3FNAA

Crystal structure of the cbs pair of possible d-arabinose 5-phosphate isomerase yrbh from escherichia coli cft073
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
120
Chain Sequence
LGRKLLLRVNDIMHTGDEIPHVKKTASLRDALLEVTRKNLGMTVICDDNMMIEGIFTDGDLRRVFDRLSIADVMTPGGIRVRPGILAVEALNLMQSRHITSVMVADGDHLLGVLHMHDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The CBS Pair of possible D-arabinose 5-phosphate isomerase yrbH from Escherichia coli CFT073
rcsb
molecule keywords Possible arabinose 5-phosphate isomerase
molecule tags Isomerase
source organism Escherichia coli
total genus 33
structure length 120
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 3fnaA00
2O16A 3SL7A 3FNAA 3OCMA 4L0DA 4ESYB 3LQNA 2QR1E 2D4ZA 2PFIA 3DDJA 2QRDE 2YZIA 2EF7A 2EMQA 1PVMA 4COOA 3K6EA 3L31A 2YVZA 2QH1A 1PBJA 3FWSA 1O50A 2YZQA 3FHMA 4NOCA 3KPCA 2UV6A 2UV4A 4PCUA 3KPDA 2UV7A 5K23C 4IY0A 4FRYA 5K25C 3L2BA 3FV6A 4L27A 3ORGA 4IY3A 3OCOA 4P1OA 4ESYA 2ZY9A 2YVYA 2QRCE 2YVXA 4FXSA 5KS7A 5K24C 5IIPA 3OI8A 3T4NC 3GBYA 3HF7A 3LFZA 4IY4A 3KXRA 2NYEA 3I8NA 2QREE 4IY2A 5LXQA 3TDHC 5K22B 3KH5A 1XKFA 3LHHA 2OOYE 1YAVA 2QLVC 1Y5HA 3KPBA 4GQYA 3PC3A 3LV9A 5MMZA 2RIHA 3PC2A 4P1GA 2OOXE 4O9KA 2P9MA 2OUXA 4IYSA 4HG0A 3TE5C 4UUUA 4DQWA 2UV5A 2NYCA 2RC3A 4L28A 2RIFA 3PC4A 3K2VA 4GQVA 3FWRA 4L3VA 4GQWA
chains in the Genus database with same CATH superfamily
2O16A 3SL7A 3FNAA 3OCMA 4L0DA 4ESYB 3LQNA 2QR1E 2D4ZA 2PFIA 3DDJA 2QRDE 2YZIA 2EF7A 2EMQA 1PVMA 4COOA 3K6EA 3L31A 2YVZA 2QH1A 1PBJA 3FWSA 1O50A 2YZQA 3FHMA 4NOCA 3KPCA 2UV6A 2UV4A 4PCUA 3KPDA 2UV7A 5K23C 4IY0A 4FRYA 5K25C 3L2BA 3FV6A 4L27A 3ORGA 4IY3A 3OCOA 4P1OA 4ESYA 2ZY9A 2YVYA 2QRCE 2YVXA 4FXSA 5KS7A 5K24C 5IIPA 3OI8A 3T4NC 3GBYA 3HF7A 3LFZA 4IY4A 3KXRA 2NYEA 3I8NA 2QREE 4IY2A 5LXQA 3TDHC 5K22B 3KH5A 1XKFA 3LHHA 2JA3A 2OOYE 1YAVA 2QLVC 1Y5HA 3KPBA 4GQYA 3PC3A 3LV9A 5MMZA 2J9LA 2RIHA 3PC2A 4P1GA 2OOXE 4O9KA 2P9MA 2OUXA 4IYSA 4HG0A 3TE5C 4UUUA 4DQWA 2UV5A 2NYCA 2RC3A 4L28A 2RIFA 3PC4A 3K2VA 4GQVA 3FWRA 4L3VA 4GQWA
chains in the Genus database with same CATH topology
2O16A 3SL7A 3FNAA 3OCMA 4L0DA 4ESYB 3LQNA 2QR1E 2D4ZA 2PFIA 3DDJA 2QRDE 2YZIA 2EF7A 2EMQA 1PVMA 4COOA 3K6EA 3L31A 2YVZA 2QH1A 1PBJA 3FWSA 1O50A 2YZQA 3FHMA 4NOCA 3KPCA 2UV6A 2UV4A 4PCUA 3KPDA 2UV7A 5K23C 4IY0A 4FRYA 5K25C 3L2BA 3FV6A 4L27A 3ORGA 4IY3A 3OCOA 4P1OA 4ESYA 2ZY9A 2YVYA 2QRCE 2YVXA 4FXSA 5KS7A 5K24C 5IIPA 3OI8A 3T4NC 3GBYA 3HF7A 3LFZA 4IY4A 3KXRA 2NYEA 3I8NA 2QREE 4IY2A 5LXQA 3TDHC 5K22B 3KH5A 1XKFA 3LHHA 2JA3A 2OOYE 1YAVA 2QLVC 1Y5HA 3KPBA 4GQYA 3PC3A 3LV9A 5MMZA 2J9LA 2RIHA 3PC2A 4P1GA 2OOXE 4O9KA 2P9MA 2OUXA 4IYSA 4HG0A 3TE5C 4UUUA 4DQWA 2UV5A 2NYCA 2RC3A 4L28A 2RIFA 3PC4A 3K2VA 4GQVA 3FWRA 4L3VA 4GQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O16 A;  3SL7 A;  3FNA A;  3OCM A;  4L0D A;  4ESY B;  3LQN A;  2QR1 E;  2D4Z A;  2PFI A;  3DDJ A;  2QRD E;  2YZI A;  2EF7 A;  