4L27A

Crystal structure of delta1-39 and delta516-525 human cystathionine beta-synthase d444n mutant containing c-terminal 6xhis tag
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
499
structure length
485
Chain Sequence
PLWIRPDAPSRCTWQLGRSESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEEKKPWWWHLRVQELGLSAPLTVLITCGTIEILREKGFNQAPVVDEILGMVTLGNMLSSLLAGKVQPSDVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHERQMVFGVVTAIDLLNFVAAQERD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Cystathionine beta-synthase
publication title Structural basis of regulation and oligomerization of human cystathionine beta-synthase, the central enzyme of transsulfuration.
pubmed doi rcsb
source organism Homo sapiens
total genus 159
structure length 485
sequence length 499
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.22: Cystathionine beta-synthase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 4l27A03
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l27A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l27A02
3DWIA 4IY3A 5JISA 5DBHX 4D96A 3L2BA 2YVZA 1KFKB 5D86A 5HBGA 3FWRA 3DWGA 5DW3A 4FXSA 5B1IA 4Y6GB 5DBEX 4ZU1X 1V71A 2TRSB 3FHMA 1TZKA 3FCAA 4D92A 5J43A 2PQMA 3PR2B 1UBSB 1TZ2A 2RKBA 3TDHC 1X1QA 4D8TA 2J9YB 1UIMA 1J0AA 3AEXA 3VBEA 1O50A 1WDWB 3IQGX 1Z7YA 4ESYB 5BW6B 2OUXA 2YZIA 1K8ZB 2C2GA 4XUGB 4IL5A 1FUYB 4LMBA 2ECQA 3CEPB 5I7OA 4JBLA 2CLIB 1TZJA 1Y5HA 1BEUB 3AEYA 3L6CA 3DDJA 2RH9B 2CLFB 5I7RA 3VSCA 5I7AA 1D6SA 5B3AA 1PWHA 2CLOB 4NEGA 2GN0A 4AIRA 4D8WA 4L27A 5D87A 4D97A 4GQVA 3ORGA 1V7CA 1VE5A 2YZQA 1A5AB 1K7EB 2RC3A 2P9MA 4D99A 5DW0A 3K2VA 4DQWA 3ZEIA 5B55A 4D8UA 4HG0A 1WBJB 5IW8A 3LHHA 2GN2A 4NOCA 1CX9B 5B53A 5KINB 3T4NC 1C29B 5I7WA 5EY5B 4GQYA 2DH6A 3VSDA 5K25C 4O9KA 2D4ZA 1C9DB 3GBYA 1QOQB 3KPCA 4P1OA 3SL7A 1WKVA 2ECOA 1P5JA 3HMKA 2O16A 4UUUA 1K8XB 4KKXB 3X44A 1WTCA 1OASA 2ZY9A 4IY4A 1E5XA 5CGQB 3DKIA 2OOXE 4HPXB 5T6MA 2Q3BA 5IIPA 1K7FB 3K6EA 2Q3CA 5D84A 1J0BA 1Z7WA 1TYZA 4H27A 