2UV7A

Crystal structure of a cbs domain pair from the regulatory gamma1 subunit of human ampk in complex with amp
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
143
structure length
143
Chain Sequence
HEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHGLVVVDENDVVKGIVSLSDILQALV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a Cbs-Domain Pair from the Regulatory Gamma1 Subunit of Human Ampk in Complex with AMP and Zmp.
pubmed doi rcsb
molecule keywords 5'-AMP-ACTIVATED PROTEIN KINASE SUBUNIT GAMMA-1
molecule tags Transferase
source organism Homo sapiens
total genus 39
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2007-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 2uv7A00
3FHMA 2ZY9A 4IY3A 2QREE 2UV5A 2QH1A 3KPBA 5K22B 4GQYA 3TDHC 4FXSA 3FWSA 1O50A 5IIPA 3TE5C 2UV7A 3KH5A 3LFZA 4UUUA 1PVMA 4IY0A 5K23C 2O16A 2D4ZA 2YVXA 3DDJA 4DQWA 3K2VA 3ORGA 4IY2A 3LHHA 1YAVA 2YZQA 2EF7A 2RIFA 1XKFA 2YVZA 4IYSA 3L2BA 2YZIA 3LV9A 1PBJA 4NOCA 5MMZA 5LXQA 4GQWA 2NYCA 2RC3A 2QRDE 4L28A 3T4NC 5K24C 4HG0A 2OUXA 2RIHA 5KS7A 1Y5HA 4FRYA 3SL7A 3OI8A 2YVYA 3PC4A 3HF7A 4PCUA 2EMQA 3FV6A 3FWRA 4L27A 4COOA 4GQVA 4ESYA 3I8NA 4IY4A 4O9KA 4L0DA 2PFIA 3OCMA 3KPCA 4P1OA 2QRCE 2UV6A 4P1GA 2UV4A 5K25C 4ESYB 3L31A 3GBYA 2QLVC 3OCOA 4L3VA 2OOXE 3PC2A 3KXRA 2QR1E 3LQNA 2P9MA 3PC3A 3FNAA 3K6EA 3KPDA 2NYEA 2OOYE
chains in the Genus database with same CATH superfamily
3FHMA 2ZY9A 4IY3A 2QREE 2UV5A 2QH1A 3KPBA 5K22B 4GQYA 3TDHC 4FXSA 3FWSA 1O50A 5IIPA 3TE5C 2UV7A 3KH5A 3LFZA 4UUUA 1PVMA 4IY0A 5K23C 2O16A 2D4ZA 2YVXA 3DDJA 4DQWA 3K2VA 3ORGA 4IY2A 3LHHA 1YAVA 2YZQA 2EF7A 2RIFA 1XKFA 2J9LA 2YVZA 4IYSA 3L2BA 2YZIA 3LV9A 1PBJA 4NOCA 5MMZA 5LXQA 4GQWA 2NYCA 2RC3A 2QRDE 4L28A 3T4NC 5K24C 4HG0A 2OUXA 2RIHA 5KS7A 1Y5HA 4FRYA 3SL7A 3OI8A 2YVYA 3PC4A 3HF7A 4PCUA 2EMQA 3FV6A 3FWRA 4L27A 4COOA 4GQVA 4ESYA 3I8NA 4IY4A 4O9KA 4L0DA 2PFIA 3OCMA 3KPCA 4P1OA 2QRCE 2UV6A 4P1GA 2UV4A 5K25C 4ESYB 3L31A 3GBYA 2QLVC 3OCOA 4L3VA 2OOXE 2OOYE 3PC2A 3KXRA 2QR1E 3LQNA 2P9MA 3PC3A 3FNAA 3K6EA 3KPDA 2NYEA 2JA3A
chains in the Genus database with same CATH topology
3FHMA 2ZY9A 4IY3A 2QREE 2UV5A 2QH1A 3KPBA 5K22B 4GQYA 3TDHC 4FXSA 3FWSA 1O50A 5IIPA 3TE5C 2UV7A 3KH5A 3LFZA 4UUUA 1PVMA 4IY0A 5K23C 2O16A 2D4ZA 2YVXA 3DDJA 4DQWA 3K2VA 3ORGA 4IY2A 3LHHA 1YAVA 2YZQA 2EF7A 2RIFA 1XKFA 2J9LA 2YVZA 4IYSA 3L2BA 2YZIA 3LV9A 1PBJA 4NOCA 5MMZA 5LXQA 4GQWA 2NYCA 2RC3A 2QRDE 4L28A 3T4NC 5K24C 4HG0A 2OUXA 2RIHA 5KS7A 1Y5HA 4FRYA 3SL7A 3OI8A 2YVYA 3PC4A 3HF7A 4PCUA 2EMQA 3FV6A 3FWRA 4L27A 4COOA 4GQVA 4ESYA 3I8NA 4IY4A 4O9KA 4L0DA 2PFIA 3OCMA 3KPCA 4P1OA 2QRCE 2UV6A 4P1GA 2UV4A 5K25C 4ESYB 3L31A 3GBYA 2QLVC 3OCOA 4L3VA 2OOXE 2OOYE 3PC2A 3KXRA 2QR1E 3LQNA 2P9MA 3PC3A 3FNAA 3K6EA 3KPDA 2NYEA 2JA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FHM A;  2ZY9 A;  4IY3 A;  2QRE E;  2UV5 A;  2QH1 A;  3KPB A;  5K22 B;  4GQY A;  3TDH C;  4FXS A;  3FWS A;  