4L3VA

Crystal structure of delta516-525 human cystathionine beta-synthase
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
510
structure length
498
Chain Sequence
PLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHERQMVFGVVTAIDLLNFVAAQERDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Cystathionine beta-synthase
publication title Structural basis of regulation and oligomerization of human cystathionine beta-synthase, the central enzyme of transsulfuration.
pubmed doi rcsb
source organism Homo sapiens
total genus 170
structure length 498
sequence length 510
chains with identical sequence B, C
ec nomenclature ec 4.2.1.22: Cystathionine beta-synthase.
pdb deposition date 2013-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 4l3vA03
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l3vA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l3vA02
5B36A 1X1QA 3T4NC 1WDWB 1TZKA 2J9YB 3FWRA 2YVXA 1O58A 4D9MA 3VBEA 2OUXA 1TZJA 4NEGA 4HG0A 4L28A 3V7NA 3HMKA 5BW6B 1K7EB 1TJPB 1K3UB 1TZ2A 4D96A 2QRDE 2BHSA 3LHHA 4F4FA 4D97A 2EF7A 1WTCA 1TYZA 5K24C 5I7HA 2OOYE 4DQWA 4IY0A 4XUGB 5I7WA 1K7XB 3BM5A 5K23C 4KKXB 1J0CA 5J5VA 1KFEB 5EY5B 2RIHA 5HBGA 3OI8A 5B1IA 3TE5C 3SS9X 3AEXA 3L2BA 2UV6A 4HPJB 1J0AA 3IAUA 2ZR8A 3PR2B 2ZY9A 2D1FA 4LMBA 4D8TA 4ZQCB 2RKBA 3AEYA 2CLKB 3SL7A 1TTPB 4P1GA 2QRCE 3IQHX 3GBYA 3IQGX 2UV4A 5IW8A 5K25C 4OREX 4D92A 5JISA 5K22B 5B53A 1CW2B 5I7AA 4D9NA 3CEPB 2RIFA 2D4ZA 1P5JA 4D9CA 5T6MA 3IQIX 1V7CA 5IXJA 2BHTA 2EGUA 5CGQB 3PC4A 1CX9B 4AECA 2ECOA 5DVZA 3DKIA 3FWSA 2CLEB 5B55A 5I7RA 1VE5A 5C3UA 2GN1A 1UBSB 3LV9A 3X44A 4I1YA 5DW3A 2CLHB 5DBEX 3PC3A 1BEUB 2TSYB 4HO1X 2QR1E 2QLVC 5MMZA 1J0EA 1KL7A 2DH5A 5KINB 3K6EA 1KFJB 4D9IA 3R0ZA 5DW0A 2V03A 4IY4A 2CLLB 3OCOA 4H27A 2J9ZB 4D9EA 2CLMB 1A50B 1K8ZB 3DWGA 3L31A 2DH6A 3LFZA 3T4PA 3HF7A 4JBNA 4IYSA 1YAVA 4COOA 3KPCA 1O50A 2EFYA 4ESYB 3VSCA 4O9KA 4UUUA 4ZU6X 3FNAA 3KPBA 5D87A 3VSAA 3OCMA 2UV5A 1Y5HA 1C29B 2WSYB 2RH9B 1UINA 2O2EA 3LQNA 1PVMA 1QOQB 4D9FA 4NU8X 3VC3A 3ZEIA 2RHGB 3L6RA 2O2JA 4GQWA 5E0KB 3PC2A 1PBJA 1J0BA 2PQMA 4GQYA 1V71A 4D8UA 2YZQA 1A5SB 4FXSA 2QREE 3FGPA 1M54A 2GN0A 5IWCA 1C9DB 4IL5A 2CLFB 1K7FB 5B1HA 2P9MA 1VE1A 4JBLA 4L27A 2JC3A 5J43A 4WX2B 2EMQA 4LMAA 3SS7X 3KPDA 5D85A 1KFKB 1V8ZA 3R0XA 3KXRA 1D6SA 4P1OA 3RR2A 3SPXA 2Q3DA 4FRYA 3L6CA 3DDJA 5I7OA 3FV6A 5B3AA 1A5AB 1WKVA 5LXQA 2CLOB 3DWIA 2ZPUA 1VB3A 1C8VB 1K8YB 1KFCB 3X43A 2YZIA 4PCUA 4ZU1X 5CVCA 3VSDA 4QYSA 4Y6GB 2GN2A 2ECQA 1TTQB 5KS7A 5D86A 5IIPA 5DBHX 2NYCA 2YVYA 1WBJB 3L6BA 1Y7LA 4D9KA 1UIMA 1E5XA 3ORGA 1QOPB 1TDJA 4LI3X 2C2BA 2PFIA 4ESYA 1JBQA 4D8WA 4IY2A 1FUYB 2J9XB 4GQVA 4OFXA 4HPXB 2O16A 2TRSB 3I8NA 5KZMB 1J0DA 4D99A 2NYEA 1PWHA 2ISQA 2QH1A 4D9GA 3TDHC 2Q3BA 4HN4B 1BKSB 2OOXE 1Z7WA 3FHMA 4L3VA 4D9BA 4AIRA 5D84A 3K2VA 1F2DA 2RC3A 4HT3B 1KFBB 2UV7A 1A5BB 3TBHA 5I6DA 1RQXA 4NOCA 5JJCA 1TZMA 2ZSJA 2Q3CA 1PWEA 2YVZA 3FCAA 4L0DA 1FCJA 4IY3A 1Z7YA 1XKFA 1OASA 2CLIB 3KH5A 1K8XB 2TYSB 2C2GA
chains in the Genus database with same CATH superfamily
3DB2A 3LVQE 1U1FA 2JJ2A 4KBFA 2HHHB 3UMGA 4B3HA 1N9GA 1GV1A 1FTWA 3BIFA 2PGXA 4CLRA 4TUYA 2CDNA 1XD9A 2ZRAA 1G3MA 3AIOA 5I8WA 4CM4B 3GLFE 3COPA 4QDJA 5DTJA 2P4EA 3QTTA 4WK4B 4IW3B 3DXFA 4BVAA 1ENYA 1M8PA 3B60A 4J1SA 1NP7A 2B4RO 3JQ6A 3RAPR 2P8JA 3RRJA 4NMLA 3Q72A 2AVDA 3TQQA 2ZJFA 2VF8A 3IXLA 3OMWA 2X6RA 4EA8A 1KBOA 2O23A 2W2KA 4TMZA 1RLMA 3V6LA 2O4CA 4QYXA 1EIWA 1VL5A 3ME5A 1RPTA 1GVHA 1YRQA 2JHFA 3R7WA 1RAFA 4WKPA 2PE5A 3KUKA 2NVOA 5JCZA 3EA5A 3N6RA 4AJEA 4B6SA 1SVMA 3FN4A 5ENVA 4AI6A 4FHFA 2H17A 5LOVA 3A2MA 2NSJA 2GEFA 3P5SA 2W4QA 1ZJYA 1FOEB 1POXA 5CH5A 3ZJYA 2QIPA 5K20A 2BI4A 1IHOA 3BGDA 3UB2A 1U8CB 1B6RA 1RQPA 1E94E 1RWXA 5EQDA 2IPMA 2IWHA 2WSLA 3SE7A 1T6ZA 4EMTA 4QBIA 1XMJA 2YBEA 4JSTA 2NZVG 1P1RA 2YS6A 4MPJA 1P8AA 4EY4A 1X42A 4AJHA 4OHWA 2D13A 3NFYA 2B9EA 2IYOA 1U9IA 1CKEA 1ICEA 2HSZA 3B1VA 3CKYA 3P9IA 3RBAA 1WPQA 1AV6A 4IS3A 2WUVA 5CLFA 5DJ5A 1WW2A 4RIGA 2ZTLA 2BFMA 3QVXA 2HU2A 4LOIA 4EFKA 2UYCA 1DHTA 3TNLA 1LF0A 2Y1XA 4EDHA 4JX8A 3DT6A 4D97A 2ZSAA 2A0YA 5CHYA 4R16A 4FZ5A 2GN6A 1DO8A 4Y9DA 2PUFA 4NATA 3V3KA 2OOYE 1E7MA 2Q9UA 4MV9A 5HIAA 4KZPA 4LZWA 5AI5A 4DR3B 1GDDA 1T3HA 2RI6A 1MUUA 2C4WA 1K2VN 1P62B 2HN9A 1EFVA 3KLPX 4A92A 2NZ2A 3EG9B 3FOCA 4HXGA 4BTEA 2CZGA 5AO9A 1MO6A 2I3ZA 3UJBA 2R1VB 4FB4A 5CXXA 1MLDA 1OV6A 4X8LA 1Z6GA 4LK3A 4QNMA 3T7SA 2W6PA 4PZLA 1TEVA 4BFYA 1C0IA 1RRVA 3P97A 4UMVA 3RNOA 4A5OA 4H17A 3EGIA 1T4BA 4TXHA 1W7AA 1PYGA 4OA5A 1ZOLA 4IIVA 4TSKA 2P6PA 4FFWA 1I0LA 5EP2A 5DNWA 2VJYA 2G9NA 1L8QA 2V6JA 2Z2YA 3VPHA 1ZSNA 1J8DA 4M4SA 4KXQA 1TAGA 5ARCA 3R0VA 1XN4A 1DEOA 2W6JD 5K3BA 1NI4B 1N6IA 2PUHA 2WG0A 1ORTA 3BDVA 2H1LA 4XQ9A 2Z9DA 3MN1A 4MUMA 2FSFA 1W8IA 4OH1A 1UMCA 3WGLA 3UJNA 3QI2A 4K1LA 4BNZA 3MQ2A 4EG4A 1TA4A 3HUEA 5D5QA 4I66A 3D81A 5TT1A 3QNUA 4Z9YA 1DQZA 1VJ1A 3L18A 4FE4A 3K9BA 5TQJA 1LUAA 1BW9A 4CF5A 2X42A 5KTKA 4FFOA 2D3WA 2NYAA 2XT0A 3KKQA 1O97D 3NIBA 3M1AA 3MAGA 4L7QA 2ERYA 4HFRA 4CI9A 4DCSA 4EUHA 1W5AA 1XZBA 4O25A 2I2XB 2QDXA 3FWHA 4F3RA 1QRSA 4PRYA 1M2KA 4MZXA 3FOFC 