3LQNA 5K22B 1J0DA 2WSYB 3PC4A 2Q3DA 1VE1A 1C8VB 1M54A 4D9FA 5E0KB 3OI8A 4D9MA 2TYSB 3PC3A 4D9GA 5JJCA 3V7NA 2J9ZB 2ISQA 2GN1A 2QREE 3L6BA 3IAUA 1O58A 1F2DA 4JBNA 1A5BB 3L6RA 3OCMA 2QH1A 1TTPB 5LXQA 2CLEB 1VB3A 4OREX 4L3VA 2UV5A 2BHTA 4D9KA 1TZMA 2JC3A 2RIFA 2ZPUA 1TJPB 2TSYB 3HF7A 1PWEA 1J0CA 3OCOA 4D9IA 4IY2A 2NYEA 2J9XB 1KFJB 5KS7A 5J5VA 2EFYA 4ZU6X 2QLVC 2RIHA 4L0DA 2V03A 2CLKB 4COOA 1KFCB 5C3UA 3FV6A 4LMAA 1PBJA 2BHSA 4HPJB 2CLHB 1CW2B 1XKFA 1TDJA 4HT3B 2EMQA 5K23C 4AECA 3LV9A 4IY0A 2ZSJA 3SS7X 2UV7A 2CLMB 5IWCA 2CLLB 3FWSA 4PCUA 4FRYA 4ESYA 1FCJA 3IQIX 4F4FA 3TE5C 4D9EA 4QYSA 1V8ZA 5I6DA 1A5SB 1PVMA 1BKSB 4P1GA 2ZR8A 3X43A 5MMZA 4HN4B 1KL7A 1YAVA 2UV6A 3KXRA 1KFEB 3SPXA 3I8NA 5I7HA 2O2EA 3BM5A 4IYSA 4I1YA 2OOYE 1J0EA 4L28A 2UV4A 4D9NA 3R0XA 4ZQCB 2YVXA 2RHGB 3R0ZA 4NU8X 5DVZA 4GQWA 5KZMB 3TBHA 3LFZA 4D9BA 3T4PA 1K7XB 4HO1X 2EGUA 3FGPA 3L31A 3KH5A 2PFIA 2EF7A 3KPDA 2YVYA 2DH5A 1A50B 3VC3A 3IQHX 3SS9X 4D9CA 2O2JA 2QR1E 4OFXA 5K24C 1TTQB 2C2BA 4LI3X 3KPBA 5B36A 1Y7LA 1K3UB 3FNAA 5D85A 1RQXA 2QRDE 1JBQA 5B1HA 1QOPB 3RR2A 1UINA 3PC2A 1K8YB 3VSAA 5IXJA 2QRCE 5CVCA 2NYCA 1KFBB 4WX2B 2D1FA
chains in the Genus database with same CATH superfamily
3RAGA 1DXQA 1R1DA 1WDTA 1ZCAA 2JKZA 4ND8A 1JU4A 1CQJA 3AEUB 4LYAA 2B99A 1JTEA 1F0PA 3S0JA 2NADA 1O6CA 4NK5A 3LVBA 1ORTA 3HA3A 4C08A 4D4JA 1HF3A 1US8B 3ZVMA 1IM8A 4UUOA 3UKDA 6REQB 4PQGA 4J43A 3U4IA 3P2OA 4KLCA 4OI4A 4BNKA 1Q3KA 4FXSA 5CA0F 1IWBB 2FVYA 1UFQA 3GZTB 3OIFA 4GDFA 2OYRA 4Y6GB 4DCGA 2P1ZA 1NNEA 2CUZA 4V0SA 5DYWA 3C16C 3EEQA 4F21A 1B3BA 3BAFA 1QX3A 4HEA1 3ROTA 4LJAA 1CY6A 2HY7A 4B31A 4XLTA 4FWIB 4F6LA 3D6UA 4UOEA 1OUMA 1J0XO 1ZVKA 1Z34A 3EVTA 1M6EX 1D0SA 1IB6A 1YNOA 3DF7A 3KYDA 1XA0A 3BH0A 3PHJA 5TF4A 4B3BA 2WSBA 4BQSA 2PZEA 3M3HA 4KGVA 4V39A 4ZARA 1VL6A 4X94A 3KJFA 4LSZA 3R7WB 3WL6A 2F9LA 2XOKD 2NUTA 3PT5A 3MA0A 4GL4A 5AXBA 4KVAA 3E3MA 2PK3A 4CMCA 4E5YA 3O8DA 1B2RA 3R5FA 2LKCA 3UATA 1YZGA 2I2DA 1NJ2A 4RF5A 3VTAA 3KAQA 4II7A 5CH5A 2QX4A 2QZ9A 1Y98A 2W43A 3BWMA 