5K25C

Crystal structure of human phosphatase prl-2 in complex with the adp-bound bateman domain of human magnesium transporter cnnm3
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
QGPLNMIQGVLELRCRTVEDVLTPLEDCFMLDASTVLDFGVLASIMQSGHTRIPVYEEERSNIVDMLYLKDLAFVDPEDCTPLSTITRFYNHPLHFVFNDTKLDAVLEEFKRGKSHLAIVQKVNNEGEGDPFYEVLGLVTLEDVIEEIIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transporter protein/protein binding
molecule keywords Protein tyrosine phosphatase type IVA 2
publication title PRL3 phosphatase active site is required for binding the putative magnesium transporter CNNM3.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 5k25C00
4NOCA 2PFIA 2QRDE 2EF7A 3KPCA 5KS7A 4DQWA 2YVYA 2QR1E 4HG0A 2UV4A 4P1OA 3LV9A 2YZQA 3PC4A 1O50A 3FV6A 3OI8A 4P1GA 5K22B 2ZY9A 4FXSA 3LFZA 2P9MA 2OOYE 3GBYA 3DDJA 3KH5A 3TDHC 4UUUA 4O9KA 2O16A 2EMQA 3PC2A 3K6EA 2RIFA 4IY4A 3L2BA 3FHMA 4ESYB 3KPDA 4IY2A 3ORGA 4FRYA 5LXQA 4L27A 1Y5HA 3KXRA 3FNAA 3LHHA 3OCMA 2QREE 2NYCA 2UV7A 4PCUA 2YZIA 2YVZA 3LQNA 3TE5C 2UV5A 3I8NA 5MMZA 3OCOA 1YAVA 5K24C 3FWSA 4ESYA 2YVXA 4IY3A 4IYSA 3FWRA 5IIPA 1XKFA 4COOA 4GQVA 3K2VA 1PBJA 1PVMA 2D4ZA 4L0DA 2QLVC 3SL7A 2RIHA 4L28A 2QH1A 3T4NC 2NYEA 5K25C 3KPBA 4IY0A 4GQYA 2OOXE 4GQWA 3L31A 2UV6A 3HF7A 2QRCE 4L3VA 3PC3A 5K23C 2OUXA 2RC3A
chains in the Genus database with same CATH superfamily
4NOCA 2PFIA 2QRDE 2EF7A 3KPCA 5KS7A 4DQWA 2YVYA 2QR1E 4HG0A 2UV4A 4P1OA 3LV9A 2YZQA 3PC4A 1O50A 3FV6A 3OI8A 4P1GA 5K22B 2ZY9A 4FXSA 3LFZA 2P9MA 2OOYE 3GBYA 3DDJA 3KH5A 3TDHC 4UUUA 4O9KA 2O16A 2EMQA 3PC2A 3K6EA 2RIFA 4IY4A 3L2BA 3FHMA 4ESYB 3KPDA 4IY2A 3ORGA 4FRYA 5LXQA 4L27A 1Y5HA 3KXRA 3FNAA 3LHHA 3OCMA 2QREE 2NYCA 2UV7A 4PCUA 2YZIA 2YVZA 3LQNA 3TE5C 2UV5A 3I8NA 5MMZA 2J9LA 3OCOA 1YAVA 5K24C 3FWSA 4ESYA 2YVXA 4IY3A 4IYSA 3FWRA 5IIPA 1XKFA 4COOA 4GQVA 3K2VA 1PBJA 1PVMA 2D4ZA 4L0DA 2QLVC 3SL7A 2RIHA 4L28A 2QH1A 3T4NC 2NYEA 5K25C 3KPBA 4IY0A 4GQYA 2OOXE 4GQWA 3L31A 2JA3A 2UV6A 3HF7A 2QRCE 4L3VA 3PC3A 5K23C 2OUXA 2RC3A
chains in the Genus database with same CATH topology
4NOCA 2PFIA 2QRDE 2EF7A 3KPCA 5KS7A 4DQWA 2YVYA 2QR1E 4HG0A 2UV4A 4P1OA 3LV9A 2YZQA 3PC4A 1O50A 3FV6A 3OI8A 4P1GA 5K22B 2ZY9A 4FXSA 3LFZA 2P9MA 2OOYE 3GBYA 3DDJA 3KH5A 3TDHC 4UUUA 4O9KA 2O16A 2EMQA 3PC2A 3K6EA 2RIFA 4IY4A 3L2BA 3FHMA 4ESYB 3KPDA 4IY2A 3ORGA 4FRYA 5LXQA 4L27A 1Y5HA 3KXRA 3FNAA 3LHHA 3OCMA 2QREE 2NYCA 2UV7A 4PCUA 2YZIA 2YVZA 3LQNA 3TE5C 2UV5A 3I8NA 5MMZA 2J9LA 3OCOA 1YAVA 5K24C 3FWSA 4ESYA 2YVXA 4IY3A 4IYSA 3FWRA 5IIPA 1XKFA 4COOA 4GQVA 3K2VA 1PBJA 1PVMA 2D4ZA 4L0DA 2QLVC 3SL7A 2RIHA 4L28A 2QH1A 3T4NC 2NYEA 5K25C 3KPBA 4IY0A 4GQYA 2OOXE 4GQWA 3L31A 2JA3A 2UV6A 3HF7A 2QRCE 4L3VA 3PC3A 5K23C 2OUXA 2RC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NOC A;  2PFI A;  2QRD E;  2EF7 A;  3KPC A;  5KS7 A;  4DQW A;  2YVY A;  2QR1 E;  4HG0 A;  2UV4 A;  4P1O A;  3LV9 A;  2YZQ A;  3PC4 A;  