4P1GA 1G6Q1 4H1TA 4V0LA 3R74A 5JPDA 2H52A 1EM6A 3DMNA 4FX5A 4L8VA 3IQGX 4DBZA 1KXJA 1A3CA 1U9IC 1ZP6A 4P92A 4PGHA 2WD9A 4D4HA 1EKXA 2H4FA 2Q3EA 4QUAA 1QDUA 4OQPA 1RM0A 5C52B 2GXAA 1LQUA 2I4NA 4UUAA 5EPUA 3R8CA 4B3TB 1J0XO 4DEYA 2OVFA 5B53A 3VPCA 3RS3A 2YY7A 3LQ4A 4DBLC 4S0ZA 5F2NA 4EUNA 3BFKA 1L8LA 5BP7A 4KQJA 1Z0IA 3DVAB 2RJOA 2K5UA 2AR7A 4DXAA 5KU7A 4JLBA 3P9RA 2VDNB 5TPWB 4ZREA 2G17A 2BFFA 4IIDA 4HNQA 4NJEA 1OZFA 3ZW8A 4G5OA 2MU1A 3GWZA 2D5CA 1TM4E 1ENOA 2PRKA 4FONA 1UDWA 4X41A 1Y8CA 1N2JA 1QTIA 5BSEA 3M81A 3VHQA 1YRWA 4HN9A 5BR7A 3EIOA 1CQJA 1ZVMA 4M8LA 3VA7A 2YDYA 2QUBA 4OFBA 3R7BA 4ABYA 4Y2TA 3BK7A 2WQZA 4GI2A 2XUJA 1ENZA 1Z5ZA 3LX5A 3OY7A 4L4XA 1N2SA 3QE4A 3DKIA 4BLQA 4IIHA 4PGFA 4TKUA 4OHCA 4TMXA 1EFTA 4WPGA 4CIVA 4PQFA 5E6RA 5FPPA 2ISCA 1NVGA 4QQKA 4EH1A 5C3UA 3N6XA 3QVJA 1UBJS 1UBKS 2AT1A 1QF7A 1RZ3A 1ZESA 3C5CA 5IJ0B 4IKOA 4I1YA 2Z6QA 4C7OB 2A67A 2Y27A 4LK2A 4MVCA 5K0TA 4JI2B 5EJFA 1DKMA 2RK6A 1H4VB 1E32A 1SXJA 1USUA 1Z6ZA 2X14A 3RC2A 1F60A 3R0JA 4M9CA 3WL3A 1DDGA 2E7ZA 2XADA 1LSSA 2XGOA 2A1UA 1GUDA 2W6ID 4H0FA 2H59A 4AZSA 3MILA 1RPNA 4Y7DA 3LU1A 3OE5A 1RBMA 2XNDA 2ZBEA 4JROA 1VI5A 2DG2A 4MWOA 3WV4A 4XQEA 4ZEOA 3BAFA 2EFEB 2HSWA 3NXKA 4KPFC 4EOGA 1JSZA 5JBQA 2NXJA 2C54A 1W93A 2H1VA 4DT1A 4A5SA 1A71A 3LXUX 1V9LA 1GQOA 1VGQA 1O9HA 3MYRA 2GK3A 3CLTC 3QX9A 4OKSA 4OSPA 1L3IA 4ZP1A 4EECA 5CNMA 3ZCSA 4M0LA 4XDYA 2V03A 1OVMA 1JPVA 4WV3A 3GROA 3RG8A 2X2OA 3INGA 4MVJF 1E3EA 1PR2A 2VP6A 3RUIA 3I37X 1W4AA 3I4CA 4TT3A 4DM3A 2W11A 3ZBUA 5DGHA 3B5JA 1V41E 1QGZA 4HDNB 2BGRA 1W5FA 2UV8A 4B4KA 4LOLA 4BC0A 3G0GA 1A82A 2C88A 4Q21A 2KM1A 2PU7A 4PV7A 1YJXA 4RPLA 3TIGA 1BQ4A 1P3DA 1Y8QA 4BMNA 1SULA 3IC5A 4FFBA 1IZ9A 1E9EA 3N0VA 3AFMA 1PN3A 5JIBA 3EPRA 3C45A 3LCVB 5EUMA 4GMGA 1B3BA 4RF3A 4CDRA 5C81A 4YTEA 5EXXA 4KOAA 1E66A 1ZOSA 4ESHA 3GLHE 3LZDA 1V8PA 2BEWB 4CN8A 5BMOA 4CCYB 3UUWA 2A5LA 3HP4A 2A30A 1JKIA 2I87A 3I4FA 1OKKD 4J0GA 4ES6A 1TM3E 1TKRA 1IQ0A 4MQ4A 1XPJA 4OJKA 4HHEA 5CVUA 1EAYA 1ZGZA 2OILA 3QE3A 3IEKA 4XEUA 3RGGA 4UUUA 1ZC3A 3GZJA 4UTOA 1GNVA 3W4JA 1N5LA 2ZW9A 2D4AA 1LV8A 3JYNA 1SU6A 2FRXA 4FXOA 4H4CA 5C4GB 3WYNA 4XWKA 2J09A 3D3KA 2MWMA 2AQHA 2PX6A 3FGOA 4OXIA 4Y1RB 3DAYA 1SXJC 4NV0A 4OO3A 2LDBA 1V16B 4A3SA 2P3QA 2VSYA 1PO7A 4GWKA 5ALJA 3USZA 4NYMQ 1EFHA 2W6QA 1JMYA 3OY2A 3OPMA 3QBDA 3LLCA 5BSKA 1PLLA 5CW2A 3KZKA 4RJTA 3U7GA 1KRWA 2B4AA 1EBBA 2ZI9A 3U56A 1YMVA 4WN9A 5AHOA 3VUFA 3MWFA 1PVMA 3VYVA 4CG3A 5A6SA 2QPOA 4EJ2A 4DAOA 4Y67A 4U39A 1GM5A 4CV3A 1NMYA 4HZIA 1AURA 2AW5A 3MT9A 4ALKA 4CM8B 3KZMA 1RJ9B 1KI1A 3NTLA 1QG4A 4FYXA 4QBGB 4LF4B 4FJ0A 4FCVA 5LCXA 1LW7A 3QU5A 1LF5A 3OJOA 2WG1A 1RM4A 1V35A 1YZKA 4L8GA 1UXHA 4MIYA 5I3CA 2ZJ8A 4N6NA 1X14A 2X7XA 3B7PA 3INYA 4CJXA 2JAUA 2WT8A 1E7SA 4K6GA 3FH0A 3QM1A 3GEMA 3RYCA 3EVFA 5DEIA 5BV1A 3ZGZA 1D8AA 4M99A 4UM9B 4Q0MA 3W5IA 2BR3A 2XGSA 3KOXA 4OFWA 4ZWNA 2NU7B 3VYUB 5I4IA 4X85A 5LQUA 2QM8A 2FLKA 1EVYA 3HJNA 3HUUA 3GRAA 2HPAA 3THSA 3DMTA 2WVHA 3EVEA 2NV2B 3AU8A 2B2XA 3KJGA 4R2LA 4EKGA 1NW7A 4OBWA 4QGFA 4R83A 3TSAA 1D9ZA 4PM4A 3WAKA 5TIIA 5DBIA 4INAA 1E9CA 1E1DA 2OBNA 1QIGA 1I36A 1R9MA 3BK1A 3D4IA 3ONDA 3QKRA 4PZZA 4EGFA 4J43A 4BX8A 4F56A 1ILEA 4H7EA 4XX0B 1AKWA 1UK7A 4LMAA 1Y63A 1G8SA 2H1WA 3E22A 4O2AF 4X7BA 4J29A 3K4HA 1J8YF 2Y3IA 3CEAA 4HYEA 1IWOA 1GL6A 3OE4A 4YROA 5D85A 3WWEA 5FUVA 3WMRA 4W1RA 1GAWA 4EYOA 2AFVA 5EHIA 1PK7A 3UJ9A 5KTRA 1IOWA 5DHQA 2D1TA 3MGKA 2ICAA 3N8NA 3NM6B 1W4LA 3HPQA 4UCXA 4XH9B 5K8IA 2OHFA 2GPSA 1SQSA 3VM6A 2B0JA 1Y1LA 2VH2A 1EU1A 4ZI2A 16PKA 1GRRA 4XLLA 2WTNA 3KT3A 1KO1A 2NT3A 4G85A 1KO7A 4I55A 4AQ7A 1IJEA 1A9OA 3E18A 3QV2A 4JXJA 2RI1A 1QVWA 2C4NA 2ACVA 1B0PA 2ZPTX 2Y9PB 5TV2A 4B6GA 2APJA 3PNMA 1P44A 5JD5A 4AIIA 4NXNB 2GWHA 2QG6A 2W00A 4B43A 3KETA 2YINC 1PG0A 4TXLA 3WV5A 5I9LA 2ZCJA 4QPCA 3LDUA 3ZLVA 1MB0A 1Q1BA 1FLNA 1UT5A 2EBHX 3GB9A 4A2PA 3CR8A 5LMNB 2J59A 3S5UA 3CWQA 3F6RA 3IVCA 4KIUA 2C97A 3ASVA 5TSDA 4HCJA 1E0JA 1JKFA 3A1VA 3BE8A 1G20A 3UXYA 2J4CA 2PJRA 2F3PA 3OCWA 4LXXA 3BJEA 4QTZA 3PPIA 4K9MA 5DTEA 1W0CA 3ZQ6A 1Z2OX 5FTKA 2RGYA 1JJAA 5E3JA 4OYYA 3IE2A 3JD0A 4M36A 3ISJA 3URMA 2P67A 3IP7A 5B6PA 3PQ4A 3DMTC 2JFYA 1JU3A 4NAHA 1Y7LA 2E4UA 3JAKA 3W1VA 1M6WA 4G0XA 1XK6A 3L7OA 4J7XA 2PFIA 2K4MA 1PDVA 3OJCA 2JHPA 1CT9A 1HBJA 2IDJA 4XCQA 1IMOA 3Q12A 1PZNA 3BCRA 5CAEB 1FUYB 1KEEB 2PIAA 3CRW1 3NHKA 3O4JA 4MP6A 5KAPA 1N8SA 1L1FA 4G1FA 2OYRA 3P2EA 3U4CA 3ZHTA 3CVYA 4LPKA 2IHVA 3AF1A 5LDHA 1PS8A 3IQXA 5G41A 5I48A 2VDRB 1MJNA 2LIPA 1ULSA 3OQOA 1CY0A 1TLTA 2XX3A 3FLAA 4I50A 4NJOA 4FEYA 4XGQA 2P41A 3IJEB 1Y1RA 2ZU0C 3KOOA 4YCMA 5KTOA 2OT3B 4RORA 4WFIA 1NMXA 3KQQA 1SA0B 1Y9EA 4EKEA 5A5VA 3E9EA 1CY7A 4YP7A 5KSOA 1PQYA 3V97A 4PC1A 3H9EO 2ZE7A 4IRXA 2WLTA 1PL7A 1KAGA 2QL9A 4D26A 2LUOA 2IWRA 1D6JA 4D9GA 1V6SA 1JFRA 2H65A 2QXTA 3TDHC 2YV5A 4LY9A 5LZ9A 1QGAA 1HURA 4O0MA 4Q7MB 3AQIA 5CYFA 1GU1A 3K9CA 2ONJA 4FFNA 4TV9A 2OOSA 1YJCA 1EQ2A 3V8QA 5IVKA 4FHGA 1D2MA 1MKYA 1JR2A 1P80A 1DLJA 1ZKMA 4OPMA 3HC7A 2FK8A 1HDRA 3B6JA 4MUIA 5FOTA 3RRFA 3PR1A 1P5ZB 3S5JA 3TW4A 4IV0A 3Q8KA 2FP4A 1KGSA 3F8TA 3DVLA 4URYR 4DCPA 1YTLA 2XYPA 1DAKA 