2OUXA

Crystal structure of the soluble part of a magnesium transporter
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
257
structure length
257
Chain Sequence
EMEEQFALLLETLKNQQMNEFRELFLALHIYEQGQFYQSLDEKDRQHLYNYLSPKELADMFDVIEEDNENMKDYLAEMRPSYAADMLAEMYTDNAVDLLNMLDKSQKAKYLSLLSSEEAGEIKELLHYEDETAGAIMTTEFVSIVANQTVRSAMYVLKNQADMAETIYYVYVVDQENHLVGVISLRDLIVNDDDTLIADILNERVISVHVGDDQEDVAQTIRDYDFLAVPVTDYDDHLLGIVTVDDIIDVIDDEAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Magnesium transporter
publication title Structural studies on cytosolic domain of magnesium transporter MgtE from Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 77
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
A PF03448 MgtE_N MgtE intracellular N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.60.10 Mainly Alpha Alpha Horseshoe MgtE N-terminal fold MgtE N-terminal domain-like 2ouxA01
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 2ouxA02
3FV6A 1PVMA 2YZIA 2NYEA 2PFIA 4HG0A 3L2BA 2QLVC 4P1GA 3KPBA 4GQWA 1PBJA 4GQVA 4GQYA 1Y5HA 3T4NC 4IY4A 4L3VA 3PC2A 5IIPA 3SL7A 2UV5A 3LV9A 4FRYA 3FWSA 3OCMA 3K6EA 3FHMA 2RIFA 3OCOA 4IY0A 2YZQA 3TE5C 2OOXE 2UV7A 2QRCE 5K24C 3ORGA 3KPCA 3TDHC 3OI8A 3LFZA 2YVZA 4NOCA 5KS7A 3PC4A 1O50A 3KPDA 4UUUA 4ESYB 3PC3A 1YAVA 3KXRA 2QRDE 2ZY9A 4COOA 4L27A 5K25C 4IY2A 3DDJA 5K23C 1XKFA 4FXSA 3LHHA 2EMQA 2YVXA 4IYSA 5LXQA 3FWRA 2QH1A 4IY3A 2OUXA 2EF7A 4L28A 2YVYA 4P1OA 2RIHA 4DQWA 4L0DA 4ESYA 3I8NA 3KH5A 3HF7A 5K22B 2NYCA 3LQNA 2UV6A 3FNAA 4O9KA 2OOYE 4PCUA 3GBYA 5MMZA 2D4ZA 2QREE 2O16A 2UV4A 2RC3A 3L31A 2P9MA 3K2VA 2QR1E
chains in the Genus database with same CATH superfamily
3FV6A 1PVMA 2YZIA 2NYEA 2PFIA 4HG0A 3L2BA 2QLVC 4P1GA 3KPBA 4GQWA 1PBJA 4GQVA 4GQYA 1Y5HA 3T4NC 4IY4A 4L3VA 3PC2A 5IIPA 3SL7A 2UV5A 3LV9A 4FRYA 3FWSA 3OCMA 3K6EA 3FHMA 2RIFA 2JA3A 3OCOA 2YZQA 4IY0A 3TE5C 2OOXE 2UV7A 2QRCE 5K24C 3ORGA 3KPCA 3TDHC 3OI8A 3LFZA 2YVZA 4NOCA 5KS7A 3PC4A 1O50A 3KPDA 4UUUA 4ESYB 3PC3A 1YAVA 3KXRA 2QRDE 2ZY9A 4COOA 4L27A 5K25C 4IY2A 3DDJA 5K23C 1XKFA 4FXSA 3LHHA 2EMQA 2YVXA 4IYSA 5LXQA 3FWRA 2QH1A 4IY3A 2OUXA 2EF7A 4L28A 2YVYA 4P1OA 2RIHA 4DQWA 4L0DA 4ESYA 3I8NA 3KH5A 3HF7A 5K22B 2NYCA 3LQNA 2UV6A 3FNAA 4O9KA 2OOYE 4PCUA 3GBYA 5MMZA 2D4ZA 2QREE 2J9LA 2O16A 2UV4A 2RC3A 3L31A 2P9MA 3K2VA 2QR1E
chains in the Genus database with same CATH topology
3FV6A 1PVMA 2YZIA 2NYEA 2PFIA 4HG0A 3L2BA 2QLVC 4P1GA 3KPBA 4GQWA 1PBJA 4GQVA 4GQYA 1Y5HA 3T4NC 4IY4A 4L3VA 3PC2A 5IIPA 3SL7A 2UV5A 3LV9A 4FRYA 3FWSA 3OCMA 3K6EA 3FHMA 2RIFA 2JA3A 3OCOA 2YZQA 4IY0A 3TE5C 2OOXE 2UV7A 2QRCE 5K24C 3ORGA 3KPCA 3TDHC 3OI8A 3LFZA 2YVZA 4NOCA 5KS7A 3PC4A 1O50A 3KPDA 4UUUA 4ESYB 3PC3A 1YAVA 3KXRA 2QRDE 2ZY9A 4COOA 4L27A 5K25C 4IY2A 3DDJA 5K23C 1XKFA 4FXSA 3LHHA 2EMQA 2YVXA 4IYSA 5LXQA 3FWRA 2QH1A 4IY3A 2OUXA 2EF7A 4L28A 2YVYA 4P1OA 2RIHA 4DQWA 4L0DA 4ESYA 3I8NA 3KH5A 3HF7A 5K22B 2NYCA 3LQNA 2UV6A 3FNAA 4O9KA 2OOYE 4PCUA 3GBYA 5MMZA 2D4ZA 2QREE 2J9LA 2O16A 2UV4A 2RC3A 3L31A 2P9MA 3K2VA 2QR1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FV6 