2UV5A

Crystal structure of a cbs domain pair from the regulatory gamma1 subunit of human ampk in complex with amp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
143
structure length
143
Chain Sequence
HEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords 5'-AMP-ACTIVATED PROTEIN KINASE SUBUNIT GAMMA-1
publication title Structure of a Cbs-Domain Pair from the Regulatory Gamma1 Subunit of Human Ampk in Complex with AMP and Zmp.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2007-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 2uv5A00
3K6EA 1PVMA 5KS7A 3K2VA 2UV6A 3LV9A 2YVZA 2O16A 5K25C 5MMZA 2NYEA 3KPDA 3ORGA 5K24C 1Y5HA 5K22B 4DQWA 3PC4A 3PC3A 4UUUA 2RIHA 3L31A 2QR1E 4P1GA 2OOXE 3FWSA 4FXSA 4L28A 4IYSA 2QREE 4ESYA 2EF7A 5IIPA 4GQYA 2YZQA 1O50A 4NOCA 2UV7A 4GQWA 3T4NC 4IY3A 3KH5A 2P9MA 2YVYA 3DDJA 3L2BA 3KPCA 1XKFA 2YVXA 1YAVA 3FNAA 5LXQA 2QH1A 2PFIA 3FWRA 4IY2A 4HG0A 2D4ZA 3TDHC 3LQNA 4COOA 4L27A 2OOYE 2NYCA 2OUXA 4L0DA 4PCUA 4FRYA 3FV6A 2UV4A 2YZIA 2EMQA 2UV5A 3OCOA 3PC2A 2QLVC 2ZY9A 4P1OA 3GBYA 1PBJA 3SL7A 4ESYB 3OCMA 3KPBA 3FHMA 2RIFA 3HF7A 5K23C 2QRDE 2QRCE 3TE5C 4GQVA 4O9KA 3KXRA 4IY0A 4L3VA 3LFZA 3LHHA 3OI8A 4IY4A 3I8NA 2RC3A
chains in the Genus database with same CATH superfamily
3K6EA 1PVMA 5KS7A 3K2VA 2UV6A 3LV9A 2YVZA 2O16A 5K25C 5MMZA 2NYEA 3KPDA 3ORGA 5K24C 1Y5HA 2J9LA 5K22B 4DQWA 2JA3A 3PC4A 3PC3A 4UUUA 2RIHA 3L31A 2QR1E 4P1GA 2OOXE 3FWSA 4FXSA 4L28A 4IYSA 2QREE 4ESYA 2EF7A 5IIPA 4GQYA 2YZQA 1O50A 4NOCA 2UV7A 4GQWA 3T4NC 4IY3A 3KH5A 2P9MA 2YVYA 3DDJA 3L2BA 3KPCA 1XKFA 2YVXA 1YAVA 3FNAA 5LXQA 2QH1A 2PFIA 3FWRA 4IY2A 4HG0A 2D4ZA 3TDHC 3LQNA 4COOA 4L27A 2OOYE 2NYCA 2OUXA 4L0DA 4PCUA 4FRYA 3FV6A 2UV4A 2YZIA 2EMQA 2UV5A 3OCOA 3PC2A 2QLVC 2ZY9A 4P1OA 3GBYA 1PBJA 3SL7A 4ESYB 3OCMA 3KPBA 3FHMA 2RIFA 3HF7A 5K23C 2QRDE 2QRCE 3TE5C 4GQVA 4O9KA 3KXRA 4IY0A 4L3VA 3LFZA 3LHHA 3OI8A 4IY4A 3I8NA 2RC3A
chains in the Genus database with same CATH topology
3K6EA 1PVMA 5KS7A 3K2VA 2UV6A 3LV9A 2YVZA 2O16A 5K25C 5MMZA 2NYEA 3KPDA 3ORGA 5K24C 1Y5HA 2J9LA 5K22B 4DQWA 2JA3A 3PC4A 3PC3A 4UUUA 2RIHA 3L31A 2QR1E 4P1GA 2OOXE 3FWSA 4FXSA 4L28A 4IYSA 2QREE 4ESYA 2EF7A 5IIPA 4GQYA 2YZQA 1O50A 4NOCA 2UV7A 4GQWA 3T4NC 4IY3A 3KH5A 2P9MA 2YVYA 3DDJA 3L2BA 3KPCA 1XKFA 2YVXA 1YAVA 3FNAA 5LXQA 2QH1A 2PFIA 3FWRA 4IY2A 4HG0A 2D4ZA 3TDHC 3LQNA 4COOA 4L27A 2OOYE 2NYCA 2OUXA 4L0DA 4PCUA 4FRYA 3FV6A 2UV4A 2YZIA 2EMQA 2UV5A 3OCOA 3PC2A 2QLVC 2ZY9A 4P1OA 3GBYA 1PBJA 3SL7A 4ESYB 3OCMA 3KPBA 3FHMA 2RIFA 3HF7A 5K23C 2QRDE 2QRCE 3TE5C 4GQVA 4O9KA 3KXRA 4IY0A 4L3VA 3LFZA 3LHHA 3OI8A 4IY4A 3I8NA 2RC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K6E A;  1PVM A;  5KS7 A;  3K2V A;  2UV6 A;  3LV9 A;  2YVZ A;  2O16 A;  5K25 C;  5MMZ A;  2NYE A;  3KPD A;  3ORG A;  5K24 C;  1Y5H A;  5K22 B;  4DQW A;  3PC4 A;  3PC3 A;  4UUU A;  2RIH