2ES4A 4MV7A 1G41A 2DBRA 4Z4GA 1CS0A 1HDEA 1Z36A 1U3WA 2ID8A 2NPOA 3AI3A 3PD7A 4RHUA 4CIDA 1AT1A 4F85A 3QWHA 3TTSA 2C83A 4YRLA 2JK0A 1H1LB 1Z5UA 1V48A 4QEZA 1A5BB 4K40A 4G8BA 4WERA 2Q3LA 4OX9B 2C99A 3FETA 1SKBA 5CX1B 4UTZA 5LQNA 3L01A 4GI5A 2BT4A 2HBQA 3R3XA 4BNXA 3IHLA 2Q3CA 3L8CA 1JG1A 1MX3A 2FH5B 4JB2A 4TZKA 1C4KA 1GCOA 1DAEA 2G28A 2OCAA 1PT7A 2QP9X 3ZKWA 1JWLA 3E7XA 1Y8RA 4QU8A 3WADA 3JYPA 1DFHA 3RWMB 1WD7A 2K2WA 4RTLA 1KBQA 3PSHA 4IJVA 3KQUA 3SX2A 4OQNA 3RTAA 1FDRA 2VBGA 2JGRA 3L7MA 1Y1SA 4I5FA 4LGVA 4N7JA 3NHFA 5DDIP 3HJAA 2G1UA 1FQJA 5KJEA 1ZD9A 4BFSA 3S29A 2ZS8A 1CEXA 4GPD1 2WM9B 2HBZA 3LWDA 1JHOA 3OOSA 2WRZA 4EVSA 2RI0A 2G9RA 1FTYA 1L4GA 4O1IA 5HIMA 3RS0A 1LNQA 1QYWA 3S99A 3EJWA 3H1BA 4M86A 4N01A 1CB0A 3K1AB 4C1BA 5ALVA 1MOPA 1WDWB 2E85A 3AIKA 3LQQA 1LBEA 5ALTA 4LJ5A 4DBLE 2N42A 1KJQA 3CW8X 2QVXX 2O8VA 5I51A 6NULA 5KYTA 3UYLA 3ENKA 2NTNA 4D1YA 1IZ8A 4ZOCA 2DHQA 5B5SA 4PLGA 1S0UA 2OB2A 2GCOA 2IA5A 3PP8A 1MNQA 1NY6A 3DZHA 3SSAA 5KPJA 1NI3A 5EMHA 2JHAA 4IJ6A 4LHYA 2XQGA 3CUYA 4X7PA 2C2ZA 4BUJA 1OFUA 2YWBA 1MQSA 1I6LA 3E5NA 4J75A 4RENA 1JQDA 1HE8B 2CK3A 1LLQA 1P2VA 2O1SA 3IBSA 4LZNA 4O2AB 1O77A 2HAEA 2BI8A 1FMLA 2CL5A 3EYAA 5FBLB 1SR8A 3M6XA 4DM4A 5LB2A 1QU2A 5KTPA 3WKDA 3BFPA 1EVIA 1JIXA 1D7AA 1CTQA 4TLCA 4BNDA 4ZEVA 4TWIA 1W85A 3UGJA 3E9QA 4EG6A 4BXOA 2ZS9A 4FW8A 3KT6A 3RFXA 1N5MA 2BFBB 4FJ2A 2QRNA 4OTZA 2IZZA 1KR2A 4KO1S 5CCEA 3K0FB 1WSDA 1KQOA 4GLFA 1J5EB 1QPZA 1QIHA 2PA0A 4UE3S 2ZIGA 3CA8A 1AXGA 3WNDA 3B5EA 4IJ5A 5ALYA 1N34B 1W4BA 1M0SA 2Q4RA 3LFUA 3VZDA 1G7RA 2YXLA 1E1CB 5FI3A 3SS8A 5AM1A 3ZLBA 4DIBA 4EGJA 3HB4X 5DM60 4CU2A 1BD3A 2Z4SA 2VDUE 4PSUA 4BIIA 3BGOS 1M0WA 1TYZA 1EVLA 1G8PA 2X0RA 3H65A 3L02A 4GSLA 4N6OA 2VYVD 4URWR 3T9DA 3KHKA 1MU0A 1GTG1 1PNTA 2XECA 3V8VA 3E7PA 3T7TA 3CN9A 4E31A 2DQZA 3DO6A 3A25A 5E4TA 4Q7EA 3RT9A 3W4IA 4E0BA 1YNOA 4JGGA 4L4YA 3PENA 4B3XA 4UARA 1EX1A 1QWSA 1W4CA 4ZZ3A 3HLYA 2H1FA 3AEKB 3R75A 3UNXA 3FDFA 4B7ZA 3CLUD 1K7YA 3KC2A 4R1LA 2J9LA 1XLVA 1QM5A 2IYEA 4JUCA 4JXXA 3A2LA 3QLUA 4IF6A 5DI9A 2WNSA 3O91A 2QTRA 1ZHOA 1NM5A 3ENVA 4FYYA 2H4XA 1K66A 4FFSA 4C7VA 3R2JA 4HDOB 2SBTA 2VHUA 1VBNA 2H00A 2B69A 3AHHA 3DP9A 3JQGB 3M82A 2YXBA 5DHSA 2BGMA 2QSYA 1UPXA 2J0UB 2YIVX 3OIVA 1SK9A 2QT1A 5GADl 3D54D 3THWA 1L4BA 1KMCA 3L7IA 4HXEB 1AOXA 1FC0A 2ZAIA 2BKXA 3TEFA 3V55A 4LCJA 1RRCA 4JXZA 2CF6A 1OREA 1HLFA 4P83A 4JI4B 3HN2A 5GOZA 2BN4A 4NFSA 3FYUC 1AJEA 2W2LD 1NNUA 4L4UA 3O8OA 3CZ5A 2WSSA 3CZMA 3FR7A 4GXTA 1QDEA 4TS4A 5J5CA 1K92A 2R4TA 3RFCA 3SLGA 3SYTA 4X7MA 4BDTA 1E6LA 3JY6A 3NDJA 1OLSB 2C4HA 4NR0A 3ZE6A 2J4FA 1X3LA 2ZAYA 1GYPA 3B3JA 3O8NA 5ANRB 2Z3VA 4IHQA 5BR4A 2L19A 1S5PA 1XZLA 3EFOA 1NXWA 2VSFA 3G7UA 4EABA 2G40A 3RTBA 4REOA 4MB0A 5AKGA 1T2VA 3HU3A 3WTCA 1PI3A 4OMCA 3NP7A 2JI4A 1ISSA 2XDQB 4QOIA 1U0GA 4Q5IA 4Z7NB 1TCBA 3A1DA 5AK6A 1T8WA 1AZTA 2EEPA 1PL8A 3OD5A 3Q3VA 4CWAA 1A96A 2QI9C 2OZLA 4Q01A 3UFBA 1CQXA 4L02A 2C2YA 1IN6A 3GN1A 3RU3A 4B3DA 2GO1A 2AOWA 4GHWA 1EA7A 1ZMTA 3GCDA 4UM5A 3W04A 5C1IA 1SXJE 4HWGA 4IEIA 2CNBA 2BMVA 1M5TA 3ZWOA 3QXHA 4FDLA 1U7WA 1LS6A 1UKVY 5LR6A 2VDWA 4OXNA 4G63A 1BEEA 3RVRA 1S4MA 3AVXA 1W59A 1PW7A 1U9CA 1XDSA 5T6MA 5KYUA 2CXQA 4NZOA 1FVHA 1YC5A 2QD2A 3BEDA 4PR0A 4ZKDA 1QQ5A 4J91A 1Q15A 4KQ9A 3K6JA 4M3NA 1Z2NX 4OBBA 1YZGA 3NI2A 4ZXPA 4BB0A 4Z51A 4ZZ0A 2VO1A 4N8DA 3CXRA 5KQGA 3ZLJA 1FRFS 4K2HA 1CSEE 4G9BA 3SVTA 4FGSA 1C1DB 1IN4A 1Q7BA 3E3LA 3Q3HA 4UNNA 4X6LA 5A9SB 2B61A 1NW8A 3N9IA 1A9ZA 2CFOA 2I8AA 3QLUC 4RKFA 1PE0A 4QZVA 1DUIA 3ASZA 1A2KC 1NM5C 6REQA 1NT4A 5EHNA 4CODB 5EAIA 5DVZA 5K99A 3ZKAA 1QMGA 4CMEC 5BOSB 3QFHA 5GZ6A 1XMIA 4P1ZA 4G56A 4RD0A 2Q41A 1A77A 121PA 1A9YA 1BSVA 3N05A 3NTXA 3PTZA 2QVZX 1NDHA 4DLUA 1S4QA 2DFNA 5DNAA 3OZDA 5F1PA 4M7RA 4KR9A 2KB0A 3KSBC 3B6ZA 3CWZA 1E1YA 1JQKA 1VBMA 4QQFA 3FMIA 1ZA1A 1QYCA 2D54A 3DV9A 1GR1A 3AQ4A 3PC7A 3QA3E 4LXIA 2OK7A 4MW0A 4UAJA 2CFTA 4EKIA 4OBEA 4U7FA 2MCFA 3I58A 1DS6A 1E2KA 2Q1WA 3RAGA 3PWKA 1JEEA 1YBMA 3S2UA 3DCJA 3I6MA 5CVTA 4BX9A 1AKTA 2YZ2A 1W9MA 2PKCA 5E1OA 2R4UA 1LW6E 2RB5A 1QIIA 1NNI1 2XCLA 5JNUA 1RABA 4X1OA 4JJFA 1NN5A 1N0VC 4NZNA 3OHMA 5TNXA 1GQFA 3UEOA 2MSNA 3R9XB 1E3JA 2Y1GA 3DJYA 5MMZA 1U80A 2JGEA 2QSZA 3B82A 3GJ3A 3RRYA 3H9CA 3TRHA 5HUQA 5TS2A 1KL7A 1TRKA 1YRYE 2PKEA 3OT5A 5E1BA 4CEIB 3N2LA 1KDTA 1T91A 4D3FA 4UASA 2JH3A 2PMWB 3IDOA 5EMJA 2TMKA 3EVBA 3OFNA 2GRUA 4P53A 1EAMA 1OC4A 3MXOA 4HJRA 1NTRA 1U8FO 3MLAA 4KU4A 4EJFA 5AVOA 4WBNA 4P4SB 5C32A 5HTOA 4Z3KA 3ELBA 2NQTA 3P32A 1H2RS 3FVQA 4HS4A 2C98A 2XPCA 3PPXA 2OAEA 2BL4A 3QE2A 4KREA 4AX4A 2CLDX 3T4XA 4MPRA 2O50A 3PCTA 4H27A 3GLGE 1IC6A 3VDQA 1Z2DA 4U9UA 4H6VA 3G0CA 1O6CA 3BCSA 5IT9A 3QMVA 5ITZA 1GGJA 3F4LA 1Q1NA 3FPFA 3Q88A 3ZWQA 5JCOC 3NNDA 2BBSA 4NEHB 3RRNA 4FM9A 3R9WA 1SKQA 1HLDA 2AFRA 3D7RA 4G89A 2ZWPA 3WLHA 5T57A 1TQ2A 3RVSA 2EKPA 2B1JA 4PAWA 2BONA 3SZLA 2BFAA 3ILHA 2O8DA 3HZZA 3EXIB 4OA8A 3W8NA 3STVA 3L93A 5DB4A 3DV0A 1LPAB 1R50A 2I4LA 3CCCA 5H70A 2P9CA 3QVVA 1JIJA 4P6VF 4DA9A 4MUKA 2CJWA 3OJXA 3SF0A 4BNIA 1JR6A 2IHBA 2EFYA 4JSYA 4NK5A 2FSIA 5EIOA 3VPXA 2V98A 4B80A 4J3JA 3QLTA 4RLQA 1G7CA 1TQ6A 3GUUA 