1XKFA

Crystal structure of hypoxic response protein i (hrpi) with two coordinated zinc ions
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
123
structure length
120
Chain Sequence
TTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGELAIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure and unusual protein chemistry of hypoxic response protein 1, a latency antigen and highly expressed member of the DosR regulon in Mycobacterium tuberculosis
pubmed doi rcsb
molecule keywords hypothetical protein RV2626C
molecule tags Unknown function
source organism Mycobacterium tuberculosis
total genus 34
structure length 120
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 1xkfA00
4L3VA 3KPCA 2QLVC 1Y5HA 4IY3A 4GQVA 2EF7A 4O9KA 2ZY9A 5K22B 2OOYE 3OI8A 3L31A 4FRYA 4GQYA 2UV6A 3TDHC 3KH5A 3PC3A 4NOCA 1XKFA 4IY2A 4UUUA 2YVXA 4IY4A 2OOXE 2UV5A 3T4NC 2RIHA 4IY0A 2UV7A 5K23C 4L27A 3FWSA 2QRCE 2O16A 2QRDE 3L2BA 2RC3A 3K2VA 4IYSA 1PVMA 5K24C 2YZIA 4ESYA 4HG0A 3OCMA 4PCUA 3FHMA 3LV9A 5K25C 2EMQA 4ESYB 3LHHA 2YVYA 3FWRA 3LFZA 4DQWA 2YVZA 3TE5C 3I8NA 2QREE 2D4ZA 2UV4A 1O50A 4L0DA 2NYEA 1YAVA 5LXQA 5KS7A 3KPBA 3FV6A 3KXRA 4P1OA 4L28A 2OUXA 4COOA 3LQNA 3DDJA 3HF7A 5MMZA 3SL7A 5IIPA 3GBYA 1PBJA 2QR1E 2P9MA 3OCOA 2RIFA 2NYCA 2PFIA 4FXSA 4P1GA 4GQWA 3KPDA 2QH1A 3K6EA 2YZQA 3ORGA 3PC2A 3PC4A 3FNAA
chains in the Genus database with same CATH superfamily
2JA3A 4L3VA 3KPCA 2QLVC 1Y5HA 4IY3A 4GQVA 2EF7A 4O9KA 2ZY9A 5K22B 2OOYE 3OI8A 3L31A 4FRYA 4GQYA 2UV6A 3TDHC 3KH5A 3PC3A 4NOCA 1XKFA 4IY2A 4UUUA 2YVXA 4IY4A 2OOXE 2UV5A 2J9LA 3T4NC 2RIHA 4IY0A 2UV7A 5K23C 4L27A 3FWSA 2QRCE 2O16A 2QRDE 3L2BA 2RC3A 3K2VA 4IYSA 1PVMA 5K24C 2YZIA 4ESYA 4HG0A 3OCMA 4PCUA 3FHMA 3LV9A 5K25C 2EMQA 4ESYB 3LHHA 2YVYA 3FWRA 3LFZA 4DQWA 2YVZA 3TE5C 3I8NA 2QREE 2D4ZA 2UV4A 1O50A 4L0DA 2NYEA 1YAVA 5LXQA 5KS7A 3KPBA 3FV6A 3KXRA 4P1OA 4L28A 2OUXA 4COOA 3LQNA 3DDJA 3HF7A 5MMZA 3SL7A 5IIPA 3GBYA 1PBJA 2QR1E 2P9MA 3OCOA 2RIFA 2NYCA 2PFIA 4FXSA 4P1GA 4GQWA 3KPDA 2QH1A 3K6EA 2YZQA 3ORGA 3PC2A 3PC4A 3FNAA
chains in the Genus database with same CATH topology
2JA3A 4L3VA 3KPCA 2QLVC 1Y5HA 4IY3A 4GQVA 2EF7A 4O9KA 2ZY9A 5K22B 2OOYE 3OI8A 3L31A 4FRYA 4GQYA 2UV6A 3TDHC 3KH5A 3PC3A 4NOCA 1XKFA 4IY2A 4UUUA 2YVXA 4IY4A 2OOXE 2UV5A 2J9LA 3T4NC 2RIHA 4IY0A 2UV7A 5K23C 4L27A 3FWSA 2QRCE 2O16A 2QRDE 3L2BA 2RC3A 3K2VA 4IYSA 1PVMA 5K24C 2YZIA 4ESYA 4HG0A 3OCMA 4PCUA 3FHMA 3LV9A 5K25C 2EMQA 4ESYB 3LHHA 2YVYA 3FWRA 3LFZA 4DQWA 2YVZA 3TE5C 3I8NA 2QREE 2D4ZA 2UV4A 1O50A 4L0DA 2NYEA 1YAVA 5LXQA 5KS7A 3KPBA 3FV6A 3KXRA 4P1OA 4L28A 2OUXA 4COOA 3LQNA 3DDJA 3HF7A 5MMZA 3SL7A 5IIPA 3GBYA 1PBJA 2QR1E 2P9MA 3OCOA 2RIFA 2NYCA 2PFIA 4FXSA 4P1GA 4GQWA 3KPDA 2QH1A 3K6EA 2YZQA 3ORGA 3PC2A 3PC4A 3FNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L3V A;  3KPC A;  2QLV C;  1Y5H A;  4IY3 A;  4GQV A;  2EF7 A;  4O9K A;  2ZY9 A;  5K22 B;  2OOY E;  3OI8 A;  3L31 A;  