A;  3L31 A;  2QR1 E;  4P1G A;  2OOX E;  3FWS A;  4FXS A;  4L28 A;  4IYS A;  2QRE E;  4ESY A;  2EF7 A;  5IIP A;  4GQY A;  2YZQ A;  1O50 A;  4NOC A;  2UV7 A;  4GQW A;  3T4N C;  4IY3 A;  3KH5 A;  2P9M A;  2YVY A;  3DDJ A;  3L2B A;  3KPC A;  1XKF A;  2YVX A;  1YAV A;  3FNA A;  5LXQ A;  2QH1 A;  2PFI A;  3FWR A;  4IY2 A;  4HG0 A;  2D4Z A;  3TDH C;  3LQN A;  4COO A;  4L27 A;  2OOY E;  2NYC A;  2OUX A;  4L0D A;  4PCU A;  4FRY A;  3FV6 A;  2UV4 A;  2YZI A;  2EMQ A;  2UV5 A;  3OCO A;  3PC2 A;  2QLV C;  2ZY9 A;  4P1O A;  3GBY A;  1PBJ A;  3SL7 A;  4ESY B;  3OCM A;  3KPB A;  3FHM A;  2RIF A;  3HF7 A;  5K23 C;  2QRD E;  2QRC E;  3TE5 C;  4GQV A;  4O9K A;  3KXR A;  4IY0 A;  4L3V A;  3LFZ A;  3LHH A;  3OI8 A;  4IY4 A;  3I8N A;  2RC3 A; 
#chains in the Genus database with same CATH topology
 3K6E A;  1PVM A;  5KS7 A;  3K2V A;  2UV6 A;  3LV9 A;  2YVZ A;  2O16 A;  5K25 C;  5MMZ A;  2NYE A;  3KPD A;  3ORG A;  5K24 C;  1Y5H A;  2J9L A;  5K22 B;  4DQW A;  2JA3 A;  3PC4 A;  3PC3 A;  4UUU A;  2RIH A;  3L31 A;  2QR1 E;  4P1G A;  2OOX E;  3FWS A;  4FXS A;  4L28 A;  4IYS A;  2QRE E;  4ESY A;  2EF7 A;  5IIP A;  4GQY A;  2YZQ A;  1O50 A;  4NOC A;  2UV7 A;  4GQW A;  3T4N C;  4IY3 A;  3KH5 A;  2P9M A;  2YVY A;  3DDJ A;  3L2B A;  3KPC A;  1XKF A;  2YVX A;  1YAV A;  3FNA A;  5LXQ A;  2QH1 A;  2PFI A;  3FWR A;  4IY2 A;  4HG0 A;  2D4Z A;  3TDH C;  3LQN A;  4COO A;  4L27 A;  2OOY E;  2NYC A;  2OUX A;  4L0D A;  4PCU A;  4FRY A;  3FV6 A;  2UV4 A;  2YZI A;  2EMQ A;  2UV5 A;  3OCO A;  3PC2 A;  2QLV C;  2ZY9 A;  4P1O A;  3GBY A;  1PBJ A;  3SL7 A;  4ESY B;  3OCM A;  3KPB A;  3FHM A;  2RIF A;  3HF7 A;  5K23 C;  2QRD E;  2QRC E;  3TE5 C;  4GQV A;  4O9K A;  3KXR A;  4IY0 A;  4L3V A;  3LFZ A;  3LHH A;  3OI8 A;  4IY4 A;  3I8N A;  2RC3 A; 
#chains in the Genus database with same CATH homology
 3K6E A;  1PVM A;  5KS7 A;  3K2V A;  2UV6 A;  3LV9 A;  2YVZ A;  2O16 A;  5K25 C;  5MMZ A;  2NYE A;  3KPD A;  3ORG A;  5K24 C;  1Y5H A;  2J9L A;  5K22 B;  4DQW A;  2JA3 A;  3PC4 A;  3PC3 A;  4UUU A;  2RIH A;  3L31 A;  2QR1 E;  4P1G A;  2OOX E;  3FWS A;  4FXS A;  4L28 A;  4IYS A;  2QRE E;  4ESY A;  2EF7 A;  5IIP A;  4GQY A;  2YZQ A;  1O50 A;  4NOC A;  2UV7 A;  4GQW A;  3T4N C;  4IY3 A;  3KH5 A;  2P9M A;  2YVY A;  3DDJ A;  3L2B A;  3KPC A;  1XKF A;  2YVX A;  1YAV A;  3FNA A;  5LXQ A;  2QH1 A;  2PFI A;  3FWR A;  4IY2 A;  4HG0 A;  2D4Z A;  3TDH C;  3LQN A;  4COO A;  4L27 A;  2OOY E;  2NYC A;  2OUX A;  4L0D A;  4PCU A;  4FRY A;  3FV6 A;  2UV4 A;  2YZI A;  2EMQ A;  2UV5 A;  3OCO A;  3PC2 A;  2QLV C;  2ZY9 A;  4P1O A;  3GBY A;  1PBJ A;  3SL7 A;  4ESY B;  3OCM A;  3KPB A;  3FHM A;  2RIF A;  3HF7 A;  5K23 C;  2QRD E;  2QRC E;  3TE5 C;  4GQV A;  4O9K A;  3KXR A;  4IY0 A;  4L3V A;  3LFZ A;  3LHH A;  3OI8 A;  4IY4 A;  3I8N A;  2RC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...