1Z73A 4YJ3F 3OQNA 1CY8A 3MWJA 3GPBA 1TVKA 3UT0A 5JD4A 3OX3A 1BO6A 3MJSA 1XRQA 2WHQA 3CX8A 4V24A 4N18A 4NE7A 4MITA 1U65A 2ALJA 4ER5A 5MN5A 1U63A 2ZR0A 3MWDB 3PUKA 3N2IA 1ULBA 3MWKA 2FMTA 1XCOA 4LXQA 1J56A 1XX6A 4CMKA 3C1TA 5K1ZA 1ND5A 1QGUB 2PR7A 2X9VA 1JWAB 3REOA 4XQ0A 4BN4A 1SVSA 5AHWA 4BUZA 3I1YA 4D4GA 2NN3C 1OI2A 3BQ9A 5HA5A 4BGVA 3EMDA 4ZRMA 1Z07A 2BJVA 1Y3DE 4DANA 5DISB 5MFPA 3Q4GA 3MUOA 2PM8A 3MBKA 1CUGA 1YIDA 4XR4A 3L4BA 1D1PA 4CHGA 5COQA 4DE5A 1SG0A 5AXDA 3WLAA 3QX3A 1C3EA 1YQTA 3MT0A 1PF7E 1YB2A 1QH8B 1UPCA 1BDIA 4AO8A 5IS2A 3LD9A 5ILGA 4CTMA 2ZRCA 1XYYA 3LUKA 2FQXA 5CM9C 4YUVA 1PBJA 4B3GA 1DELA 3PEEA 1KY5A 1F1BA 1S7CA 3IULA 2EIXA 2ZRLA 1CEQA 3FHLA 3N74A 2GBPA 3MOIA 4KV7A 4N7RA 2JIZD 3OF3A 4HLCA 1NKVA 1PIWA 3S2IA 1FTNA 1SBCA 1KDRA 3EW7A 4L9AA 2G06A 1T3SA 3PNYA 5F1KA 5HK8A 3AU9A 3TTUA 2QREE 2WVGA 4URVR 4WKCA 2JFVA 3PBKA 4FJ1A 4JLUA 5MDHA 4AY3A 2P0AA 3HL0A 2V9ZA 4QWWA 1CZHA 2PIDA 1ECBA 4RFSB 2LTAA 1WAMA 4P7FA 4TN1A 2W0MA 3DBHB 3WYEA 1MX1A 3MC1A 3PFFA 3KOUA 3FLBA 2WI8A 4WCVA 1M72A 5LIRA 4L27A 1QGED 1SIBE 3BF7A 4LHVA 3RUCA 2IYYA 3P9CA 1JLRA 3LA6A 1PT9A 3OIWA 4IIJF 3ENWA 4K9SA 2DOKA 2H2IA 1Y7TA 1P3JA 2DU8A 2IYXA 2JGIA 1Z83A 3HDTA 1G20E 4PSKA 2GZMA 2VJBA 4XTCS 2QV0A 3M9WA 1LLDA 2CB0A 3CS3A 5FO0A 1BDBA 3ITEA 1CIVA 2G25A 3WMFA 4LUCA 4RMJA 3WB2A 1H93A 2G71A 2F43B 1ESDA 1A9QA 1P18A 1Z6AA 3KXRA 4IVNA 4QUKA 3VTAA 1DG1G 1NOIA 1JLKA 4IDPA 4QJ3A 2WJ3A 1VPDA 5EFZA 2VUIB 5KDDA 4UZEA 3L6CA 1TGVA 3EDOA 2A35A 2P4UA 1X7ZB 2HPHA 2PWAA 1UF9A 1U2GC 2C82A 1ZX1A 1BXGB 3HJRA 1SHLA 2I33A 1TE2A 2YRFA 3LWZA 3T1VA 2GGSA 1IPEA 2NU6B 3GD5A 4WLOA 4I1PA 4MW9A 4PGAA 4QNNA 1KDVA 3MYYA 1Z5OA 3JW8A 4Z1OA 2X8JA 5GZ1A 1BDJA 4NDAA 1LZLA 4P08A 2K87A 1FU7A 3A37A 4PC7A 5AM4A 1V2GA 4K9KA 3W5UA 4EW3A 3OLWA 1RPAA 1RC8A 2WTAA 3TN7A 3B20A 5BYAA 3JALB 1EUYA 3A6PC 2XMGA 3AESB 3ZDEA 4C0BA 2NO9A 3S8YA 3L4BC 2XE4A 2RD2A 2OO7A 3W77A 2BM8A 2X8AA 2Y0PA 2IZ6A 3F97A 4I46A 1RYEA 2N0SA 5C34B 3WBKA 3O2QB 4Y0NA 1XAGA 3N58A 1SBHA 4UQOA 3TOXA 2DY1A 1YJBA 2ECQA 3RBVA 2HQBA 5DM2A 5IAJA 2XUPA 1QIKA 4HFMA 1DT5A 4R8RA 4DPLA 3KSMA 4EFMA 3OTHA 3N8DA 4N48A 1EFPB 4IM7A 3O4FA 1TCUA 1F2UA 3PEFA 1PZFA 4N9WA 4ZI7A 5I45A 1CB7A 2D6FA 3KJHA 1HYQA 1IK4A 2FNAA 5E6UB 1GP2A 3GGJA 3EGVA 5EZYF 3AW9A 4MJ3A 4DMCA 3IP5A 1XDBA 1E5XA 1NV9A 5FF9A 5DI3B 1OF1A 4Q9AA 2HUNA 3IVAA 1DL5A 2V7GA 4Z6KA 5J2TA 2H92A 4LS3A 1I2DA 5JQGB 4KXYA 4PQYA 1Y4UA 5ALUA 3E1SA 2G9QA 3QU7A 4ZDIA 1JALA 1DO0A 4HPXB 5GZ3A 5K0BA 3OWOA 3IVGA 1A04A 1RYBA 1AKMA 1F3OA 1XEXA 3OICA 4LX0A 5JO0A 5L9AA 3EDQA 3VYRB 1UDBA 3Q3CA 4ZVLA 3PYMA 4ZALA 2A14A 1FMCA 1OBFO 3KKNA 4KMOA 3WRVA 2V5VA 4X1YA 3CNQS 4Y6RA 2QAJA 2W4IA 1B3RA 4TL7A 1GU7A 2PO5A 4PIMA 4Y2HA 5E2AA 2HZBA 1S8NA 3ZY4A 1ZU5A 4KHZA 2QJOA 3U4GA 2HBRA 4HTFB 2J3MA 1KEZA 2BV3A 5TQ2A 3AEUA 1SVIA 1KHTA 3EF3A 3KQVA 1E58A 1GSAA 4CU5A 1E18A 1MH1A 3H2IA 2OXTA 4BRZA 5JVDA 1J06A 5KYXA 2OV1A 2I6TA 3KOWA 1Z39A 1O0BA 1SB9A 4MUYA 2FCAA 1DCKA 1OE0A 1GRNA 2VYVA 2X5JO 1JEJA 3C7AA 4KQWA 3VKVA 3DL2A 5KB3A 3NVKI 4M8IA 3K2BA 2H63A 1IG0A 4HV4A 2HSJA 2RC3A 4U02A 1P2UA 4JH0A 5AJTA 4F9TA 2VHQA 3P5BA 4A8JB 2WSIA 3ICQB 3I5MA 1Z26A 1OYYA 3LOQA 1B16A 3BL6A 3N8GA 1N8TA 1PNQA 3PGA1 3IKJA 4KYVA 4MB2A 4YJ3B 3ZGXA 5EJ7A 3UQYS 3KTFA 1IK6A 3W05A 2DWPA 5A4MS 3UYKA 3K0KA 4JAVC 1N5IA 3F6SA 3QUAA 4DEXA 2IPNA 3SOPA 5AQEA 2E6KA 3CNBA 1XELA 2VP5A 5FUYA 3RH0A 4B0OA 5KSWB 4Q4JB 1JBKA 1FRZA 2XTZA 3JAWB 3LDGA 2VHYA 3MCWA 5C8YA 4EM6A 4YCNA 1MPTA 1U99A 2HTEA 3DQZA 3SHOA 2CXTA 1JJVA 4UDOA 2I7VA 5B2FA 1IJKA 3AZOA 3Q0IA 4OJMX 1VHTA 2I3AA 5KQSA 4BGDA 3HO6A 4G6ZA 3VQTA 2QZ9A 1HK7A 4XSGA 1RJEA 2W2LA 2E6UX 1ZY2A 3DL4A 4V2IA 1CQWA 2UYGA 2FR0A 3NONA 1Z45A 3GF4A 4B83A 1KY3A 5BR1A 1ZONA 3ZV6A 1MEJA 4EF6A 3GFSA 4YR9A 1DXOA 2JKZA 2ERCA 1RRFA 2BCJQ 1K89A 4X60A 1GZVA 4GDFA 3S27A 3AL3A 1CCWA 2A4KA 1YGYA 2VK8A 4IDAA 4K88A 3LUAA 4EX6A 2FPMA 2XOKD 5LBIA 1AKVA 5DTQA 3VR2D 5HK9A 1XYGA 3SI7A 4ZPJA 4HX9A 5ECYA 2P79A 2ZJ6A 3JYOA 4M54A 4MR9B 1YOVB 4QRDA 5HPYB 1S9DA 1UIRA 2I78A 2QRVB 5CLGA 2QRZA 4A6DA 2X8WA 2C20A 1K0FA 4KAFA 2GTIA 3AHDA 1T0HB 2CMHA 3AUAA 4JVSB 4ENRA 4I4CA 4RJLA 4D6XA 2ODNA 3H3JA 2DUUA 2HADA 3PK0A 4IIJB 2JBAB 3WRWA 1J33A 2PZEA 1GV0A 1ZU4A 3GPLA 3PEYA 2ODWA 3V4SA 1IEXA 2Q99A 3ESZA 5CT9A 4E5UA 2FRDA 1XU7A 4ZHSA 4GFDA 1OZHA 1UOOA 3TOZA 4UNIA 4LRQA 1RWMA 2JCYA 4P3OA 2IHUA 5E7JA 3T7JA 2ABWA 1MH9A 1XQ9A 3WBBA 4HQLA 1O96A 1WUKS 3P0RA 4ZVKA 1D6NA 2JGDA 2B9VA 3TGWA 1O9BA 5AKIA 2FMUA 4GG1A 1TJPB 3FVTA 4Q4DA 3L6OO 2R86A 1GPH1 5H7XA 2O5EA 4HX5A 4I4TF 4ZIRA 4ND8B 2C1EA 2XUOA 1HQDA 2WJIA 4GNRA 2XCQA 4G8DA 5C0OE 1KI2A 3N7AA 1S6YA 1P77A 1Z7EA 4M9SA 3GQBB 1ODIA 5M7EA 3L7BA 4ENTA 2HK6A 1CVLA 2HCBA 5LMUB 4HQOA 2IPOA 3O4IA 4YV2A 5AI0A 5F9FA 2O5RA 3RQIA 1BRMA 4PIPA 1O1YA 1K7XB 5LB4A 2EX1A 3TJZA 5FNVA 5KC9A 3JZDA 2ZR9A 4C05A 4IX1A 3GWGA 4QGGA 3ORSA 1OTHA 2AF4C 3O90A 3DHYA 1O0CA 2I29A 2PH7A 1XZ8A 3C3AA 1KO5A 3DJFA 5EJ8A 2V7QA 2IGBA 3Q2IA 2GBGA 3DNFA 4YWJA 3C3JA 1KQ3A 2RIHA 3GPCA 2AN9A 4YCDA 5A6VA 5JXWA 1H9CA 4HUJA 5DIZA 1BZYA 2FJUA 2OHGA 1NG9A 1ZD5A 2YWXA 4OYLA 3SS9X 1V6AA 1YCGA 1Z9BA 2DWUA 3CSDA 4I4NA 4J4HA 5DLDA 3RSQA 