3JR3A 3U3JA 3F78A 3WIBA 2HH9A 2JJ2D 4HDOB 4GFDA 1AKNA 4OA8A 3C5HA 1PFVA 5JH7B 2LP4Y 4DNOA 4MW6A 5ECWA 3KCNA 4LMBA 4JT9A 1H8HD 5HMLA 1PNRA 2QUHA 3TUZC 3OE7D 2W2QA 1DB3A 2W00A 3CVUA 3VOBA 4UVDA 5LN1A 1Y1QA 5CU7A 5DM2A 1HQCA 1FUKA 2W6JD 3U31A 3CPJB 5BQPA 1JT2A 5AVTA 2NZ2A 4AB1A 5ERYA 3K5HA 1N5RA 4L72A 1IVYA 2PXXA 4TKUB 4MR8A 3W5VA 5A4DA 4FPXA 3PKIA 3BSSA 3ZLUA 1T3GA 2AV6A 3WGUA 2YNMD 2NAFA 4NV3A 4RMJA 4ZYWA 5CA1A 4MUGA 5I7UA 4GO1A 1K6IA 4RTMA 1M1NB 3DDJA 4L4ZA 5JSKA 2HQRA 4BQPA 3BHNA 2B3TA 5GZ3A 3PWSA 4TWJA 2BP7B 1C1DA 1VA5A 3FJ1A 4B3TB 1DX9A 1I2AA 2CWWA 4KQMA 3BJIC 2LV8A 3ZWBA 3SF0A 4BAZA 5AESA 4QXAA 1J1UA 2IYQA 2W2LD 4Q39A 1APBA 1Q1ZA 1VIAA 1MO2A 3BE5A 3VDMA 1BX1A 2ATXA 4MLPA 4EKIA 1T1JA 1EFVB 1WMDA 5IH7A 1W76A 2AUNA 4QAQA 1HYQA 3GHYA 1THZA 1TRKA 3WP1B 1ZMRA 4KG7A 2O3SA 3A27A 5CCXA 3CWZA 4NY1A 3QW2A 3DL7A 4OPMA 4CTNA 2PGIA 1TC1A 3IMFA 1POXA 1PNOA 3CRZA 3GLKA 1A7UA 3DV0B 2J8ZA 2BZGA 1ECJA 1QCZA 3UMMA 2GPJA 2P2LA 3TBFA 3THOA 2H1OA 2QPOA 5KSZA 4ZAWA 5I8WA 3MTEA 2C84A 4MITA 3CZAA 2BTQA 3LLMA 1Q15A 1GSOA 1I7NA 1T8PA 4MUEA 4ZV9A 3RV4A 3FUVA 5DM70 2JBWA 4EY5A 3EZNA 3ZVRA 4OYRA 4XD7D 1X0VA 5M5BA 2IA5A 1XZLA 5KNDH 4DBLE 3HVJA 4O2RA 1QKIA 2A33A 3ANLA 4Z0NA 1XCOA 3N8DA 2L69A 4JLPA 5I9NA 3PHIA 4GVLA 4W5HA 2JD0A 3ZBUA 5HIKA 1IY0A 3MJHA 1P8AA 5ECGC 4ZAFA 4PYJA 1AZTA 1JIVA 3W4IA 4D99A 4U2EA 5K51A 2ZJ1A 2IHYA 4WOPA 1MAHA 1XL1A 5E4YA 3ZI7A 3FTCA 1U4SA 3R3HA 3RFTA 1KF0A 1GIAA 3K0FB 3MSCA 4WK0B 4OUDB 5CFRA 4JHLA 2GN2A 1KK1A 3TTTA 4NBSA 3CNOA 1ZN7A 3HKBB 5DULA 4AWAA 5AK4A 5FB3A 2PFKA 1DQSA 2EFGA 2AD5A 4PNPA 1MJGM 2ZRHA 2B6NA 1G21A 3M81A 2FPPA 3N0VA 1Z0UA 4OHMA 1YOVB 4L78A 3UO8B 3PIIA 4K1XA 1PLJA 3FSJX 3AZQA 3EPLA 2FN9A 5CLGA 1TIBA 1JMVA 2W0SA 2FPUA 4IPTA 4TLMB 3L8FA 4UUMA 1WMFA 2GZ2A 3AB8A 3UJHA 4QZVA 2ZQ5A 3JQPA 4KQWA 4QSMA 5T57A 1QOQB 3RM3A 1TVMA 5KJCA 2HBYA 5F2KA 4PG8A 2ZKLA 2H7XA 3N0TA 2Q4OA 2Y0DA 3R8CA 5TMPA 4LRWA 4FCTA 5D6NA 4E4TA 5SYMA 2IITA 2QRQA 5B7NA 3BWVA 1RIFA 2O16A 4HEQA 4UUUA 2F4NA 3Q7PA 4KKXB 4MPRA 3H5IA 3PS9A 