3OCMA

The crystal structure of a domain from a possible membrane protein of bordetella parapertussis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
149
structure length
149
Chain Sequence
AFGVEERNMVSGVLTLAERSIRSIMTPRTDVSWVNIDDDAATIRQQLTAAPHSFFPVCRGSLDEVVGIGRAKDLVADLITEGRVRRNRLRDPIIVHESIGILRLMDTLKRSRGQLVLVADEFGAIEGLVTPIDVFEAIAGEFPDEDELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of a domain from a possible membrane protein of Bordetella parapertussis
rcsb
molecule keywords Putative membrane protein
molecule tags Membrane protein
source organism Bordetella parapertussis
total genus 33
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 3ocmA00
3LFZA 2QH1A 5KS7A 2YVZA 2YVXA 3L2BA 2RIFA 2NYEA 2QRCE 3SL7A 3KPDA 3PC4A 4GQYA 5K22B 3ORGA 4HG0A 3KPCA 4IY4A 4GQWA 2D4ZA 4IY3A 1Y5HA 3OI8A 4NOCA 2PFIA 4P1OA 4L28A 3FWSA 2QR1E 2EMQA 4ESYA 3I8NA 2UV6A 3K2VA 3TE5C 1O50A 3PC3A 3OCOA 2RIHA 3K6EA 3KXRA 4ESYB 4IY2A 5MMZA 4FXSA 4IY0A 2NYCA 4UUUA 2P9MA 5K23C 3FNAA 1XKFA 5IIPA 2QREE 3T4NC 3HF7A 2QLVC 4P1GA 4IYSA 3LQNA 2UV5A 4O9KA 2OUXA 3TDHC 4PCUA 2YVYA 3KPBA 2OOXE 3LV9A 2O16A 3FWRA 3GBYA 4DQWA 1YAVA 4COOA 1PVMA 3FHMA 3L31A 4GQVA 2YZIA 5K24C 4L0DA 2QRDE 3PC2A 2EF7A 2OOYE 2RC3A 3DDJA 1PBJA 4FRYA 3FV6A 5K25C 4L27A 2ZY9A 3LHHA 4L3VA 5LXQA 2UV4A 2UV7A 3OCMA 2YZQA 3KH5A
chains in the Genus database with same CATH superfamily
3LFZA 2QH1A 5KS7A 2YVZA 2YVXA 3L2BA 2RIFA 2NYEA 2QRCE 3SL7A 3KPDA 3PC4A 4GQYA 5K22B 3ORGA 4HG0A 3KPCA 4IY4A 4GQWA 2D4ZA 4IY3A 1Y5HA 3OI8A 4NOCA 2PFIA 4P1OA 4L28A 3FWSA 2QR1E 2EMQA 4ESYA 3I8NA 2UV6A 3K2VA 3TE5C 1O50A 3PC3A 3OCOA 2RIHA 3K6EA 3KXRA 4ESYB 2J9LA 4IY2A 5MMZA 4FXSA 4IY0A 2NYCA 4UUUA 2P9MA 5K23C 3FNAA 1XKFA 5IIPA 2QREE 3T4NC 3HF7A 2QLVC 4P1GA 4IYSA 3LQNA 2UV5A 4O9KA 2OUXA 3TDHC 4PCUA 2YVYA 3KPBA 2OOXE 3LV9A 2O16A 3FWRA 3GBYA 4DQWA 1YAVA 4COOA 1PVMA 3FHMA 3L31A 4GQVA 2YZIA 5K24C 4L0DA 2QRDE 3PC2A 2EF7A 2OOYE 2RC3A 3DDJA 1PBJA 4FRYA 3FV6A 5K25C 4L27A 2ZY9A 2JA3A 3LHHA 4L3VA 5LXQA 2UV4A 2UV7A 3OCMA 2YZQA 3KH5A
chains in the Genus database with same CATH topology
3LFZA 2QH1A 5KS7A 2YVZA 2YVXA 3L2BA 2RIFA 2NYEA 2QRCE 3SL7A 3KPDA 3PC4A 4GQYA 5K22B 3ORGA 4HG0A 3KPCA 4IY4A 4GQWA 2D4ZA 4IY3A 1Y5HA 3OI8A 4NOCA 2PFIA 4P1OA 4L28A 3FWSA 2QR1E 2EMQA 4ESYA 3I8NA 2UV6A 3K2VA 3TE5C 1O50A 3PC3A 3OCOA 2RIHA 3K6EA 3KXRA 4ESYB 2J9LA 4IY2A 5MMZA 4FXSA 4IY0A 2NYCA 4UUUA 2P9MA 5K23C 3FNAA 1XKFA 5IIPA 2QREE 3T4NC 3HF7A 2QLVC 4P1GA 4IYSA 3LQNA 2UV5A 4O9KA 2OUXA 3TDHC 4PCUA 2YVYA 3KPBA 2OOXE 3LV9A 2O16A 3FWRA 3GBYA 4DQWA 1YAVA 4COOA 1PVMA 3FHMA 3L31A 4GQVA 2YZIA 5K24C 4L0DA 2QRDE 3PC2A 2EF7A 2OOYE 2RC3A 3DDJA 1PBJA 4FRYA 3FV6A 5K25C 4L27A 2ZY9A 2JA3A 3LHHA 4L3VA 5LXQA 2UV4A 2UV7A 3OCMA 2YZQA 3KH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LFZ A;  2QH1 A;  5KS7 A;  2YVZ A;  2YVX A;  3L2B A;  2RIF A;  2NYE A;  2QRC E;  3SL7 A;  3KPD A;  3PC4 A;  4GQY A;  5K22 B;  3ORG