3LY8A 5EZYB 1YRAA 2IZ7A 4RCYA 3BWMA 4JJKA 4QOHA 4RZHA 3DLAA 4NAUA 5BY2A 1R5NA 1Y1PA 3D0RA 2D00A 2NACA 4I1VA 5FJIA 1Y9ZA 1J2TA 2AEEA 4QDTA 4YQEA 4YUZA 3FRIA 3I34X 3PR2B 3R24A 4MYCA 5ABPA 2Z6AA 4ZV7A 1A9RA 1WUHS 4UBJA 5D1NA 1NE7A 4TLDA 3T8YA 3DZCA 4ZVOA 5LZ2A 3I09A 4LNAA 2RHBA 4M9UA 5IK2A 2ZCUA 3KQMA 1JT2A 3BULA 1G2PA 2X58A 3D6VA 4IJUA 2QSJA 4JY7A 2FRDC 1UL1X 3T9EA 4BJ3A 4O4IA 3SVLA 4H7JA 2LVBA 2VT6A 3ZHOA 3PX7A 1V26A 1LDBA 2QTWB 2IUTA 3A31A 1D6MA 4Q3KA 5FOVA 3TM5A 1B14A 3W1EA 1NI5A 3OQ6A 1V3QE 1LRLA 4N5NA 5FEMA 3IUYA 4MQBA 2N46A 1T0JB 3H8JA 4ESOA 3E81A 2JZCA 3DXZA 1SPXA 4R98A 3JQAD 1Z5WA 5IW8A 3H4IA 3E3AA 2F1IA 3T1TA 1YZYA 2GR9A 2ZJ3A 2IXFA 3AXTA 3E82A 3JPYA 4JC8A 4RYDA 3T0GA 3HA7A 3SDZA 3CIFA 1E5TA 2PBFA 2VTDA 3U09A 2HA7A 2M98A 4QDXA 4BNMA 5JXGA 4WESB 3HH8A 4HNRA 5J4HA 2QR3A 4AJ4A 3ZHQA 2IXGA 3UBMA 4PAGA 2D4ZA 5FLKA 3OEHA 3TRDA 2VHEA 4U7GA 3YASA 5CA1A 3EHEA 4V0QA 5JNLA 3BHJA 5K6AC 5KVSA 2J7PD 3GRYA 1L4FA 4YR7A 1U6KA 1ZD3A 4TV8A 3H0EA 1XD2B 2YS7A 3I2HA 4GX0A 1KOJA 2JD0A 3L6EA 3RKSA 1QXSA 4L57A 3NV9A 1CUUA 1CHDA 1JP7A 4PLCA 3DUFB 4LZOA 3VZPA 3MG9A 4N03A 4B75A 5CB8A 1Q17A 1K68A 3BBPA 3D8SA 3UG6A 1RZUA 4WOPA 4XFJA 1XIVA 2GHIA 5IVDA 3ZQJA 2Z83A 2OHXA 3MFYA 1LLUA 1YZTA 1RAHA 3HNPA 1R0YA 2OYSA 3OM1A 1KBZA 3GLVA 3L82B 3RVBA 4XYGA 3JARA 3BEOA 2HSEA 3H3XA 4F6RA 4PNHA 2ZDQA 3U26A 3BTUA 4UHCA 4BVLA 2RJ3A 2XE8A 3BMQA 4DSAA 5EIEA 221PA 3AJRA 3ZWXA 5DFAA 2JIRA 1Z0FA 3RU9A 4MH0R 3A9RA 1APBA 2CYCA 4RIIA 1VI6A 1BX0A 1HFKA 4W7SA 3X44A 3V4PB 3WAJA 1IXYA 4MR8A 1R6TA 1X87A 1U8YA 2RC5A 2JEOA 3WFIA 4UBNA 1ATZA 2VT3A 3VKFA 4HMPA 4C2AA 1G17A 3A4MA 2A9OA 3QVGA 1SCUA 1EGHA 3KJIA 3KV1A 2GLXA 3G1WA 4RA9A 4KXUA 4ZQBA 1BE6A 1HQYE 2A0WA 3QLEA 2VQFB 1T1EA 2C5GA 2DBQA 2KE5A 3QTLA 3MLEA 2B82A 4DOMA 4BWVA 4HWPA 3CJTA 4KQFA 1RCUA 2X0JA 1IZYA 2O0LA 4KTTE 3B13B 3R7SA 4B6OA 5LJIA 5L4NA 1NQWA 1SB8A 2DH5A 3RI3A 2QXYA 3RTDA 2IP4A 3ZHUA 3K73O 1YNSA 5ITSA 5CB4A 1L6RA 2HF2A 5HYVA 4XSVA 4B81A 1GGKA 2B8EA 2D2XA 4JJGA 4A16A 4KUEA 5IU6A 3BSFA 4IVQA 3TTTA 5CDGA 2A0UA 3S8EA 2P5TB 4IWYA 1KQNA 2NLOA 1H6CA 4C6RA 4RSMA 3G2JA 2ZQYA 4HKTA 2QT0A 4ZKEA 4EA6A 5LD2C 3SX0A 1ZIPA 5G40A 4B45A 3E7WA 3EZ6A 2QZ4A 3OCOA 1DKRA 2WJHA 1J00A 1SCAA 3E84A 2Z0MA 3BH0A 4JCOA 2W70A 3AV3A 1Z2AA 3NEPX 1Z4LA 1AGPA 1KAEA 1II8A 1Y7IA 4MUHA 4J3FA 4RWEA 5EC8A 3TLZA 3VI4B 4DLAA 3C87A 4W7HA 1B0ZA 1KK2A 2Y6VA 1YL5A 2XBLA 3OTWA 4I3FA 3KSDO 3QU9A 3WOHA 2XMBA 4I4TB 3EY9A 2H6EA 5BN3A 4JOCA 1MV5A 1O94D 1PR6A 1ZNYA 2PHZA 3RYHA 4XXHA 2DUNA 2XMSA 4V0OA 4WNAB 1OFUX 4YAFA 1ORWA 2J08A 4YAIA 1QCYA 4IYSA 4FOLA 2CBXA 4B4OA 2N3ZA 1BXZA 1YOBA 2W6ZA 4ESYB 1C7EA 4LGMA 1ZVQA 3VSCA 2P62A 4LC0A 1D2NA 1AG9A 2YQ4A 5BN4A 1X0VA 2JI7A 2FP3A 3PQ6A 3UB4A 4KQEA 1SM4A 1XMPA 4BY9E 3R40A 2GNPA 3NHSA 3T7RA 4PGMA 3LP6A 4ENSA 2AOTB 5JFGA 3HP7A 4XEHA 2YJNA 3ZDDA 5BUZA 2I2DA 1KEPA 3OM0A 3WDSA 5JUWA 2NUAA 2Q1XA 3ZHSA 1B8UA 1XZKA 4EY8A 3GR6A 5IT0A 4ZTUB 1DTEA 3IMFA 3MPUA 4X8HA 3MJTA 3QVOA 2P6NA 3TFOA 1XJ5A 3WGUA 4G4IA 4IJKA 4O59O 4FIZA 1JTVA 1GO2A 4YC7A 2LCQA 3TCKA 2D06A 4EQ6B 4G24A 1N1EA 2G80A 3BF8A 3HP1A 4EVQA 3NBQA 2ONKA 1SN7A 3PHCA 2Z5GA 3DMPA 4XD2A 1QCDA 2NW6A 3DT9A 1NVFA 1E3SA 3MMNA 2QTVA 3PE6A 4CCAA 5IYZA 1LKZA 3E53A 5FWXA 1RWPA 5KWVA 3GDHA 4BO8A 3EODA 4NY1A 2BEKA 3HZRA 1XZEA 3V32A 1UZNA 2Q1UA 3U3DA 5JADA 5C1DA 2TMDA 3DMHA 4IO0A 4Y2GA 4B3FX 4LN1A 2WOJA 3U7EB 4D3YA 4CRWB 3FUUA 3ZNNA 2VATA 3HYTA 5KUTA 1I14A 2OBLA 1PJTA 1GN9A 3OKFA 5ENDA 2NP7A 4K3VA 4JEUA 3SNKA 5KNBD 4LYGA 1AUQA 3V9PA 4WLEA 3FDXA 3I23A 4C0QC 1YUBA 1K7FB 3THXB 3G2MA 3IERA 5EESA 2QROA 5EQJB 3W5JA 4D25A 1CHNA 1G291 3HKEA 1FL9A 1MTOA 1YKFA 1QH1B 4IEEA 3T3IA 1PDWA 4ER3A 5HX7A 1W5SA 1OXSC 3MJFA 5L6MB 3FHTA 4ISBA 3VKUA 5J43A 1I33A 3D5EA 1X94A 5JSFA 1E77A 1QSGA 3SS7X 3IXQA 2GEBA 2FXIA 2EW2A 4O4LF 2H3EA 3BZWA 3ZVMA 3IUNA 2C0QA 1SURA 2ZSUA 3Q0TA 3R0XA 4TSFD 4U2DA 1GG9A 1WXHA 3MA0A 2OC9A 1RHJA 3SKVA 3SPXA 4PTZA 3CEMA 1PBTA 3L7DA 2O8FB 2IITA 5KNBH 1YJAA 3MTDA 3B78A 3D3EA 4RV5A 5EUCA 2IVFA 4ZARA 3IBGA 2OV2A 1KJ9A 5IBRA 3LLSA 4AROA 2F8SA 1MENA 4UATA 5E6SA 4D4LA 1K7SN 1VSQA 4BRWA 4WBSA 5DGTA 2AD5A 2D0DA 4DEVA 3PI6A 4LXUA 5LXQA 3TNDA 3X1KA 2QUZA 3IR6A 5KNCH 1OWNA 1HX7A 1H0SA 1UAGA 4JVMA 1N3IA 1I4WA 2Q5FA 2BM1A 2IFTA 2VSQA 3LH5A 4KOEC 3UK1A 4GECA 2VQSA 2YFHA 3UF0A 4ZHQF 4YASA 3EPLA 1CE8B 3ICEA 4WASA 3WHKA 1ELOA 3SEZA 2AHRA 3EUAA 3NRJA 1KFCB 3LUFA 1XTSA 1QAQA 1RI4A 4JR2A 3ENQA 2B5OA 4DC1A 4DPMA 1GQ2A 1T3ZA 2LXNA 3E27A 3KT0A 2CJPA 1YE8A 4DV7B 4QPPA 3SGLA 2W71A 3BAZA 3UMJA 5J3JA 1WUJS 1QAMA 3LHKA 1X9GA 2A0FA 3JQDA 5TMBA 1B2LA 3WMWA 5H83A 4GZ5A 4EIWA 4EG8A 2ZU6A 1FF9A 2UZ1A 5IIPA 1Q50A 1L5LA 1T43A 2OUKA 4E70A 2LIVA 3HKCB 3R6LA 4X84A 4BJ1A 3J7AC 4F86A 2HY7A 4DJ5X 2Z04A 3KVNA 1V1MB 4G67A 4NCJA 4C04A 2HB6A 4D42A 1N5RA 1KARA 1GPKA 4KK3A 1XF9A 3O1LA 4OHUA 5BYBA 2IF2A 5IRCD 1TTTA 2R1TB 3ORGA 4YRMA 1O03A 2C2BA 4ER7A 3O4GA 1IUKA 4GOMD 5BV8A 1CNFA 1Y33E 2FPLA 3ROXA 2DFDA 3WLLA 4EYGA 4KVZA 2W2QA 5FXMA 4UXJA 3W2TA 2YNMD 4BQFA 1GCGA 1ODFA 3KXIA 1DRVA 1I5RA 1HT3A 4MNTA 1UUFA 1W9HA 3I8NA 2ZUVA 5ESXA 4I1UA 2AG0A 5D8DA 4YONB 2J85A 5KZMB 2YMLA 4Q15A 4BP1A 3U61B 