4FRY A;  4GQY A;  2UV6 A;  3TDH C;  3KH5 A;  3PC3 A;  4NOC A;  1XKF A;  4IY2 A;  4UUU A;  2YVX A;  4IY4 A;  2OOX E;  2UV5 A;  3T4N C;  2RIH A;  4IY0 A;  2UV7 A;  5K23 C;  4L27 A;  3FWS A;  2QRC E;  2O16 A;  2QRD E;  3L2B A;  2RC3 A;  3K2V A;  4IYS A;  1PVM A;  5K24 C;  2YZI A;  4ESY A;  4HG0 A;  3OCM A;  4PCU A;  3FHM A;  3LV9 A;  5K25 C;  2EMQ A;  4ESY B;  3LHH A;  2YVY A;  3FWR A;  3LFZ A;  4DQW A;  2YVZ A;  3TE5 C;  3I8N A;  2QRE E;  2D4Z A;  2UV4 A;  1O50 A;  4L0D A;  2NYE A;  1YAV A;  5LXQ A;  5KS7 A;  3KPB A;  3FV6 A;  3KXR A;  4P1O A;  4L28 A;  2OUX A;  4COO A;  3LQN A;  3DDJ A;  3HF7 A;  5MMZ A;  3SL7 A;  5IIP A;  3GBY A;  1PBJ A;  2QR1 E;  2P9M A;  3OCO A;  2RIF A;  2NYC A;  2PFI A;  4FXS A;  4P1G A;  4GQW A;  3KPD A;  2QH1 A;  3K6E A;  2YZQ A;  3ORG A;  3PC2 A;  3PC4 A;  3FNA A; 
#chains in the Genus database with same CATH topology
 2JA3 A;  4L3V A;  3KPC A;  2QLV C;  1Y5H A;  4IY3 A;  4GQV A;  2EF7 A;  4O9K A;  2ZY9 A;  5K22 B;  2OOY E;  3OI8 A;  3L31 A;  4FRY A;  4GQY A;  2UV6 A;  3TDH C;  3KH5 A;  3PC3 A;  4NOC A;  1XKF A;  4IY2 A;  4UUU A;  2YVX A;  4IY4 A;  2OOX E;  2UV5 A;  2J9L A;  3T4N C;  2RIH A;  4IY0 A;  2UV7 A;  5K23 C;  4L27 A;  3FWS A;  2QRC E;  2O16 A;  2QRD E;  3L2B A;  2RC3 A;  3K2V A;  4IYS A;  1PVM A;  5K24 C;  2YZI A;  4ESY A;  4HG0 A;  3OCM A;  4PCU A;  3FHM A;  3LV9 A;  5K25 C;  2EMQ A;  4ESY B;  3LHH A;  2YVY A;  3FWR A;  3LFZ A;  4DQW A;  2YVZ A;  3TE5 C;  3I8N A;  2QRE E;  2D4Z A;  2UV4 A;  1O50 A;  4L0D A;  2NYE A;  1YAV A;  5LXQ A;  5KS7 A;  3KPB A;  3FV6 A;  3KXR A;  4P1O A;  4L28 A;  2OUX A;  4COO A;  3LQN A;  3DDJ A;  3HF7 A;  5MMZ A;  3SL7 A;  5IIP A;  3GBY A;  1PBJ A;  2QR1 E;  2P9M A;  3OCO A;  2RIF A;  2NYC A;  2PFI A;  4FXS A;  4P1G A;  4GQW A;  3KPD A;  2QH1 A;  3K6E A;  2YZQ A;  3ORG A;  3PC2 A;  3PC4 A;  3FNA A; 
#chains in the Genus database with same CATH homology
 2JA3 A;  4L3V A;  3KPC A;  2QLV C;  1Y5H A;  4IY3 A;  4GQV A;  2EF7 A;  4O9K A;  2ZY9 A;  5K22 B;  2OOY E;  3OI8 A;  3L31 A;  4FRY A;  4GQY A;  2UV6 A;  3TDH C;  3KH5 A;  3PC3 A;  4NOC A;  1XKF A;  4IY2 A;  4UUU A;  2YVX A;  4IY4 A;  2OOX E;  2UV5 A;  2J9L A;  3T4N C;  2RIH A;  4IY0 A;  2UV7 A;  5K23 C;  4L27 A;  3FWS A;  2QRC E;  2O16 A;  2QRD E;  3L2B A;  2RC3 A;  3K2V A;  4IYS A;  1PVM A;  5K24 C;  2YZI A;  4ESY A;  4HG0 A;  3OCM A;  4PCU A;  3FHM A;  3LV9 A;  5K25 C;  2EMQ A;  4ESY B;  3LHH A;  2YVY A;  3FWR A;  3LFZ A;  4DQW A;  2YVZ A;  3TE5 C;  3I8N A;  2QRE E;  2D4Z A;  2UV4 A;  1O50 A;  4L0D A;  2NYE A;  1YAV A;  5LXQ A;  5KS7 A;  3KPB A;  3FV6 A;  3KXR A;  4P1O A;  4L28 A;  2OUX A;  4COO A;  3LQN A;  3DDJ A;  3HF7 A;  5MMZ A;  3SL7 A;  5IIP A;  3GBY A;  1PBJ A;  2QR1 E;  2P9M A;  3OCO A;  2RIF A;  2NYC A;  2PFI A;  4FXS A;  4P1G A;  4GQW A;  3KPD A;  2QH1 A;  3K6E A;  2YZQ A;  3ORG A;  3PC2 A;  3PC4 A;  3FNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...