2EMQ A;  1PVM A;  4COO A;  3K6E A;  3L31 A;  2YVZ A;  2QH1 A;  1PBJ A;  3FWS A;  1O50 A;  2YZQ A;  3FHM A;  4NOC A;  3KPC A;  2UV6 A;  2UV4 A;  4PCU A;  3KPD A;  2UV7 A;  5K23 C;  4IY0 A;  4FRY A;  5K25 C;  3L2B A;  3FV6 A;  4L27 A;  3ORG A;  4IY3 A;  3OCO A;  4P1O A;  4ESY A;  2ZY9 A;  2YVY A;  2QRC E;  2YVX A;  4FXS A;  5KS7 A;  5K24 C;  5IIP A;  3OI8 A;  3T4N C;  3GBY A;  3HF7 A;  3LFZ A;  4IY4 A;  3KXR A;  2NYE A;  3I8N A;  2QRE E;  4IY2 A;  5LXQ A;  3TDH C;  5K22 B;  3KH5 A;  1XKF A;  3LHH A;  2OOY E;  1YAV A;  2QLV C;  1Y5H A;  3KPB A;  4GQY A;  3PC3 A;  3LV9 A;  5MMZ A;  2RIH A;  3PC2 A;  4P1G A;  2OOX E;  4O9K A;  2P9M A;  2OUX A;  4IYS A;  4HG0 A;  3TE5 C;  4UUU A;  4DQW A;  2UV5 A;  2NYC A;  2RC3 A;  4L28 A;  2RIF A;  3PC4 A;  3K2V A;  4GQV A;  3FWR A;  4L3V A;  4GQW A; 
#chains in the Genus database with same CATH topology
 2O16 A;  3SL7 A;  3FNA A;  3OCM A;  4L0D A;  4ESY B;  3LQN A;  2QR1 E;  2D4Z A;  2PFI A;  3DDJ A;  2QRD E;  2YZI A;  2EF7 A;  2EMQ A;  1PVM A;  4COO A;  3K6E A;  3L31 A;  2YVZ A;  2QH1 A;  1PBJ A;  3FWS A;  1O50 A;  2YZQ A;  3FHM A;  4NOC A;  3KPC A;  2UV6 A;  2UV4 A;  4PCU A;  3KPD A;  2UV7 A;  5K23 C;  4IY0 A;  4FRY A;  5K25 C;  3L2B A;  3FV6 A;  4L27 A;  3ORG A;  4IY3 A;  3OCO A;  4P1O A;  4ESY A;  2ZY9 A;  2YVY A;  2QRC E;  2YVX A;  4FXS A;  5KS7 A;  5K24 C;  5IIP A;  3OI8 A;  3T4N C;  3GBY A;  3HF7 A;  3LFZ A;  4IY4 A;  3KXR A;  2NYE A;  3I8N A;  2QRE E;  4IY2 A;  5LXQ A;  3TDH C;  5K22 B;  3KH5 A;  1XKF A;  3LHH A;  2JA3 A;  2OOY E;  1YAV A;  2QLV C;  1Y5H A;  3KPB A;  4GQY A;  3PC3 A;  3LV9 A;  5MMZ A;  2J9L A;  2RIH A;  3PC2 A;  4P1G A;  2OOX E;  4O9K A;  2P9M A;  2OUX A;  4IYS A;  4HG0 A;  3TE5 C;  4UUU A;  4DQW A;  2UV5 A;  2NYC A;  2RC3 A;  4L28 A;  2RIF A;  3PC4 A;  3K2V A;  4GQV A;  3FWR A;  4L3V A;  4GQW A; 
#chains in the Genus database with same CATH homology
 2O16 A;  3SL7 A;  3FNA A;  3OCM A;  4L0D A;  4ESY B;  3LQN A;  2QR1 E;  2D4Z A;  2PFI A;  3DDJ A;  2QRD E;  2YZI A;  2EF7 A;  2EMQ A;  1PVM A;  4COO A;  3K6E A;  3L31 A;  2YVZ A;  2QH1 A;  1PBJ A;  3FWS A;  1O50 A;  2YZQ A;  3FHM A;  4NOC A;  3KPC A;  2UV6 A;  2UV4 A;  4PCU A;  3KPD A;  2UV7 A;  5K23 C;  4IY0 A;  4FRY A;  5K25 C;  3L2B A;  3FV6 A;  4L27 A;  3ORG A;  4IY3 A;  3OCO A;  4P1O A;  4ESY A;  2ZY9 A;  2YVY A;  2QRC E;  2YVX A;  4FXS A;  5KS7 A;  5K24 C;  5IIP A;  3OI8 A;  3T4N C;  3GBY A;  3HF7 A;  3LFZ A;  4IY4 A;  3KXR A;  2NYE A;  3I8N A;  2QRE E;  4IY2 A;  5LXQ A;  3TDH C;  5K22 B;  3KH5 A;  1XKF A;  3LHH A;  2JA3 A;  2OOY E;  1YAV A;  2QLV C;  1Y5H A;  3KPB A;  4GQY A;  3PC3 A;  3LV9 A;  5MMZ A;  2J9L A;  2RIH A;  3PC2 A;  4P1G A;  2OOX E;  4O9K A;  2P9M A;  2OUX A;  4IYS A;  4HG0 A;  3TE5 C;  4UUU A;  4DQW A;  2UV5 A;  2NYC A;  2RC3 A;  4L28 A;  2RIF A;  3PC4 A;  3K2V A;  4GQV A;  3FWR A;  4L3V A;  4GQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...