5EXSA 1UPTA 5A7FA 1H8EA 1VZ3A 3H84A 4CI0B 4XIGS 2A9FA 1M1XB 1SQFA 1WY7A 1ZD1A 2R5NA 3F7OA 1XRNA 3WB0A 1TEHA 4L6CA 4P36A 4EB8A 3DD5A 2X7HA 5I9NA 3KTDA 4I2NA 4CT4B 2QD1A 5CH8A 3B1KA 4ON9A 1X7HA 5JLJA 4QUGA 1ZRNA 3QIAA 2GYYA 3L1HA 4F04A 3AERB 2JGLA 3C8DA 2ZKLA 3PX2A 5GWXA 2RGGA 3FZQA 2JAXA 2ZYUX 2AJTA 2Y99A 3GFPA 1YFKA 1LNSA 3T61A 4AIRA 2QRHA 1XZHA 2WG2A 4NC9A 5DEOA 1RXEA 2FDXA 3QE0A 1R0XA 3VC2A 4BQRA 1NX6A 3MEQA 5B1DA 3LUJA 2WOOA 4DZRA 4W9NA 2AC4A 1D2CA 4HT3B 5AM0A 1LSJA 4IX9A 4QELA 2UV7A 1AHHA 5KSZA 4ZC8A 4PS0A 3E9ZA 3FWKA 2G6BA 2P9QA 3ZGVA 2A9PA 1P4JA 3L41A 1U9ZA 3UTDA 1T5BA 1U7OA 2WJGA 3CU5A 4R0VA 2WQ7A 2DMRA 5KOIA 3C4VA 4A0HA 3U44B 3CUWA 4U2BA 5LLSA 3SXUB 3CXUA 5C5DA 5LPNA 3ZW7A 1JN0A 1KSGA 5E4FA 5BNTA 4X3PA 4F84A 1OH8A 2WFLA 4FWBA 4OQXA 4R8MA 3ZYCA 3LCRA 5KQLA 2AI1A 2GN9A 3WMEA 3EVAA 2HU5A 4QL3A 5AMXA 1DBQA 2WU3A 5LYYA 4N82A 3NALA 3MTEA 3KPUA 3S6JA 3SCZA 3U4QA 1J99A 3WLEA 3KLBA 4XDZA 5B57C 2C2GA 1ZLXA 1JW9B 5AJVB 2V0NA 1TUBA 5FLYA 3U7IA 2J5RA 4GYYA 4YJ2F 1B4DA 1VHLA 3NHBA 1XRSB 2VJCA 4KODA 3TJMA 4C6TB 1IN1A 1Q20A 1U90A 3U4HA 3GLIE 2ZSHA 5G0SA 1FP2A 4LVUA 3KOZA 1I7SB 3AR4A 4KBYA 1RT9A 3DHWC 1M33A 3TR5A 2YKGA 4JIGA 1B23P 2DPGA 1FSFA 1NTOA 2HPZA 1NY5A 2JCBA 4PXAA 2HDWA 4WNCA 3PT9A 1WHTA 1EZ1A 2CUZA 4ZVMA 4B35A 1SG6A 1UM9A 2HRRA 4NYIQ 3CPSA 3IAM6 4MIOA 1KVQA 1JG3A 3VR0A 4O4JF 4P3YA 4G0UA 4C76A 2E49A 2KWIA 1VRVA 2PEYA 3DBLB 3I6IA 5AJXA 1U2QA 2EU8A 5A9RA 2XJ9A 3WYDA 4LHZA 1G60A 3N2EA 4BLWA 2XTNA 3AUFA 4YJFB 2JW5A 5EG5A 4EI2A 4Z49A 4NOKA 4O4LB 5DK6A 2EF0A 4EWLA 3ORRA 1I0IA 4E7PA 1DSSG 2N1MA 4E22A 4Y2UA 2OAQ1 4AY2A 4MKXA 4J90A 4GUDA 4FLFA 3UC5A 1EG7A 4IZOA 3S4YA 2JFBA 3LYHA 1N2IA 3ONFA 1SXGA 4MQEB 2Q46A 5A7HA 2XH8A 4DRYA 1K3UB 2YMMA 2VR1A 4HQKA 4ROSA 1Y5IA 1LXCA 1FNDA 3FHOA 4TVKA 1R1DA 4YNBA 5K0NA 1GNQA 2H2WA 4MR7A 5TRTA 3L0OA 4B34A 1O95D 5DLQC 1HDYA 1V7PC 1WPRA 1DKNA 1FXWA 3ZIAD 3F1KA 5DHUA 3ASYA 3BJRA 1L6IA 3AY0A 4ZHQB 1AMOA 3MS2A 1JR3D 4I7EA 4NKRA 3JATB 1NRXA 4GXNA 3T9BA 4ZZ1A 3NASA 2Y4NA 2XZOA 5JSYA 4F2PA 1X1TA 2VPIA 1FTGA 1XRPA 4X6XA 3GOQA 2R85A 5TPZD 1QBGA 3FNEA 3FSJX 1WU7A 1ZK2A 4R4JA 2H11A 4XPIB 5B1IA 4C2UA 3UWPA 3QYAA 3L4SO 3G0OA 3I9V6 5H1YA 5IZCA 5FFMA 4DLSA 3NLLA 4HQNA 1ICIA 2CV1A 4JT8A 1BFDA 4KLRA 3QTBA 3WWDA 5H16A 4IDQA 1YQGA 3F3MA 1EXDA 3OZ7A 5FOWA 5L3RA 2F7SA 1JFVA 3RV4A 3BS4A 2H1RA 3MINB 3ICOA 2ZRIA 4DV3B 4EJ0A 5E8RA 2ZR8A 4TROA 3U40A 1OHHD 2QNIA 4UEQA 1NFQA 1A5TA 1DU4A 2PD4A 3FZEA 2DVMA 3GZNA 3QX7A 1VL2A 4MEJA 1HUQA 3DH0A 3M3HA 4JHLA 4OHKA 1W0JA 5IC4A 1TW3A 4LJYA 1KA9H 4DV5B 1QYVA 4WCFC 4BNNA 4Z0NA 2XRFA 2A92A 4LDZA 2YV3A 4P38A 2JCSA 1T6NA 2NM0A 3ABQB 3C41J 3C4JA 3EZFA 4W9RA 4E32A 1ESCA 9LDTA 2FHSA 4TTRA 5KVVA 3EHDA 1LI4A 3P19A 3J81k 3HKDA 1NNEA 4MLDA 3K9QO 5DWQA 4NNPA 2FLWA 1PR3A 3ZH2A 1A8UA 2ENUA 2WAXA 2ZUBA 3AETA 4OREX 3T1QA 7REQA 1O94A 5KTSA 1L5VA 2P65A 4FS8A 1P2BA 1NR7A 2FZEA 5EWMB 4D02A 2G4VA 3G0BA 2GAIA 3ZU2A 4E5VA 3JQPA 7YASA 1U5BB 3QPUA 4MRPA 1DC4A 4RKWA 3RJ5A 1BOOA 5AVSA 4KQKA 1NN3A 3RBZA 4ZYZA 1SCQA 3C39A 4PVDA 1XDDA 5LA6F 1MDFA 2UZ0A 4DIMA 1BN7A 2ECPA 2D0PB 4L3OA 3ECSA 4ZVNA 2PL1A 4EGCB 1T8UA 4YMUA 5IASA 1M75A 1R5JA 3KJXA 4X1KA 2PBZA 2I55A 3W3ZB 3LPAA 2XOXA 2YVLA 4BKRA 4HD8A 4OD0A 2HK7A 3EQ2A 1YQQA 5ER9A 2JH9A 3A36A 1I7DA 1GTVA 3PC4A 1E1RD 3U3JA 3SD7A 5CPFA 4DLLA 4ZI3A 3ZE0B 5KJCA 4ZO9A 3KCNA 3LW8A 1RXVA 1Z6QA 1TTHA 3IAXA 2I9KA 2Z2KA 3FDZA 3GEBA 3PPVA 4QXQA 4ARZA 3J7TA 4PZYA 2PVPA 5IZCC 3O8QA 3FYDA 1RMQA 1PR4A 4AG5A 1J70A 1FA9A 2EKZA 4MHSA 4FQ5A 1BH2A 3L8YA 3LV9A 1DT3A 2VG8A 1FTQA 1DNPA 1UWLA 4FYHA 5JATA 1I1QB 1KHHA 1EG2A 1S8AA 2P9BA 1KOLA 2VNKA 4H08A 1DRKA 2R60A 1Z2PX 1JI3A 5ALXA 2NZ8A 5CBPA 3Q1KA 2J5KA 4PIVA 1FB5A 4YJ2B 5E3HA 4HUTA 5JXJA 4OM7A 5T4HA 2UVPB 1C0EA 5ALQA 1MT3A 2GCIA 3CN7A 3DNMA 4B82A 3MAJA 2JDID 1VP9A 2CV0A 1H3NA 5DNUA 1P7WA 3AGQA 2PMEA 5B64A 1GT6A 2Q4BA 2WYVA 3ANNA 2IOQA 5EHXA 2OHHA 4GC5A 4INJA 5HM6A 1CJMA 2EGGA 3O8LA 2ZZNA 2G5PA 3HV0A 2NVWA 1FNMA 1GZ4A 1QPGA 1SHTX 1EHYA 1WM1A 2FF7A 3AUTA 3DL0A 2I91A 4D3XA 3LF2A 3GBVA 3GMIA 3TVTA 4O4JB 1N8NA 1RTTA 1WR8A 2NG1A 3I2YX 3JTMA 4Z54A 1VFPA 2VK2A 4H3VA 1F3LA 4JLVA 4Y2SA 1W34A 4QC2A 2F1JA 1JE1A 4PTYA 3EZXA 3X2SA 4DUGA 5I9BA 1U7ZA 5KU1A 4MDEA 1SUSA 1IQUA 1SCIA 2DJIA 3EQ6A 1UEIA 4RM3A 2ORED 3IOEA 5KHLB 2Z2JA 3OZRA 1VCOA 3E9RA 4MW5A 4UEJA 2ZJ2A 2FE1A 3C16C 4I6GA 1DJPA 1ZSYA 1BMDA 5K4GA 1BJRE 1TI7A 5EGNA 3C48A 1E3MA 4QEKA 4NG4A 1HNWB 5IEBA 5GIPE 1KZYC 1JUDA 1Q22A 1GPLA 1XG5A 2CLMB 2NNWB 2O2ZA 4X0EA 5CLLA 3CZAA 4DDWA 2P9GA 5BT8A 4B2LA 4DCMA 3IO5A 4P22A 1FP6A 1VE3A 3RTGA 1N78A 4E2YA 2MYUA 1L7PA 3CH5A 2BFOA 1ZW6A 1KZ7B 1B8NA 3LKVA 1JLLA 3WDKA 3LC0A 1L0BA 5AOCA 1R37A 4S1TA 2WU4A 5AKKA 3LBHA 2NUPA 4L4ZA 2E55A 4WVFA 1NXTA 4P4TA 3TRIA 2WU1A 3PWTA 5DSTA 4E6PA 2D2EA 1O50A 1FP1D 1PJQA 2ZTMA 3E8XA 4TVOA 5CFPA 2OXFA 2AIRA 3BRWD 2WIBA 4Y6OA 1UMBA 3RT1A 4F5ZA 1QQAA 3HCEA 3ZE8A 4YA6A 1YA4A 3EVDA 4AX8A 3E4DA 1A7AA 5E9QA 3KPBA 1TO1E 1NT2A 1W88A 2EC5A 1T9HA 2WAYA 4K6CA 4PYNA 2Z4RA 4ME6A 5DH9A 3VSAA 4F21A 2ADMA 2Z1DA 2HH9A 3OPYB 4C4ZA 3DEKA 3OFSA 2WSYB 2QY6A 4PNZA 1IH8A 1QVZA 1QYXA 1MT0A 1FP4A 1RKQA 3G3EA 3IQWA 