A;  4HG0 A;  3KPC A;  4IY4 A;  4GQW A;  2D4Z A;  4IY3 A;  1Y5H A;  3OI8 A;  4NOC A;  2PFI A;  4P1O A;  4L28 A;  3FWS A;  2QR1 E;  2EMQ A;  4ESY A;  3I8N A;  2UV6 A;  3K2V A;  3TE5 C;  1O50 A;  3PC3 A;  3OCO A;  2RIH A;  3K6E A;  3KXR A;  4ESY B;  4IY2 A;  5MMZ A;  4FXS A;  4IY0 A;  2NYC A;  4UUU A;  2P9M A;  5K23 C;  3FNA A;  1XKF A;  5IIP A;  2QRE E;  3T4N C;  3HF7 A;  2QLV C;  4P1G A;  4IYS A;  3LQN A;  2UV5 A;  4O9K A;  2OUX A;  3TDH C;  4PCU A;  2YVY A;  3KPB A;  2OOX E;  3LV9 A;  2O16 A;  3FWR A;  3GBY A;  4DQW A;  1YAV A;  4COO A;  1PVM A;  3FHM A;  3L31 A;  4GQV A;  2YZI A;  5K24 C;  4L0D A;  2QRD E;  3PC2 A;  2EF7 A;  2OOY E;  2RC3 A;  3DDJ A;  1PBJ A;  4FRY A;  3FV6 A;  5K25 C;  4L27 A;  2ZY9 A;  3LHH A;  4L3V A;  5LXQ A;  2UV4 A;  2UV7 A;  3OCM A;  2YZQ A;  3KH5 A; 
#chains in the Genus database with same CATH topology
 3LFZ A;  2QH1 A;  5KS7 A;  2YVZ A;  2YVX A;  3L2B A;  2RIF A;  2NYE A;  2QRC E;  3SL7 A;  3KPD A;  3PC4 A;  4GQY A;  5K22 B;  3ORG A;  4HG0 A;  3KPC A;  4IY4 A;  4GQW A;  2D4Z A;  4IY3 A;  1Y5H A;  3OI8 A;  4NOC A;  2PFI A;  4P1O A;  4L28 A;  3FWS A;  2QR1 E;  2EMQ A;  4ESY A;  3I8N A;  2UV6 A;  3K2V A;  3TE5 C;  1O50 A;  3PC3 A;  3OCO A;  2RIH A;  3K6E A;  3KXR A;  4ESY B;  2J9L A;  4IY2 A;  5MMZ A;  4FXS A;  4IY0 A;  2NYC A;  4UUU A;  2P9M A;  5K23 C;  3FNA A;  1XKF A;  5IIP A;  2QRE E;  3T4N C;  3HF7 A;  2QLV C;  4P1G A;  4IYS A;  3LQN A;  2UV5 A;  4O9K A;  2OUX A;  3TDH C;  4PCU A;  2YVY A;  3KPB A;  2OOX E;  3LV9 A;  2O16 A;  3FWR A;  3GBY A;  4DQW A;  1YAV A;  4COO A;  1PVM A;  3FHM A;  3L31 A;  4GQV A;  2YZI A;  5K24 C;  4L0D A;  2QRD E;  3PC2 A;  2EF7 A;  2OOY E;  2RC3 A;  3DDJ A;  1PBJ A;  4FRY A;  3FV6 A;  5K25 C;  4L27 A;  2ZY9 A;  2JA3 A;  3LHH A;  4L3V A;  5LXQ A;  2UV4 A;  2UV7 A;  3OCM A;  2YZQ A;  3KH5 A; 
#chains in the Genus database with same CATH homology
 3LFZ A;  2QH1 A;  5KS7 A;  2YVZ A;  2YVX A;  3L2B A;  2RIF A;  2NYE A;  2QRC E;  3SL7 A;  3KPD A;  3PC4 A;  4GQY A;  5K22 B;  3ORG A;  4HG0 A;  3KPC A;  4IY4 A;  4GQW A;  2D4Z A;  4IY3 A;  1Y5H A;  3OI8 A;  4NOC A;  2PFI A;  4P1O A;  4L28 A;  3FWS A;  2QR1 E;  2EMQ A;  4ESY A;  3I8N A;  2UV6 A;  3K2V A;  3TE5 C;  1O50 A;  3PC3 A;  3OCO A;  2RIH A;  3K6E A;  3KXR A;  4ESY B;  2J9L A;  4IY2 A;  5MMZ A;  4FXS A;  4IY0 A;  2NYC A;  4UUU A;  2P9M A;  5K23 C;  3FNA A;  1XKF A;  5IIP A;  2QRE E;  3T4N C;  3HF7 A;  2QLV C;  4P1G A;  4IYS A;  3LQN A;  2UV5 A;  4O9K A;  2OUX A;  3TDH C;  4PCU A;  2YVY A;  3KPB A;  2OOX E;  3LV9 A;  2O16 A;  3FWR A;  3GBY A;  4DQW A;  1YAV A;  4COO A;  1PVM A;  3FHM A;  3L31 A;  4GQV A;  2YZI A;  5K24 C;  4L0D A;  2QRD E;  3PC2 A;  2EF7 A;  2OOY E;  2RC3 A;  3DDJ A;  1PBJ A;  4FRY A;  3FV6 A;  5K25 C;  4L27 A;  2ZY9 A;  2JA3 A;  3LHH A;  4L3V A;  5LXQ A;  2UV4 A;  2UV7 A;  3OCM A;  2YZQ A;  3KH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...