2YZIA

Crystal structure of uncharacterized conserved protein from pyrococcus horikoshii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
132
structure length
132
Chain Sequence
MDMKAPIKVYMTKKLLGVKPSTSVQEASRLMMEFDVGSLVVINDDGNVVGFFTKSDIIRRVIVPGLPYDIPVERIMTRNLITANVNTPLGEVLRKMAEHRIKHILIEEEGKIVGIFTLSDLLEASRRRLETA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein PH0107
publication title Crystal structure of uncharacterized conserved protein from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
total genus 34
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 2yziA00
3HF7A 1PVMA 2EMQA 1YAVA 4UUUA 2QR1E 2NYCA 2OOXE 4FXSA 2RIHA 2QH1A 3L31A 3KXRA 5IIPA 2YZQA 4ESYA 4L27A 3OI8A 2O16A 4L0DA 4L28A 2YVXA 4DQWA 3FNAA 4FRYA 3TDHC 3OCMA 2NYEA 5LXQA 4PCUA 3T4NC 4IY4A 3FHMA 3K6EA 3K2VA 3DDJA 4IY3A 3KPBA 2UV5A 3KPDA 2D4ZA 2OOYE 3I8NA 3KH5A 2UV7A 2UV4A 2YVYA 2YZIA 3LV9A 3LHHA 2QRDE 2ZY9A 1XKFA 3KPCA 1PBJA 3FWRA 4GQWA 2PFIA 2RC3A 2EF7A 3PC2A 2OUXA 4L3VA 3TE5C 4P1OA 2RIFA 4IY0A 4NOCA 3FV6A 4GQVA 3L2BA 3PC3A 2QLVC 5K25C 4P1GA 1Y5HA 5K23C 3GBYA 3SL7A 5MMZA 3ORGA 3PC4A 5K22B 2P9MA 4COOA 2QRCE 4ESYB 2QREE 4IY2A 2UV6A 5KS7A 1O50A 3LFZA 4GQYA 5K24C 3LQNA 3OCOA 4O9KA 4HG0A 3FWSA 2YVZA 4IYSA
chains in the Genus database with same CATH superfamily
3HF7A 1PVMA 2EMQA 1YAVA 4UUUA 2QR1E 2NYCA 2OOXE 4FXSA 2RIHA 2QH1A 3L31A 3KXRA 5IIPA 2YZQA 4ESYA 4L27A 3OI8A 2O16A 4L0DA 4L28A 2YVXA 4DQWA 3FNAA 4FRYA 3TDHC 3OCMA 2NYEA 5LXQA 4PCUA 3T4NC 2J9LA 4IY4A 3FHMA 3K6EA 3K2VA 3DDJA 4IY3A 3KPBA 2UV5A 3KPDA 2D4ZA 2OOYE 3I8NA 3KH5A 2UV7A 2UV4A 2YVYA 2YZIA 3LV9A 3LHHA 2QRDE 2ZY9A 1XKFA 3KPCA 1PBJA 3FWRA 4GQWA 2PFIA 2JA3A 2RC3A 2EF7A 3PC2A 2OUXA 4L3VA 3TE5C 4P1OA 2RIFA 4IY0A 4NOCA 3FV6A 4GQVA 3L2BA 3PC3A 2QLVC 5K25C 4P1GA 1Y5HA 5K23C 3GBYA 3SL7A 5MMZA 3ORGA 3PC4A 5K22B 2P9MA 4COOA 2QRCE 4ESYB 2QREE 4IY2A 2UV6A 5KS7A 1O50A 3LFZA 4GQYA 5K24C 3LQNA 3OCOA 4O9KA 4HG0A 3FWSA 2YVZA 4IYSA
chains in the Genus database with same CATH topology
3HF7A 1PVMA 2EMQA 1YAVA 4UUUA 2QR1E 2NYCA 2OOXE 4FXSA 2RIHA 2QH1A 3L31A 3KXRA 5IIPA 2YZQA 4ESYA 4L27A 3OI8A 2O16A 4L0DA 4L28A 2YVXA 4DQWA 3FNAA 4FRYA 3TDHC 3OCMA 2NYEA 5LXQA 4PCUA 3T4NC 2J9LA 4IY4A 3FHMA 3K6EA 3K2VA 3DDJA 4IY3A 3KPBA 2UV5A 3KPDA 2D4ZA 2OOYE 3I8NA 3KH5A 2UV7A 2UV4A 2YVYA 2YZIA 3LV9A 3LHHA 2QRDE 2ZY9A 1XKFA 3KPCA 1PBJA 3FWRA 4GQWA 2PFIA 2JA3A 2RC3A 2EF7A 3PC2A 2OUXA 4L3VA 3TE5C 4P1OA 2RIFA 4IY0A 4NOCA 3FV6A 4GQVA 3L2BA 3PC3A 2QLVC 5K25C 4P1GA 1Y5HA 5K23C 3GBYA 3SL7A 5MMZA 3ORGA 3PC4A 5K22B 2P9MA 4COOA 2QRCE 4ESYB 2QREE 4IY2A 2UV6A 5KS7A 1O50A 3LFZA 4GQYA 5K24C 3LQNA 3OCOA 4O9KA 4HG0A 3FWSA 2YVZA 4IYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HF7 A;  1PVM A;  2EMQ A;  1YAV A;  4UUU A;  2QR1 E;  2NYC A;  2OOX E;  4FXS A;  2RIH A;  2QH1 A;  3L31 A;  3KXR A;  5IIP A;  2YZQ A;  4ESY A;  4L27 A;  3OI8 A;  2O16 A;  