1KH1A 1SO8A 1U31A 2PLAA 3M1IA 3MMSA 4R1MA 4U2FA 3MSXA 3SBEA 4BZXA 2Z5FA 2F9FA 4CCSA 4PU0A 2H1CA 4Y9UA 2OCDA 3FAZA 4KX3A 3SVZA 1ZEMA 4LHWA 3VU9A 4TZTA 2YHIB 5ALWA 1VJDA 4GYKA 2B4KA 3RUFA 2WJWA 2GZ3A 4MMYB 1CJVC 3AEQB 3KXLA 3DZKA 2DR3A 4EHBA 5IF9A 4C2BA 5IM4F 5D3QA 1REQB 3FWNA 1JRLA 3OH8A 5BQ3A 1R00A 4BMSA 4XRGA 1E62A 4QHTA 1X8JA 4LSGA 1JHYA 3WLIA 3E8SA 1AKUA 3LUBA 4QSHA 5LMCA 1NL3A 1WCIB 1QZXA 4NAVA 3CX3A 4XI9A 2WICA 1IZ7A 3C70A 3FKJA 1T4DA 3K3PA 4MICA 1N3YA 1G8MA 1QE5A 3DFMA 1UC8A 1B43A 4XX1A 3WXMA 1PX2A 3CRNA 5GONF 4U7DA 2OV3A 2WJZB 1JE0A 4NARA 2GM5A 4GMXA 3GLHB 3QPBA 1IY8A 1LSOA 2J5BA 3KJEA 2HV8A 1QS0A 2FEPA 4KSCA 4TYMA 2NUTA 4BVGA 1NVXQ 4HQFA 1WABA 1YCDA 1H6BA 2NU9A 2VA9A 4HZGA 4M7PA 4MP3A 4NE2A 3MSCA 3TSCA 2DT5A 2OBYA 1GCAA 1NC1A 3PRKE 1EFUA 3GA0A 2DUMA 3BKWA 4LWOA 4LQLA 1YJ5A 2G76A 3RRMA 5T6BA 2O19A 3GV0A 3QVWA 2IHJA 4BQIA 2YC4C 1P75A 4ITUA 3VDXA 1EJBA 5AW8A 3RADC 1AVTA 2Z1NA 1SD2A 3U3XA 5DLYA 4FR0A 2ZE8A 2GB4A 3F6PA 3FYHA 3S2FA 4A1FA 3LO8A 1YA6A 3UJHA 2P0EA 2WF9A 2DKFA 3RUAA 4MGHA 2ORWA 1YZNA 4HB2A 1KI3A 5KCMA 2BPOA 3HZHA 5HQ3B 4BMDA 3OPXA 3FHCB 3H6KA 4BP8A 3L7NA 5LA6B 3MCZA 1SUCA 5HFNA 2PY6A 1O9GA 3D1LA 4MW6A 4GBMA 2QQ5A 2O7SA 4K87A 5LQKA 3QWAA 2X3YA 4MUJA 2E2WA 5BOVA 3HXMA 1Y7PA 3RYIA 1D0SA 5BT9A 1OI3A 1T4CB 2P90A 3AJDA 4WZAA 5FOUA 5SYNA 4OP2A 4RYLA 4EQZA 2RK4A 1WKVA 3EGXB 1US8B 3V2IA 1OIXA 3RHFA 5C37A 3NHYA 1FRVA 1X9IA 4JYCA 2JIMA 4BMPB 1LBSA 2IQ5A 2QUAA 1XKQA 3NUGA 4FDAA 1GPYA 1W52X 4I9HA 1ZM9A 2MSCB 1P1JA 5HJ7A 1MB9A 4XUDA 4FHZA 4I1IA 3UOAB 3EN0A 1N6LA 4Y6PA 2PSEA 1W44A 3N2YA 3R23A 5YASA 4ZDJA 5IJ9B 5LU8A 4JKOA 4IG9A 5IWAB 4CM1A 2HDNB 4G5GA 5EUBA 4OU4A 2H7CA 4U6SA 1E2GA 2Y1WA 4YRFA 3LBNA 1L7QA 3NJ4A 2M6SA 4PZEA 2L18A 2R96A 2V6GA 2JD2A 3TTYA 3WBFA 5EKUA 1U7XA 3U39A 2FVXA 5BSRA 4LNUB 3RUPA 2BKLA 1CS4C 1UJ2A 5KDLA 3A05A 2QMUA 2OCBA 5CVJA 3CKLA 3NYRA 2OXCA 3W6PA 4UZSA 3N07A 3RSSA 2BMAA 4N0EA 2IOYA 2PVSA 5HS4A 1UH5A 1NF8A 1XU9A 3JR3A 4X24A 3D4LA 4R0MA 4P0TA 3F46A 1S96A 4G3XA 5EPOA 2Q8QA 4KVAA 5KEIA 4IHJA 3Q5GA 1AQLA 1Z22A 3EW9A 5EHQA 3WL5A 2AD1A 1CJBA 1U3TA 3AKYA 2GD0A 2FG7C 3GFFA 4XIYA 3MM4A 4LVCA 3PFBA 2XE6A 3ADKA 3EBLA 2Y0CA 2GTPA 1ZGBA 3HN6A 1T6YA 3QVUA 3DE4X 3N2ZB 2HT6A 5BSHA 1ZOIA 2IIPA 2KX7A 3FPHA 3IMGA 4CKCA 4C6SA 4PLZA 4YPVA 4AF7A 2FSPA 3V4RA 1DKUA 3FLEA 5BR8B 4YN3A 3ET5A 4NXMB 3ZCTA 1F9AA 1BU8A 3IB3A 4IUCS 3K5IA 2DB3A 3K96A 2Q0XA 3ZG6A 4OXQA 4AN0A 5IKXA 3H17A 5FUBA 3J80A 2PLNA 5HP4A 3KVYA 2H4YA 2VVTA 5DF1A 5B2EA 4JGIA 821PA 1UBFA 1S2DA 3G0IA 5ITVA 4AJLA 4ZAWA 1SXPA 5EP3A 4U5XA 1ZNZA 1W0KA 2J6HA 1L5YA 1PX0A 1EE9A 2V9PA 3CPJB 3E9YA 3NHRA 1HT1E 3ZIAA 3T3NA 4CKBA 2GH1A 3F96A 3C6BA 2AG6A 5I8ZA 3TEMA 4DZTA 4R2JA 1Z74A 5IH7A 5AUNB 1KH3A 1QFYA 4NS1A 4CLHA 5AH0A 4WTOA 4QOGA 4FWTA 2DLDA 4HNHA 4A15A 4JK3A 3SZGA 1SRQA 2EDCA 2JJYA 2R6HA 3I05A 1EK1A 3DLTA 1QRUA 2QN2A 3X1XA 5TPZA 4WK2B 5J23A 3QGMA 1Q7EA 1LVUA 4GZLA 5EMKA 2HNKA 1CG6A 1P6QA 5BXQC 2JRLA 1OXBB 4ZAYA 1ZISA 1GQRA 1FS5A 3Q85A 2AFHA 2GPTA 2J7KA 2X4DA 3D5TA 3PXXA 2AUNA 4RDCA 3C7TA 2J32A 3PZRA 4BLRA 4YIKA 4MI3A 3THOA 2OO5A 3O3CA 4AMZA 4MUFA 1ZS9A 1IZZA 2GCNA 2H9IA 3DCNA 1RU3A 3LQ2A 5CK5A 4IV5A 1FDVA 1U2DA 2VT2A 4C0WA 5FL7D 2B2CA 3KQWA 1K8XB 3HNRA 1ISHA 2RE8A 4D0SA 3AWIA 1Q0HA 1SUIA 2Y1KA 2QD3A 3VV3A 3RHTA 3H7AA 4W99A 2JHGA 1FX1A 1X92A 3H04A 3DE1X 5C18A 3KAKA 3TW6A 1Q74A 3CZRA 4US0R 1HC7A 3F6BX 3LK7A 4HEJA 4M8SA 1YK1A 3QOWA 3C1UA 4N0PA 4QGHA 4QUBA 2ZT5A 3UV7A 4UOZA 4J4BA 1U11A 3TIVA 4GPAA 3UICA 2B92A 1IY2A 3ID6C 1C3VA 1UADA 4HGYA 3TK1A 3DMFA 4CLRB 2JCXA 3W34A 4C7MA 4DREA 1KKLA 2ANCA 3RAFC 1Z63A 1AHIA 1RJWA 3TZKA 1BYIA 4GI7A 4D9HA 5HKAA 1X7WB 2I2WA 2BFCB 7MHTA 4Q3BA 1OD6A 4N47A 1CDDA 2DFTA 3DTVA 2HCRA 5SV2A 2JKVA 2ZBGA 4WY8A 1J20A 4KWCA 2D8AA 9LDBA 4AUEA 3H9UA 1Q0RA 3PC6A 4MS4A 1H2EA 2P9EA 4JLOA 4L28A 1FNBA 3X1MA 3WJ7A 3EWNA 2FSVC 2IUSA 4YJGB 2HV9A 3H1EA 5KNLA 3JZIA 2FPPA 1I4EB 2OORC 4JLNA 5CITA 1M7HA 5FHQA 3HGMA 3LWBA 2BIFA 3QBEA 2FPIB 3KYDA 3MJVA 5KVQA 5TQ0A 3PLNA 3NDPA 3LT4A 1I13A 2ZWAA 4KO2S 4UUMA 2AS0A 2Y1FA 421PA 2C29D 4KMMA 2R2GA 2QN3A 2GKSA 3ILVA 4PZAA 1U8UA 5FOXA 1GUFA 4V2UA 3PXUA 1U7HA 3T94A 2QZZA 5CB6A 4TX1A 4ACAA 5B3JA 4DQXA 2F9MA 5ECDA 3RIHA 5CK4A 4YRKA 1MCZA 2PRSA 4S24A 1LEHA 1FFGA 2WAAA 3PRHA 1XJQA 1N2ZA 1SBZA 3EFEA 5I7HA 3KQNA 2W2VA 4QFDA 3KLNA 1Q83A 4O2BA 4DQWA 1OFTA 1F20A 1IB0A 4R8LA 2OO5C 2DE0X 4Z9FA 2C8KA 3A3OA 3V1TC 3SFVA 4ACBA 3JV7A 3GMTA 1K6XA 1U2DC 2LBPA 3RHSA 3RDPA 4WKNA 4R1TA 2OFXA 2YDXA 4YRSA 3ZI7A 1Z5GA 1ES9A 1LTHR 4F97A 4CIBA 4CMGA 1CF4A 3WL4A 3PUVA 4YP6A 1C7ZA 3HYLA 1K2WA 1ARZA 5EY5B 4U8HA 5A03A 1KAHA 4J6FA 4NHEA 3GT3A 2I66A 2QYTA 3BG5A 4MUGA 3OAAA 3PYLA 3OI8A 3C6YA 4P4GA 4AJIA 1IWPB 2YXNA 4BX0A 3FPLA 4M98A 2NO1A 3FBWA 3NIFB 1Q5PA 4ZCRA 3OKPA 4GP9A 2XNJA 4DLXA 4K9DA 1NOKA 4AQDA 4A03A 1XMOB 5BORA 3IAFA 1GSHA 5C4IA 3AKCA 3UJ6A 4EPVA 3KVVA 4ZCSA 1MTZA 5JDIA 5G4KB 5JSZA 3HUDA 2GXUA 4E5DA 1M0TA 2QT9A 2LKCA 2R6JA 3UMRA 3AWDA 3V8EA 3I01M 4Q9LA 4II7A 3UAVA 5H3LA 5K3OA 4LG1A 4CLXA 2ZTHA 4BATA 4KWIA 4B9AA 1TK2A 4JP3A 5HW0A 5JMWA 1UMCB 1YZLA 3KJFA 4P35A 1UFQA 1CZNA 2GZHA 1R7RA 2EFGA 5G53C 5K2MA 