1O50 A;  5IIP A;  3TE5 C;  2UV7 A;  3KH5 A;  3LFZ A;  4UUU A;  1PVM A;  4IY0 A;  5K23 C;  2O16 A;  2D4Z A;  2YVX A;  3DDJ A;  4DQW A;  3K2V A;  3ORG A;  4IY2 A;  3LHH A;  1YAV A;  2YZQ A;  2EF7 A;  2RIF A;  1XKF A;  2YVZ A;  4IYS A;  3L2B A;  2YZI A;  3LV9 A;  1PBJ A;  4NOC A;  5MMZ A;  5LXQ A;  4GQW A;  2NYC A;  2RC3 A;  2QRD E;  4L28 A;  3T4N C;  5K24 C;  4HG0 A;  2OUX A;  2RIH A;  5KS7 A;  1Y5H A;  4FRY A;  3SL7 A;  3OI8 A;  2YVY A;  3PC4 A;  3HF7 A;  4PCU A;  2EMQ A;  3FV6 A;  3FWR A;  4L27 A;  4COO A;  4GQV A;  4ESY A;  3I8N A;  4IY4 A;  4O9K A;  4L0D A;  2PFI A;  3OCM A;  3KPC A;  4P1O A;  2QRC E;  2UV6 A;  4P1G A;  2UV4 A;  5K25 C;  4ESY B;  3L31 A;  3GBY A;  2QLV C;  3OCO A;  4L3V A;  2OOX E;  3PC2 A;  3KXR A;  2QR1 E;  3LQN A;  2P9M A;  3PC3 A;  3FNA A;  3K6E A;  3KPD A;  2NYE A;  2OOY E; 
#chains in the Genus database with same CATH topology
 3FHM A;  2ZY9 A;  4IY3 A;  2QRE E;  2UV5 A;  2QH1 A;  3KPB A;  5K22 B;  4GQY A;  3TDH C;  4FXS A;  3FWS A;  1O50 A;  5IIP A;  3TE5 C;  2UV7 A;  3KH5 A;  3LFZ A;  4UUU A;  1PVM A;  4IY0 A;  5K23 C;  2O16 A;  2D4Z A;  2YVX A;  3DDJ A;  4DQW A;  3K2V A;  3ORG A;  4IY2 A;  3LHH A;  1YAV A;  2YZQ A;  2EF7 A;  2RIF A;  1XKF A;  2J9L A;  2YVZ A;  4IYS A;  3L2B A;  2YZI A;  3LV9 A;  1PBJ A;  4NOC A;  5MMZ A;  5LXQ A;  4GQW A;  2NYC A;  2RC3 A;  2QRD E;  4L28 A;  3T4N C;  5K24 C;  4HG0 A;  2OUX A;  2RIH A;  5KS7 A;  1Y5H A;  4FRY A;  3SL7 A;  3OI8 A;  2YVY A;  3PC4 A;  3HF7 A;  4PCU A;  2EMQ A;  3FV6 A;  3FWR A;  4L27 A;  4COO A;  4GQV A;  4ESY A;  3I8N A;  4IY4 A;  4O9K A;  4L0D A;  2PFI A;  3OCM A;  3KPC A;  4P1O A;  2QRC E;  2UV6 A;  4P1G A;  2UV4 A;  5K25 C;  4ESY B;  3L31 A;  3GBY A;  2QLV C;  3OCO A;  4L3V A;  2OOX E;  2OOY E;  3PC2 A;  3KXR A;  2QR1 E;  3LQN A;  2P9M A;  3PC3 A;  3FNA A;  3K6E A;  3KPD A;  2NYE A;  2JA3 A; 
#chains in the Genus database with same CATH homology
 3FHM A;  2ZY9 A;  4IY3 A;  2QRE E;  2UV5 A;  2QH1 A;  3KPB A;  5K22 B;  4GQY A;  3TDH C;  4FXS A;  3FWS A;  1O50 A;  5IIP A;  3TE5 C;  2UV7 A;  3KH5 A;  3LFZ A;  4UUU A;  1PVM A;  4IY0 A;  5K23 C;  2O16 A;  2D4Z A;  2YVX A;  3DDJ A;  4DQW A;  3K2V A;  3ORG A;  4IY2 A;  3LHH A;  1YAV A;  2YZQ A;  2EF7 A;  2RIF A;  1XKF A;  2J9L A;  2YVZ A;  4IYS A;  3L2B A;  2YZI A;  3LV9 A;  1PBJ A;  4NOC A;  5MMZ A;  5LXQ A;  4GQW A;  2NYC A;  2RC3 A;  2QRD E;  4L28 A;  3T4N C;  5K24 C;  4HG0 A;  2OUX A;  2RIH A;  5KS7 A;  1Y5H A;  4FRY A;  3SL7 A;  3OI8 A;  2YVY A;  3PC4 A;  3HF7 A;  4PCU A;  2EMQ A;  3FV6 A;  3FWR A;  4L27 A;  4COO A;  4GQV A;  4ESY A;  3I8N A;  4IY4 A;  4O9K A;  4L0D A;  2PFI A;  3OCM A;  3KPC A;  4P1O A;  2QRC E;  2UV6 A;  4P1G A;  2UV4 A;  5K25 C;  4ESY B;  3L31 A;  3GBY A;  2QLV C;  3OCO A;  4L3V A;  2OOX E;  2OOY E;  3PC2 A;  3KXR A;  2QR1 E;  3LQN A;  2P9M A;  3PC3 A;  3FNA A;  3K6E A;  3KPD A;  2NYE A;  2JA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...