4L0D A;  4L28 A;  2YVX A;  4DQW A;  3FNA A;  4FRY A;  3TDH C;  3OCM A;  2NYE A;  5LXQ A;  4PCU A;  3T4N C;  4IY4 A;  3FHM A;  3K6E A;  3K2V A;  3DDJ A;  4IY3 A;  3KPB A;  2UV5 A;  3KPD A;  2D4Z A;  2OOY E;  3I8N A;  3KH5 A;  2UV7 A;  2UV4 A;  2YVY A;  2YZI A;  3LV9 A;  3LHH A;  2QRD E;  2ZY9 A;  1XKF A;  3KPC A;  1PBJ A;  3FWR A;  4GQW A;  2PFI A;  2RC3 A;  2EF7 A;  3PC2 A;  2OUX A;  4L3V A;  3TE5 C;  4P1O A;  2RIF A;  4IY0 A;  4NOC A;  3FV6 A;  4GQV A;  3L2B A;  3PC3 A;  2QLV C;  5K25 C;  4P1G A;  1Y5H A;  5K23 C;  3GBY A;  3SL7 A;  5MMZ A;  3ORG A;  3PC4 A;  5K22 B;  2P9M A;  4COO A;  2QRC E;  4ESY B;  2QRE E;  4IY2 A;  2UV6 A;  5KS7 A;  1O50 A;  3LFZ A;  4GQY A;  5K24 C;  3LQN A;  3OCO A;  4O9K A;  4HG0 A;  3FWS A;  2YVZ A;  4IYS A; 
#chains in the Genus database with same CATH topology
 3HF7 A;  1PVM A;  2EMQ A;  1YAV A;  4UUU A;  2QR1 E;  2NYC A;  2OOX E;  4FXS A;  2RIH A;  2QH1 A;  3L31 A;  3KXR A;  5IIP A;  2YZQ A;  4ESY A;  4L27 A;  3OI8 A;  2O16 A;  4L0D A;  4L28 A;  2YVX A;  4DQW A;  3FNA A;  4FRY A;  3TDH C;  3OCM A;  2NYE A;  5LXQ A;  4PCU A;  3T4N C;  2J9L A;  4IY4 A;  3FHM A;  3K6E A;  3K2V A;  3DDJ A;  4IY3 A;  3KPB A;  2UV5 A;  3KPD A;  2D4Z A;  2OOY E;  3I8N A;  3KH5 A;  2UV7 A;  2UV4 A;  2YVY A;  2YZI A;  3LV9 A;  3LHH A;  2QRD E;  2ZY9 A;  1XKF A;  3KPC A;  1PBJ A;  3FWR A;  4GQW A;  2PFI A;  2JA3 A;  2RC3 A;  2EF7 A;  3PC2 A;  2OUX A;  4L3V A;  3TE5 C;  4P1O A;  2RIF A;  4IY0 A;  4NOC A;  3FV6 A;  4GQV A;  3L2B A;  3PC3 A;  2QLV C;  5K25 C;  4P1G A;  1Y5H A;  5K23 C;  3GBY A;  3SL7 A;  5MMZ A;  3ORG A;  3PC4 A;  5K22 B;  2P9M A;  4COO A;  2QRC E;  4ESY B;  2QRE E;  4IY2 A;  2UV6 A;  5KS7 A;  1O50 A;  3LFZ A;  4GQY A;  5K24 C;  3LQN A;  3OCO A;  4O9K A;  4HG0 A;  3FWS A;  2YVZ A;  4IYS A; 
#chains in the Genus database with same CATH homology
 3HF7 A;  1PVM A;  2EMQ A;  1YAV A;  4UUU A;  2QR1 E;  2NYC A;  2OOX E;  4FXS A;  2RIH A;  2QH1 A;  3L31 A;  3KXR A;  5IIP A;  2YZQ A;  4ESY A;  4L27 A;  3OI8 A;  2O16 A;  4L0D A;  4L28 A;  2YVX A;  4DQW A;  3FNA A;  4FRY A;  3TDH C;  3OCM A;  2NYE A;  5LXQ A;  4PCU A;  3T4N C;  2J9L A;  4IY4 A;  3FHM A;  3K6E A;  3K2V A;  3DDJ A;  4IY3 A;  3KPB A;  2UV5 A;  3KPD A;  2D4Z A;  2OOY E;  3I8N A;  3KH5 A;  2UV7 A;  2UV4 A;  2YVY A;  2YZI A;  3LV9 A;  3LHH A;  2QRD E;  2ZY9 A;  1XKF A;  3KPC A;  1PBJ A;  3FWR A;  4GQW A;  2PFI A;  2JA3 A;  2RC3 A;  2EF7 A;  3PC2 A;  2OUX A;  4L3V A;  3TE5 C;  4P1O A;  2RIF A;  4IY0 A;  4NOC A;  3FV6 A;  4GQV A;  3L2B A;  3PC3 A;  2QLV C;  5K25 C;  4P1G A;  1Y5H A;  5K23 C;  3GBY A;  3SL7 A;  5MMZ A;  3ORG A;  3PC4 A;  5K22 B;  2P9M A;  4COO A;  2QRC E;  4ESY B;  2QRE E;  4IY2 A;  2UV6 A;  5KS7 A;  1O50 A;  3LFZ A;  4GQY A;  5K24 C;  3LQN A;  3OCO A;  4O9K A;  4HG0 A;  3FWS A;  2YVZ A;  4IYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...