5K23C 3LHHA 5LXQA 2QRDE 4L27A 4IY0A 3PC3A 2QRCE 4ESYA 5K24C 2QR1E 3L31A 4NOCA 1O50A 4GQYA 3LQNA 3GBYA 5MMZA 1PVMA 3PC2A 4PCUA 4IY4A 2RIHA 2YZIA 4O9KA 3L2BA 2YZQA 4L0DA 3FV6A 4HG0A 4FRYA 2UV5A 2YVYA 2PFIA 2YVZA 3KH5A 2QREE 2QLVC 3KPCA 2OOXE 2EF7A 2EMQA 2QH1A 3TDHC 3DDJA 2OOYE 2UV6A 3LV9A 2OUXA 2RC3A 4UUUA 3FWRA 4IY3A 4ESYB 3KPBA 3LFZA 4GQVA 4P1OA 3OCOA 1Y5HA 3K2VA 1PBJA 3I8NA 2UV7A 2NYCA 2O16A 5K22B 3T4NC 2JA3A
chains in the Genus database with same CATH topology
3OCMA 3SL7A 2YVXA 2J9LA 4IY2A 4L28A 1XKFA 2RIFA 2P9MA 3FNAA 2UV4A 4GQWA 3FWSA 4L3VA 3FHMA 3OI8A 4IYSA 5KS7A 5K25C 4COOA 2D4ZA 4FXSA 4DQWA 4P1GA 2NYEA 1YAVA 2ZY9A 3ORGA 5IIPA 3K6EA 3KXRA 3PC4A 3HF7A 3KPDA 3TE5C 5K23C 3LHHA 5LXQA 2QRDE 4L27A 4IY0A 3PC3A 2QRCE 4ESYA 5K24C 2QR1E 3L31A 4NOCA 1O50A 4GQYA 3LQNA 3GBYA 5MMZA 1PVMA 3PC2A 4PCUA 4IY4A 2RIHA 2YZIA 4O9KA 3L2BA 2YZQA 4L0DA 3FV6A 4HG0A 4FRYA 2UV5A 2YVYA 2PFIA 2YVZA 3KH5A 2QREE 2QLVC 3KPCA 2OOXE 2EF7A 2EMQA 2QH1A 3TDHC 3DDJA 2OOYE 2UV6A 3LV9A 2OUXA 2RC3A 4UUUA 3FWRA 4IY3A 4ESYB 3KPBA 3LFZA 4GQVA 4P1OA 3OCOA 1Y5HA 3K2VA 1PBJA 3I8NA 2UV7A 2NYCA 2O16A 5K22B 3T4NC 2JA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OCM A;  3SL7 A;  2YVX A;  4IY2 A;  4L28 A;  1XKF A;  2RIF A;  2P9M A;  3FNA A;  2UV4 A;  4GQW A;  3FWS A;  4L3V A;  3FHM A;  3OI8 A;  4IYS A;  5KS7 A;  5K25 C;  4COO A;  2D4Z A;  4FXS A;  4DQW A;  4P1G A;  2NYE A;  1YAV A;  2ZY9 A;  3ORG A;  5IIP A;  3K6E A;  3KXR A;  3PC4 A;  3HF7 A;  3KPD A;  3TE5 C;  5K23 C;  3LHH A;  5LXQ A;  2QRD E;  4L27 A;  4IY0 A;  3PC3 A;  2QRC E;  4ESY A;  5K24 C;  2QR1 E;  3L31 A;  4NOC A;  1O50 A;  4GQY A;  3LQN A;  3GBY A;  5MMZ A;  1PVM A;  3PC2 A;  4PCU A;  4IY4 A;  2RIH A;  2YZI A;  4O9K A;  3L2B A;  2YZQ A;  4L0D A;  3FV6 A;  4HG0 A;  4FRY A;  2UV5 A;  2YVY A;  2PFI A;  2YVZ A;  3KH5 A;  2QRE E;  2QLV C;  3KPC A;  2OOX E;  2EF7 A;  2EMQ A;  2QH1 A;  3TDH C;  3DDJ A;  2OOY E;  2UV6 A;  3LV9 A;  2OUX A;  2RC3 A;  4UUU A;  3FWR A;  4IY3 A;  4ESY B;  3KPB A;  3LFZ A;  4GQV A;  4P1O A;  3OCO A;  1Y5H A;  3K2V A;  1PBJ A;  3I8N A;  2UV7 A;  2NYC A;  2O16 A;  5K22 B;  3T4N C; 