4DN6A 4E5SA 3EDMA 1V11B 4CM1A 1MNAA 1UMDA 1BDIA 2VF5X 4K6GA 3TYXA 4RLFA 4NCHA 4UU7A 1JDJA 4ZANA 2UUAB 2HIAA 1M73E 4MWDA 3SIRA 1UK8A 3NHUA 1BMFA 1E4EA 1OKKD 3ZWWA 4MYRA 4YROA 3FVWA 1GDTA 1EQAA 3CO0S 3TPFA 3PGJA 1RWOA 4BLQA 1D2EA 1OIXA 2DQKA 1CZRA 2D4AA 2RI1A 4JB2A 2ZM6B 5C0OE 1PZNA 2PY6A 4G63A 4Z9YA 5FBVB 3FOEC 3EGCA 1EP1B 3GZJA 4X44A 3O73A 5FA5A 2LCQA 5LQCA 4DM3A 3ZHOA 1L4EA 3PX2A 4S2EA 4DFDA 5JMTA 3PRKE 2MR5A 4DEVA 5MF6A 1BS1A 2PRJA 3H87A 2VYVA 3QKTA 4L6AA 4BV2A 1KHTA 2XTMA 2YCLA 2AG6A 2ZUBA 2DULA 3KD3A 3MEQA 4IMIB 2YZ7A 4KUGA 4CM4A 1D2HA 1YSCA 4ROSA 1WG8A 2OYSA 1FLAA 3QLJA 5FULA 1EUZA 3AILA 2JIQA 3A3YA 4UUQA 3QKSA 1KJWA 1LCIA 5IZCA 1SKYE 1UP6A 3L0ZA 2UZ1A 5E0KB 4KREA 2HMWA 3FTDA 3DKVA 4EUEA 1EFKA 1IBMB 4Q1VA 4NE7A 3ZTTA 2ANBA 3NGLA 3I45A 1R8JA 4TXHA 1Q1QA 3PC3A 1E61A 2H4HA 2XDWA 2P91A 3ROPA 1H69A 3RIMA 1TO2E 5TARA 1QAOA 3NOQA 2XVZA 1JP7A 2FUCA 3V7NA 4TN1A 4H08A 1R74A 4E09A 5IXSA 1SZCA 4V0MA 4EZEA 1M7GA 1PNVA 1BW9B 4Z4QA 3BMOA 4ZHQB 4DPKA 5D6OA 1DIBA 1IAVA 1H3FA 4N65A 5F3WB 4A10A 4CF5A 1E7WA 3T7DA 4JQCA 1A5BB 1M1YA 3B3AA 1H3EA 2YW9A 3GA0A 3T34A 2Q3EA 3TI9A 4IFIA 3WK6A 1EDEA 4PFQA 1FSSA 4EG4A 2VK2A 2HJWA 4Y2RA 3ZJYA 3MFYA 1JEOA 4OYLA 3N9IA 2D1QA 1VB3A 4HLUC 1LW6E 3I62A 5LJLA 1BWQA 1SOAA 2CNOA 3FCOA 1J99A 2GEKA 1GGFA 4QM6A 1C0EA 4PRYA 1BWSA 2BRUA 4KYVA 1YI1A 4DV0B 1ANKA 1KVRA 2V4ZA 2QHXA 4KBGA 1XB2A 1WHSA 2JA2A 1N2CA 1XNJA 2FZWA 2YHIB 3DT9A 4PSDA 3F5SA 3QMMA 3T35A 4ESOA 4NE2A 3SBDA 1L7BA 2J5KA 3LPAA 3L9WA 1TIPA 4AZ0B 3LTNC 1JWAB 1CUXA 1Q1GA 3NATA 3HF7A 1EUDB 3DQPA 1ONBA 2NXEA 2QP9X 3FPLA 1UBRS 3PF8A 2WJWA 3PDHA 4BQQA 1UMCA 2HRZA 3NKLA 4EEXA 3I01A 1VTKA 3I3SR 3NDBB 3UMFA 4FFMA 3H5NA 3HBMA 5CVVA 4JDPA 3KUDA 3UW3A 1PL6A 2SKDA 2OENG 3I42A 2VF2A 1YI0A 2B8EA 5KNCH 2IODA 3FB1A 3AF6A 3RU7A 4AY2A 2XB4A 3KJHA 1E9VA 3IIIA 3K15A 3OSZA 2VNHA 1NR7A 3QVGB 4OI1A 3UJCA 2VNIA 3GJXC 2WFZA 4OHKA 1QS0B 3MPOA 4RJIA 2D0DA 3SDBA 1MT0A 2EL9A 2CLKB 2EX4A 2GO7A 3E7DA 3KOWA 2V1UA 1JDZA 1T8SA 4ZO8A 2LW7A 4COOA 1TYEB 3FGZA 5K99A 1Z16A 