3GBYA

Crystal structure of a protein with unknown function ct1051 from chlorobium tepidum
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
127
structure length
127
Chain Sequence
NASVTFSYLAETDYPVFTLGGSTADAARRLAASGCACAPVLDGERYLGMVHLSRLLEGRKGWPTVKEKLGEELLETVRSYRPGEQLFDNLISVAAAKCSVVPLADEDGRYEGVVSRKRILGFLAERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a protein with unknown function CT1051 from Chlorobium tepidum
rcsb
molecule keywords Uncharacterized protein CT1051
molecule tags Structural genomics, unknown function
source organism Chlorobium tepidum tls
total genus 39
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 3gbyA00
3L31A 5MMZA 3L2BA 2QREE 4ESYA 3FWSA 5IIPA 3LFZA 2O16A 1O50A 2RC3A 2UV5A 4NOCA 2EF7A 2RIFA 2UV4A 4GQYA 2RIHA 4IY2A 5K22B 3FNAA 4L28A 3DDJA 5LXQA 2QRCE 3TDHC 2YVZA 3KPBA 3PC2A 1Y5HA 2YVYA 5K25C 4ESYB 3LV9A 2QR1E 2NYEA 1YAVA 2OUXA 2NYCA 2D4ZA 4PCUA 3SL7A 4DQWA 4O9KA 2QLVC 2ZY9A 3FV6A 2YVXA 2YZQA 3T4NC 2UV7A 3LQNA 2QH1A 3KH5A 2OOXE 2PFIA 4IYSA 3KXRA 4P1OA 3KPDA 4L3VA 4IY0A 3OCOA 5KS7A 2UV6A 3FHMA 3PC3A 4P1GA 4IY4A 4IY3A 1PBJA 4FXSA 2QRDE 3PC4A 3FWRA 3K6EA 3ORGA 3K2VA 2OOYE 3TE5C 4L27A 5K23C 5K24C 4GQWA 4UUUA 1XKFA 3LHHA 3OCMA 4FRYA 3KPCA 2EMQA 4GQVA 4L0DA 4HG0A 3HF7A 2YZIA 3OI8A 3I8NA 1PVMA 3GBYA 4COOA 2P9MA
chains in the Genus database with same CATH superfamily
3L31A 5MMZA 3L2BA 2QREE 4ESYA 3FWSA 5IIPA 3LFZA 2O16A 1O50A 2RC3A 2UV5A 4NOCA 2EF7A 2RIFA 2UV4A 4GQYA 2RIHA 4IY2A 5K22B 3FNAA 4L28A 3DDJA 5LXQA 2QRCE 3TDHC 2YVZA 3KPBA 3PC2A 1Y5HA 2YVYA 5K25C 4ESYB 3LV9A 2QR1E 2NYEA 1YAVA 2OUXA 2NYCA 2D4ZA 4PCUA 3SL7A 4DQWA 4O9KA 2QLVC 2ZY9A 3FV6A 2YVXA 2YZQA 3T4NC 2UV7A 2JA3A 3LQNA 2QH1A 3KH5A 2OOXE 2PFIA 4IYSA 3KXRA 4P1OA 3KPDA 4L3VA 2J9LA 4IY0A 3OCOA 5KS7A 2UV6A 3FHMA 3PC3A 4P1GA 4IY4A 4IY3A 1PBJA 4FXSA 2QRDE 3PC4A 3FWRA 3K6EA 3ORGA 3K2VA 2OOYE 3TE5C 4L27A 5K23C 5K24C 4GQWA 4UUUA 1XKFA 3LHHA 3OCMA 4FRYA 3KPCA 2EMQA 4GQVA 4L0DA 4HG0A 3HF7A 2YZIA 3OI8A 3I8NA 1PVMA 3GBYA 4COOA 2P9MA
chains in the Genus database with same CATH topology
3L31A 5MMZA 3L2BA 2QREE 4ESYA 3FWSA 5IIPA 3LFZA 2O16A 1O50A 2RC3A 2UV5A 4NOCA 2EF7A 2RIFA 2UV4A 4GQYA 2RIHA 4IY2A 5K22B 3FNAA 4L28A 3DDJA 5LXQA 2QRCE 3TDHC 2YVZA 3KPBA 3PC2A 1Y5HA 2YVYA 5K25C 4ESYB 3LV9A 2QR1E 2NYEA 1YAVA 2OUXA 2NYCA 2D4ZA 4PCUA 3SL7A 4DQWA 4O9KA 2QLVC 2ZY9A 3FV6A 2YVXA 2YZQA 3T4NC 2UV7A 2JA3A 3LQNA 2QH1A 3KH5A 2OOXE 2PFIA 4IYSA 3KXRA 4P1OA 3KPDA 4L3VA 2J9LA 4IY0A 3OCOA 5KS7A 2UV6A 3FHMA 3PC3A 4P1GA 4IY4A 4IY3A 1PBJA 4FXSA 2QRDE 3PC4A 3FWRA 3K6EA 3ORGA 3K2VA 2OOYE 3TE5C 4L27A 5K23C 5K24C 4GQWA 4UUUA 1XKFA 3LHHA 3OCMA 4FRYA 3KPCA 2EMQA 4GQVA 4L0DA 4HG0A 3HF7A 2YZIA 3OI8A 3I8NA 1PVMA 3GBYA 4COOA 2P9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L31 A;  5MMZ A;  3L2B A;  2QRE E;  4ESY A;  3FWS A;  5IIP A;  3LFZ A;  2O16 A;  1O50 A;  2RC3 A;  2UV5 A;  4NOC A;  2EF7 A;  2RIF A;  2UV4 