A;  1PVM A;  2YZI A;  2NYE A;  2PFI A;  4HG0 A;  3L2B A;  2QLV C;  4P1G A;  3KPB A;  4GQW A;  1PBJ A;  4GQV A;  4GQY A;  1Y5H A;  3T4N C;  4IY4 A;  4L3V A;  3PC2 A;  5IIP A;  3SL7 A;  2UV5 A;  3LV9 A;  4FRY A;  3FWS A;  3OCM A;  3K6E A;  3FHM A;  2RIF A;  3OCO A;  4IY0 A;  2YZQ A;  3TE5 C;  2OOX E;  2UV7 A;  2QRC E;  5K24 C;  3ORG A;  3KPC A;  3TDH C;  3OI8 A;  3LFZ A;  2YVZ A;  4NOC A;  5KS7 A;  3PC4 A;  1O50 A;  3KPD A;  4UUU A;  4ESY B;  3PC3 A;  1YAV A;  3KXR A;  2QRD E;  2ZY9 A;  4COO A;  4L27 A;  5K25 C;  4IY2 A;  3DDJ A;  5K23 C;  1XKF A;  4FXS A;  3LHH A;  2EMQ A;  2YVX A;  4IYS A;  5LXQ A;  3FWR A;  2QH1 A;  4IY3 A;  2OUX A;  2EF7 A;  4L28 A;  2YVY A;  4P1O A;  2RIH A;  4DQW A;  4L0D A;  4ESY A;  3I8N A;  3KH5 A;  3HF7 A;  5K22 B;  2NYC A;  3LQN A;  2UV6 A;  3FNA A;  4O9K A;  2OOY E;  4PCU A;  3GBY A;  5MMZ A;  2D4Z A;  2QRE E;  2O16 A;  2UV4 A;  2RC3 A;  3L31 A;  2P9M A;  3K2V A;  2QR1 E; 
#chains in the Genus database with same CATH topology
 3FV6 A;  1PVM A;  2YZI A;  2NYE A;  2PFI A;  4HG0 A;  3L2B A;  2QLV C;  4P1G A;  3KPB A;  4GQW A;  1PBJ A;  4GQV A;  4GQY A;  1Y5H A;  3T4N C;  4IY4 A;  4L3V A;  3PC2 A;  5IIP A;  3SL7 A;  2UV5 A;  3LV9 A;  4FRY A;  3FWS A;  3OCM A;  3K6E A;  3FHM A;  2RIF A;  2JA3 A;  3OCO A;  2YZQ A;  4IY0 A;  3TE5 C;  2OOX E;  2UV7 A;  2QRC E;  5K24 C;  3ORG A;  3KPC A;  3TDH C;  3OI8 A;  3LFZ A;  2YVZ A;  4NOC A;  5KS7 A;  3PC4 A;  1O50 A;  3KPD A;  4UUU A;  4ESY B;  3PC3 A;  1YAV A;  3KXR A;  2QRD E;  2ZY9 A;  4COO A;  4L27 A;  5K25 C;  4IY2 A;  3DDJ A;  5K23 C;  1XKF A;  4FXS A;  3LHH A;  2EMQ A;  2YVX A;  4IYS A;  5LXQ A;  3FWR A;  2QH1 A;  4IY3 A;  2OUX A;  2EF7 A;  4L28 A;  2YVY A;  4P1O A;  2RIH A;  4DQW A;  4L0D A;  4ESY A;  3I8N A;  3KH5 A;  3HF7 A;  5K22 B;  2NYC A;  3LQN A;  2UV6 A;  3FNA A;  4O9K A;  2OOY E;  4PCU A;  3GBY A;  5MMZ A;  2D4Z A;  2QRE E;  2J9L A;  2O16 A;  2UV4 A;  2RC3 A;  3L31 A;  2P9M A;  3K2V A;  2QR1 E; 
#chains in the Genus database with same CATH homology
 3FV6 A;  1PVM A;  2YZI A;  2NYE A;  2PFI A;  4HG0 A;  3L2B A;  2QLV C;  4P1G A;  3KPB A;  4GQW A;  1PBJ A;  4GQV A;  4GQY A;  1Y5H A;  3T4N C;  4IY4 A;  4L3V A;  3PC2 A;  5IIP A;  3SL7 A;  2UV5 A;  3LV9 A;  4FRY A;  3FWS A;  3OCM A;  3K6E A;  3FHM A;  2RIF A;  2JA3 A;  3OCO A;  2YZQ A;  4IY0 A;  3TE5 C;  2OOX E;  2UV7 A;  2QRC E;  5K24 C;  3ORG A;  3KPC A;  3TDH C;  3OI8 A;  3LFZ A;  2YVZ A;  4NOC A;  5KS7 A;  3PC4 A;  1O50 A;  3KPD A;  4UUU A;  4ESY B;  3PC3 A;  1YAV A;  3KXR A;  2QRD E;  2ZY9 A;  4COO A;  4L27 A;  5K25 C;  4IY2 A;  3DDJ A;  5K23 C;  1XKF A;  4FXS A;  3LHH A;  2EMQ A;  2YVX A;  4IYS A;  5LXQ A;  3FWR A;  2QH1 A;  4IY3 A;  2OUX A;  2EF7 A;  4L28 A;  2YVY A;  4P1O A;  2RIH A;  4DQW A;  4L0D A;  4ESY A;  3I8N A;  3KH5 A;  3HF7 A;  5K22 B;  2NYC A;  3LQN A;  2UV6 A;  3FNA A;  4O9K A;  2OOY E;  4PCU A;  3GBY A;  5MMZ A;  2D4Z A;  2QRE E;  2J9L A;  2O16 A;  2UV4 A;  2RC3 A;  3L31 A;  2P9M A;  3K2V A;  2QR1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...