1O50 A;  3FV6 A;  3OI8 A;  4P1G A;  5K22 B;  2ZY9 A;  4FXS A;  3LFZ A;  2P9M A;  2OOY E;  3GBY A;  3DDJ A;  3KH5 A;  3TDH C;  4UUU A;  4O9K A;  2O16 A;  2EMQ A;  3PC2 A;  3K6E A;  2RIF A;  4IY4 A;  3L2B A;  3FHM A;  4ESY B;  3KPD A;  4IY2 A;  3ORG A;  4FRY A;  5LXQ A;  4L27 A;  1Y5H A;  3KXR A;  3FNA A;  3LHH A;  3OCM A;  2QRE E;  2NYC A;  2UV7 A;  4PCU A;  2YZI A;  2YVZ A;  3LQN A;  3TE5 C;  2UV5 A;  3I8N A;  5MMZ A;  3OCO A;  1YAV A;  5K24 C;  3FWS A;  4ESY A;  2YVX A;  4IY3 A;  4IYS A;  3FWR A;  5IIP A;  1XKF A;  4COO A;  4GQV A;  3K2V A;  1PBJ A;  1PVM A;  2D4Z A;  4L0D A;  2QLV C;  3SL7 A;  2RIH A;  4L28 A;  2QH1 A;  3T4N C;  2NYE A;  5K25 C;  3KPB A;  4IY0 A;  4GQY A;  2OOX E;  4GQW A;  3L31 A;  2UV6 A;  3HF7 A;  2QRC E;  4L3V A;  3PC3 A;  5K23 C;  2OUX A;  2RC3 A; 
#chains in the Genus database with same CATH topology
 4NOC A;  2PFI A;  2QRD E;  2EF7 A;  3KPC A;  5KS7 A;  4DQW A;  2YVY A;  2QR1 E;  4HG0 A;  2UV4 A;  4P1O A;  3LV9 A;  2YZQ A;  3PC4 A;  1O50 A;  3FV6 A;  3OI8 A;  4P1G A;  5K22 B;  2ZY9 A;  4FXS A;  3LFZ A;  2P9M A;  2OOY E;  3GBY A;  3DDJ A;  3KH5 A;  3TDH C;  4UUU A;  4O9K A;  2O16 A;  2EMQ A;  3PC2 A;  3K6E A;  2RIF A;  4IY4 A;  3L2B A;  3FHM A;  4ESY B;  3KPD A;  4IY2 A;  3ORG A;  4FRY A;  5LXQ A;  4L27 A;  1Y5H A;  3KXR A;  3FNA A;  3LHH A;  3OCM A;  2QRE E;  2NYC A;  2UV7 A;  4PCU A;  2YZI A;  2YVZ A;  3LQN A;  3TE5 C;  2UV5 A;  3I8N A;  5MMZ A;  2J9L A;  3OCO A;  1YAV A;  5K24 C;  3FWS A;  4ESY A;  2YVX A;  4IY3 A;  4IYS A;  3FWR A;  5IIP A;  1XKF A;  4COO A;  4GQV A;  3K2V A;  1PBJ A;  1PVM A;  2D4Z A;  4L0D A;  2QLV C;  3SL7 A;  2RIH A;  4L28 A;  2QH1 A;  3T4N C;  2NYE A;  5K25 C;  3KPB A;  4IY0 A;  4GQY A;  2OOX E;  4GQW A;  3L31 A;  2JA3 A;  2UV6 A;  3HF7 A;  2QRC E;  4L3V A;  3PC3 A;  5K23 C;  2OUX A;  2RC3 A; 
#chains in the Genus database with same CATH homology
 4NOC A;  2PFI A;  2QRD E;  2EF7 A;  3KPC A;  5KS7 A;  4DQW A;  2YVY A;  2QR1 E;  4HG0 A;  2UV4 A;  4P1O A;  3LV9 A;  2YZQ A;  3PC4 A;  1O50 A;  3FV6 A;  3OI8 A;  4P1G A;  5K22 B;  2ZY9 A;  4FXS A;  3LFZ A;  2P9M A;  2OOY E;  3GBY A;  3DDJ A;  3KH5 A;  3TDH C;  4UUU A;  4O9K A;  2O16 A;  2EMQ A;  3PC2 A;  3K6E A;  2RIF A;  4IY4 A;  3L2B A;  3FHM A;  4ESY B;  3KPD A;  4IY2 A;  3ORG A;  4FRY A;  5LXQ A;  4L27 A;  1Y5H A;  3KXR A;  3FNA A;  3LHH A;  3OCM A;  2QRE E;  2NYC A;  2UV7 A;  4PCU A;  2YZI A;  2YVZ A;  3LQN A;  3TE5 C;  2UV5 A;  3I8N A;  5MMZ A;  2J9L A;  3OCO A;  1YAV A;  5K24 C;  3FWS A;  4ESY A;  2YVX A;  4IY3 A;  4IYS A;  3FWR A;  5IIP A;  1XKF A;  4COO A;  4GQV A;  3K2V A;  1PBJ A;  1PVM A;  2D4Z A;  4L0D A;  2QLV C;  3SL7 A;  2RIH A;  4L28 A;  2QH1 A;  3T4N C;  2NYE A;  5K25 C;  3KPB A;  4IY0 A;  4GQY A;  2OOX E;  4GQW A;  3L31 A;  2JA3 A;  2UV6 A;  3HF7 A;  2QRC E;  4L3V A;  3PC3 A;  5K23 C;  2OUX A;  2RC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...