A;  4GQY A;  2RIH A;  4IY2 A;  5K22 B;  3FNA A;  4L28 A;  3DDJ A;  5LXQ A;  2QRC E;  3TDH C;  2YVZ A;  3KPB A;  3PC2 A;  1Y5H A;  2YVY A;  5K25 C;  4ESY B;  3LV9 A;  2QR1 E;  2NYE A;  1YAV A;  2OUX A;  2NYC A;  2D4Z A;  4PCU A;  3SL7 A;  4DQW A;  4O9K A;  2QLV C;  2ZY9 A;  3FV6 A;  2YVX A;  2YZQ A;  3T4N C;  2UV7 A;  3LQN A;  2QH1 A;  3KH5 A;  2OOX E;  2PFI A;  4IYS A;  3KXR A;  4P1O A;  3KPD A;  4L3V A;  4IY0 A;  3OCO A;  5KS7 A;  2UV6 A;  3FHM A;  3PC3 A;  4P1G A;  4IY4 A;  4IY3 A;  1PBJ A;  4FXS A;  2QRD E;  3PC4 A;  3FWR A;  3K6E A;  3ORG A;  3K2V A;  2OOY E;  3TE5 C;  4L27 A;  5K23 C;  5K24 C;  4GQW A;  4UUU A;  1XKF A;  3LHH A;  3OCM A;  4FRY A;  3KPC A;  2EMQ A;  4GQV A;  4L0D A;  4HG0 A;  3HF7 A;  2YZI A;  3OI8 A;  3I8N A;  1PVM A;  3GBY A;  4COO A;  2P9M A; 
#chains in the Genus database with same CATH topology
 3L31 A;  5MMZ A;  3L2B A;  2QRE E;  4ESY A;  3FWS A;  5IIP A;  3LFZ A;  2O16 A;  1O50 A;  2RC3 A;  2UV5 A;  4NOC A;  2EF7 A;  2RIF A;  2UV4 A;  4GQY A;  2RIH A;  4IY2 A;  5K22 B;  3FNA A;  4L28 A;  3DDJ A;  5LXQ A;  2QRC E;  3TDH C;  2YVZ A;  3KPB A;  3PC2 A;  1Y5H A;  2YVY A;  5K25 C;  4ESY B;  3LV9 A;  2QR1 E;  2NYE A;  1YAV A;  2OUX A;  2NYC A;  2D4Z A;  4PCU A;  3SL7 A;  4DQW A;  4O9K A;  2QLV C;  2ZY9 A;  3FV6 A;  2YVX A;  2YZQ A;  3T4N C;  2UV7 A;  2JA3 A;  3LQN A;  2QH1 A;  3KH5 A;  2OOX E;  2PFI A;  4IYS A;  3KXR A;  4P1O A;  3KPD A;  4L3V A;  2J9L A;  4IY0 A;  3OCO A;  5KS7 A;  2UV6 A;  3FHM A;  3PC3 A;  4P1G A;  4IY4 A;  4IY3 A;  1PBJ A;  4FXS A;  2QRD E;  3PC4 A;  3FWR A;  3K6E A;  3ORG A;  3K2V A;  2OOY E;  3TE5 C;  4L27 A;  5K23 C;  5K24 C;  4GQW A;  4UUU A;  1XKF A;  3LHH A;  3OCM A;  4FRY A;  3KPC A;  2EMQ A;  4GQV A;  4L0D A;  4HG0 A;  3HF7 A;  2YZI A;  3OI8 A;  3I8N A;  1PVM A;  3GBY A;  4COO A;  2P9M A; 
#chains in the Genus database with same CATH homology
 3L31 A;  5MMZ A;  3L2B A;  2QRE E;  4ESY A;  3FWS A;  5IIP A;  3LFZ A;  2O16 A;  1O50 A;  2RC3 A;  2UV5 A;  4NOC A;  2EF7 A;  2RIF A;  2UV4 A;  4GQY A;  2RIH A;  4IY2 A;  5K22 B;  3FNA A;  4L28 A;  3DDJ A;  5LXQ A;  2QRC E;  3TDH C;  2YVZ A;  3KPB A;  3PC2 A;  1Y5H A;  2YVY A;  5K25 C;  4ESY B;  3LV9 A;  2QR1 E;  2NYE A;  1YAV A;  2OUX A;  2NYC A;  2D4Z A;  4PCU A;  3SL7 A;  4DQW A;  4O9K A;  2QLV C;  2ZY9 A;  3FV6 A;  2YVX A;  2YZQ A;  3T4N C;  2UV7 A;  2JA3 A;  3LQN A;  2QH1 A;  3KH5 A;  2OOX E;  2PFI A;  4IYS A;  3KXR A;  4P1O A;  3KPD A;  4L3V A;  2J9L A;  4IY0 A;  3OCO A;  5KS7 A;  2UV6 A;  3FHM A;  3PC3 A;  4P1G A;  4IY4 A;  4IY3 A;  1PBJ A;  4FXS A;  2QRD E;  3PC4 A;  3FWR A;  3K6E A;  3ORG A;  3K2V A;  2OOY E;  3TE5 C;  4L27 A;  5K23 C;  5K24 C;  4GQW A;  4UUU A;  1XKF A;  3LHH A;  3OCM A;  4FRY A;  3KPC A;  2EMQ A;  4GQV A;  4L0D A;  4HG0 A;  3HF7 A;  2YZI A;  3OI8 A;  3I8N A;  1PVM A;  3GBY A;  4COO A;  2P9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...