2YBDA 1UFOA 2IPLA 4L5YA 1L5ZA 3PXAA 3GJ0A 1TVMA 3NWEA 4UZFA 2Y9MB 1BNCA 3H9BA 3LKBA 4RZSA 3V7UA 3KJZA 1ULZA 1N7HA 1WZIA 4F60A 1XVLA 2C95A 1VE6A 2NU8A 1N2CA 4P4LA 4RF2A 2QJWA 2XSZD 4YALA 4ZJZA 9ATCA 4KQHA 5GMOA 4C07A 1J1UA 4LJ6A 4RK0A 2JZOA 4PO3X 4RZXA 4W4TA 2OA0A 2AA3A 1XALA 1B74A 2CVZA 4LZPA 4MEAA 4BMYA 1QK4A 1MQ9A 2ZJZA 2A5YB 1XWFA 4HAIA 5JCXA 2PNFA 1V4BA 4I5IA 2V7XA 1CUSA 3MWLA 4C3ZA 3LSTA 2YICA 1K9VF 1B76A 3ZV3A 5B3JC 4JL8A 4GIBA 5A4AA 4Q7QA 1TMYA 1V5WA 2CLCX 2DFPA 3CEPB 3T52A 2RIFA 5ETJA 1G9SA 1Y6FA 3I64A 4AO7A 3IA2A 1WJGA 2W2TA 2XGMA 3QEAZ 4J16A 1V4NA 3OPQA 5DGXA 1MOQA 4QO7A 4KLAA 5CIYA 3SQMA 3BREA 1SCJA 1HMYA 3ITDA 3OEWA 1G8AA 5FA8A 4L74A 3VR3A 2FPGA 4KIJA 4DS3A 3C6ZA 4E1AA 3PTAA 2BFFB 3DVSX 3PNQA 3S1AA 3BSSA 3AF5A 3AR8A 3R3JA 3NJRA 2C0CA 4QICA 4DJAA 3K09A 2ZUFA 4JV5B 4B9EA 3IIJA 2H51A 1CUVA 4G0QA 2EDAA 1AKRA 2P6MA 2VHZA 3NP9A 4H7PA 4W5HA 4A91A 3QX8A 1CQJB 2J6IA 4JKIA 1DCTA 3LFTA 1MOSA 1N3LA 2QLNA 4FLEA 4R2WA 4CZ2A 5JNTA 1VE5A 1E8NA 2BKAA 1EB8A 4OGGA 2O20A 1TADA 2CJFA 4XVCA 1Z29A 1F0PA 1U1IA 2CCKA 3EFBA 3WP0A 3AM1A 2G9UA 1LK7A 3ZOZA 3TB6A 3QBJA 4O2LA 2X0FA 3M7IA 4HI0E 5K7SA 1AMUA 1NGSA 4RHYA 1GGVA 2JGNA 3GRZA 4QREA 1N0UA 4AM8A 4E5NA 4RL6A 4LECA 2IE0A 2REOA 4WGGA 5BRNA 3QKUA 2CHQA 5JEDA 3IDSA 2Y71A 3VZSA 4F71A 2PZ8A 2Z6UA 3G2LA 2QR1E 1SXJB 4DLZA 4CQLB 2HU7A 2C42A 1Y4ZA 2ZTSA 4KVFA 3G2HA 2VEOA 3T15A 3Q7TA 4KIFA 3I01A 4R68A 4J0JA 4N76A 2G09A 1E6CA 1U81A 4LBVA 1IWBB 2Z3WA 4TMKA 3ZE7A 5DV9A 4R69A 5ALGA 3W7AA 3KE8A 4AMVA 4CMIA 4ZYUA 3DEYX 3RVQA 1U1GA 2ET6A 2Z3ZA 1AQUA 1K75A 1TKAA 1A8HA 4QE3A 4Y1GA 3K6EA 1CUIA 4U3JA 3G1UA 2PT5A 1VMKA 4UBMA 3E05A 2HA2A 5JLAA 1A76A 2YW9A 1OBCA 2JCVA 4I99A 2GUGA 2E89A 3SDSA 2WLSA 5IJAA 2W4MA 1KU6A 1UBOS 2CLLB 1J9ZA 4MJLA 5DRTA 1M83A 4URUR 4GOOD 4K6HA 4EEKA 4XB1A 5HSGA 3ZX4A 2WWFA 1DBPA 1PD1A 3WGZA 5CCXA 2AQ8A 4JYBA 4WBXC 5J5AA 4Z4CA 2W22A 3C8MA 4L5BA 1JFFA 2ORIA 1MMFB 1WKBA 3FPAA 3F5FA 3A4IA 5LQSA 2E5WA 2ZTUA 3PQ3A 3CE6A 3PD0A 5A2GA 4DLTA 2QPAA 2CKDA 1XRMA 3TLAA 3EIXA 2H2GA 2ZATA 3VPFA 2VTBA 1R4AA 1KEVA 4RHTA 4JYAB 3B9RA 1CZUA 2NYRA 3D4PA 1L5GB 2WVAA 3CISA 1KJWA 2J8ZA 4N65A 2Y1CA 3HCAA 4F9FA 1KERA 4IOLA 5JSHA 2Q0HA 3K09C 1WV0A 2C9BA 3OIFA 4LF8B 2PLWA 3QHAA 1OFVA 2WKRA 5FTWA 3G68A 3Q6IA 1QQBA 3KJNA 1V5GA 3W2FA 1E59A 3O83A 2VPTA 3UOWA 4ARSA 2P4SA 1SUWA 3U7QA 2BZ0A 2H1OA 5FWNA 1WTAA 1B1CA 1HL7A 1T1IA 2Q2NA 2I8LA 3PGJA 3R6DA 1RD4A 2FI1A 2H0RA 2BEVA 5BWMA 1OH5A 1AQYA 3LUDA 2P40A 3OIUA 3PNLA 2CCJA 2YASA 4LC9A 4U9IS 3SMQA 2BH2A 1OTYA 1W25A 2JGAA 1FUKA 5FT9A 1SY7A 3UXEA 2HYIC 2BFPA 1EP1B 2V45A 1NW3A 3TLMA 4H16A 2XR1A 1C0KA 1VB5A 3FROA 1IIBA 3I9FA 1HSOA 3DD1A 3H42B 1BD4A 3ANTA 3E23A 4P32A 5TDHA 1WETA 3BH7A 5KWIA 2YHSA 2ZYIA 3NGXA 4Y6LA 5F78A 4O4HA 5EKSA 1YS6A 4D9FA 5JH7A 3QEBZ 2YXEA 5AVVA 3IB6A 2IW1A 3DR5A 3IPAA 5JS8A 2AZ4A 3OCCA 2RHGB 4HEA6 2XGGA 3EAGA 4DR6B 1GZSA 5A6SB 2CMFA 2VH1A 3FUXA 3L07A 4RQUA 3UHPA 4L78A 4KR0A 3UWKA 5L40A 2O0HA 3NPAA 1CEEA 2QLBA 1PEDA 3AK4A 3KP1A 4LIPD 1G3QA 2V97A 3AR5A 2AZDA 4N39A 4IOMA 1X1DA 4H0CA 1E0SA 4PANA 4Z2YA 4DIUA 5K6TA 1GA1A 1GTMA 2LGJA 3IEUA 2PT9A 1E1QD 2NYVA 1YSCA 1RYYA 3CRQA 3N76A 2QS9A 1TC1A 1KPHA 2YZQA 1X39A 1MW9X 1MRSA 2FMHA 2REQB 3OCZA 4MAAA 2W58A 3OEED 4YRZA 2HLHA 1A2OA 1J90A 4CM7A 5CFOA 3LJKA 5IWCA 2R1UA 5CVEA 4IL5A 3UK7A 3KKZA 2IHYA 2X22A 3D3WA 2C7OA 4TS3A 4HNAB 2QTAA 1DC3A 4RM2A 4BE9A 5K3FA 3TCNA 2V54A 4C9BA 3PUIA 2VJAA 5LKAA 2FR8A 4U2KA 4C0AC 5LQAA 5KSPA 4YHBA 1M6NA 3SFTA 1KI6A 1ZQ9A 3D2CA 4NCIA 4O29A 3JR7A 4ZDKA 1JFTA 1VMAA 5DHTA 2RAFA 3IUSA 2I6GA 2JIBA 3HKBB 3ONNA 3HI6A 2ZIXA 5DN6D 1ZXBA 3LA8A 3C7CB 4AP5A 3D3JA 3WMXA 5DCUA 3PJEA 3WSTA 4JLMA 4FOOA 1Q57A 2WM8A 4OP3A 5BVGB 1Z68A 1DJQA 1XA0A 5CFLA 1JEQA 4NBVA 1MRNA 4DG5A 2QEQA 3NHPA 3OQ1A 4PPFA 4EMUA 4KQGA 1WBDA 3CH4B 5HRUA 2JRCA 2Q5EA 3O0TA 3QWBA 3P1JA 3P9SA 1ISMA 4TLEA 4BAZA 1EFRD 1M1YA 2YZMA 1KYZA 3EVCA 7ABPA 2O8EB 1ZL0A 2V55B 1D7OA 2UUBB 4DQLA 2DQKA 1T2UA 3TZLA 1RSZA 4DNOA 2YHBA 4UMFA 3GGPA 3VR6A 5KIAA 3K6SA 4F1WA 1N6PA 1UBRS 1VYTA 2EWWA 3H2BA 1IVNA 5LYJF 1M2JA 3MPOA 3PDIA 4KL8S 1IONA 2ZREA 3LC2O 4Q4LA 1W6RA 2Y2UA 3VZRA 2H9YA 4TQ9A 1YE5A 5A3SA 1U6JA 2F6RA 2HXGA 2ZB4A 2OG2A 3O9VA 2CE7A 4KFSA 3WKCA 1CQPA 5FL7A 4ZANA 2B21A 1A2QA 1W96A 5F35A 5TARA 3OBIA 2YZKA 4FYJA 1QFZA 3OZXA 5TQVA 2IV3A 5CXQA 1SGWA 4PCUA 4MS1B 1EXMA 2R6FA 3A4VA 3K8QA 4QYSA 4A8PA 4G86A 4HGQA 1RWWA 2H08A 3ZHXA 2WUEA 5JMTA 3EIQA 4QAJA 1NZDA 4U5QA 2RHWA 4W63A 5BYJA 1Y7HA 5JDCA 1DRUA 3WIBA 4HB0A 2YYAA 1WV1A 3T12A 3LSYA 1SVKA 3ROTA 4B76A 1G20B 2BR5A 5ERYA 1C41A 5JNRA 3ZVNA 3ZGNA 5JAUA 4WADA 4BE4A 3K9NA 4A1OA 8MHTA 3HSYA 5FULA 3MCUA 4HLDA 4D9KA 1YVPA 3R1IA 2W2NA 1PR0A 1TDJA 1RZRD 5EE3A 5L3QB 2NQ2C 4TS9A 1JBQA 2CXXA 1QC5A 1GFWA 2OD2A 3HXLA 5L8VA 4FT2A 2OQIA 1WXWA 1G21A 1S2GA 2FTKE 1YDFA 2FR8C 4QUHA 5H0IA 4PHHA 2C8VA 1UWKA 3MCTA 3M4YA 1B8PA 4GI1A 4FFVA 3IAS1 2C2HA 2ONCA 2VEDA 3PE4A 3PEWA 1PFVA 3W5HA 3KWMA 5SICE 4L16A 1S2MA 3BGIA 3TD6A 3UCEA 3C6MA 4EGAA 4YUAA 2OK8A 1G9TA 3HJUA 4RS3A 3A0RB 4AD8A 1QQ6A 5DCLA 3TTWA 1Y6GA 3SQXA 2AFHE 2BGKA 3HADA 3HS3A 2CBZA 3W8FA 5EJ6A 2FEOA 1D3AA 4H6PA 8GPBA 1RWOA