#chains in the Genus database with same CATH topology
 3OCM A;  3SL7 A;  2YVX A;  2J9L A;  4IY2 A;  4L28 A;  1XKF A;  2RIF A;  2P9M A;  3FNA A;  2UV4 A;  4GQW A;  3FWS A;  4L3V A;  3FHM A;  3OI8 A;  4IYS A;  5KS7 A;  5K25 C;  4COO A;  2D4Z A;  4FXS A;  4DQW A;  4P1G A;  2NYE A;  1YAV A;  2ZY9 A;  3ORG A;  5IIP A;  3K6E A;  3KXR A;  3PC4 A;  3HF7 A;  3KPD A;  3TE5 C;  5K23 C;  3LHH A;  5LXQ A;  2QRD E;  4L27 A;  4IY0 A;  3PC3 A;  2QRC E;  4ESY A;  5K24 C;  2QR1 E;  3L31 A;  4NOC A;  1O50 A;  4GQY A;  3LQN A;  3GBY A;  5MMZ A;  1PVM A;  3PC2 A;  4PCU A;  4IY4 A;  2RIH A;  2YZI A;  4O9K A;  3L2B A;  2YZQ A;  4L0D A;  3FV6 A;  4HG0 A;  4FRY A;  2UV5 A;  2YVY A;  2PFI A;  2YVZ A;  3KH5 A;  2QRE E;  2QLV C;  3KPC A;  2OOX E;  2EF7 A;  2EMQ A;  2QH1 A;  3TDH C;  3DDJ A;  2OOY E;  2UV6 A;  3LV9 A;  2OUX A;  2RC3 A;  4UUU A;  3FWR A;  4IY3 A;  4ESY B;  3KPB A;  3LFZ A;  4GQV A;  4P1O A;  3OCO A;  1Y5H A;  3K2V A;  1PBJ A;  3I8N A;  2UV7 A;  2NYC A;  2O16 A;  5K22 B;  3T4N C;  2JA3 A; 
#chains in the Genus database with same CATH homology
 3OCM A;  3SL7 A;  2YVX A;  2J9L A;  4IY2 A;  4L28 A;  1XKF A;  2RIF A;  2P9M A;  3FNA A;  2UV4 A;  4GQW A;  3FWS A;  4L3V A;  3FHM A;  3OI8 A;  4IYS A;  5KS7 A;  5K25 C;  4COO A;  2D4Z A;  4FXS A;  4DQW A;  4P1G A;  2NYE A;  1YAV A;  2ZY9 A;  3ORG A;  5IIP A;  3K6E A;  3KXR A;  3PC4 A;  3HF7 A;  3KPD A;  3TE5 C;  5K23 C;  3LHH A;  5LXQ A;  2QRD E;  4L27 A;  4IY0 A;  3PC3 A;  2QRC E;  4ESY A;  5K24 C;  2QR1 E;  3L31 A;  4NOC A;  1O50 A;  4GQY A;  3LQN A;  3GBY A;  5MMZ A;  1PVM A;  3PC2 A;  4PCU A;  4IY4 A;  2RIH A;  2YZI A;  4O9K A;  3L2B A;  2YZQ A;  4L0D A;  3FV6 A;  4HG0 A;  4FRY A;  2UV5 A;  2YVY A;  2PFI A;  2YVZ A;  3KH5 A;  2QRE E;  2QLV C;  3KPC A;  2OOX E;  2EF7 A;  2EMQ A;  2QH1 A;  3TDH C;  3DDJ A;  2OOY E;  2UV6 A;  3LV9 A;  2OUX A;  2RC3 A;  4UUU A;  3FWR A;  4IY3 A;  4ESY B;  3KPB A;  3LFZ A;  4GQV A;  4P1O A;  3OCO A;  1Y5H A;  3K2V A;  1PBJ A;  3I8N A;  2UV7 A;  2NYC A;  2O16 A;  5K22 B;  3T4N C;  2JA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...