2FY8A 2R7KA 3WLEA 4IIUA 1ODKA 2DWUA 1HDXA 4UHBA 2GRAA 2A57A 4H59A 2QTWB 5AI9A 3NHBA 1YH3A 3PWKA 5DGXA 1KZ7B 4RCZA 1GGHA 4EI9A 4PR0A 1IN8A 4M9RA 1NOJA 2IDJA 2J0VA 2J7PD 4O8CA 1G9XA 2X9QA 3HKCA 4JLWA 2I3AA 3BG5A 4LTNA 4MEJA 4G0VA 2NT4A 3ESYA 2XXAB 3TXAA 1M34B 3ZS9A 1U7HA 2WNHA 2Q3HA 1B74A 4EQ6B 1USIA 1KNXA 3FAKA 3FOZA 2BFDA 4AMVA 4IRUB 1TEHA 3E5HA 5AI8A 1Q12A 2OXFA 5TJ9A 3D4IA 1EA7A 1ABBA 3ECAA 5F12A 3A6PC 1AZWA 1Z5UA 1ZOIA 5GOTA 5CYFA 2Q5FA 1G7RA 1YE8A 3SQNA 1KVQA 3AVTA 1Z0JA 2GBLC 2DUJA 3JQ8B 3WK8A 2H8KA 2O8FA 4L9WA 1XRNA 3GEPA 1T0PA 3PQ3A 4C0JA 4QUKA 3S27A 2G1KA 3JTMA 3NOVA 1U7ZA 3NWOA 2H3EA 4WOJA 2G3YA 2R8OA 3N59A 4HEJA 4YV0A 3P4UA 3B9BA 2HF7A 1AKWA 2VDQB 4E5KA 4ITVA 1JJAA 1V3VA 1EFUA 2OBYA 4QYXA 3VSEA 4LF5B 4JUIA 3L05A 1GCGA 3IB6A 5AVVA 3FYCA 1JN0A 1J9EA 1E32A 3K6SB 1W88A 4KV7A 3WLKX 3VR2A 1DFIA 4FU0A 1RI5A 5DO9A 3BD8A 1YT5A 1KC1A 1P9NA 3HR4A 1CR1A 3W9UA 1D09A 1NNSA 1VP9A 1KL7A 4D4LA 2COKA 4V1CB 5JD6A 2GYUA 3CCFA 2ONCA 1YVPA 1WBBA 1FFAA 3KXRA 2ZRLA 1JE0A 4L4SA 4YXWA 3CH5A 4UM5A 3E4CA 1AKEA 4I2NA 3RK0A 2E21A 2F3RA 4JYCA 4U4AA 1F48A 1YDEA 2DBVO 4H7DA 3U3ZA 1N1MA 1JYFA 4DA8A 4XAQA 3SQLA 2ET6A 2GZSA 2GT1A 4FONA 2H4YA 4PXAA 1DBRA 4DJ5X 5KYYB 2JLXA 3VR3A 1GN8A 1XEXB 2Q2WA 3G7UA 1ECGA 4HQOA 1UDBA 3K9GA 1NN1A 5FX2A 1R6UA 2QEQA 4CLOA 5L53A 4IDNA 1TYCA 1ZJ6A 1GSAA 2DPLA 1IHYA 4ZQCB 2FPIB 4MQEB 4KLNA 1GKLA 3CT6A 3BTVA 1O95D 4N01A 4NFYA 4OY3A 5KNDA 4B71A 1YZLA 3FHJA 1U0LA 5L3QA 1DU4A 5CLQA 5KZMB 3B8HA 4RLHA 4ZCMA 5B57C 3CX7A 2GMWA 2BFWA 3FFAA 3QFFA 1N8KA 1BMTA 5DWVA 1UIRA 5EWMA 5B1SA 5JQGF 3TX6A 1V37A 1MJHA 2XADA 3L0OA 4ITUA 1YJQA 1X39A 1F8UA 1E2DA 2ZYHA 3CLRC 4P4SA 4UPDA 1A7KA 3WVNA 1RXYA 2Q3LA 2HHLA 2XMBA 4OO3A 3F73A 1YFKA 1MRNA 2BUBA 2ORVA 3OPXA 3SOPA 2FI1A 1GTMA 3ADPA 1TFRA 3U4QB 3F4KA 3MD9A 2BEWB 5GGYA 1U2SA 2GK3A 4KMOA 4NCKA 3U4HA 2OP0A 3ETHA 1GA1A 1RWKA 5HCUA 3HJCA 4GP7A 3DVAA 3WL3A 3IV6A 3TTSA 5A2QA 4M8KA 1IAQA 4C3VA 3SYNA 3VVMA 4C0AC 3AUJB 2PUWA 2OFOA 2YV4A 2FMIA 5CVDA 4ZO7A 1X7YB 3FWZA 3VH1A 1E89A 3E3AA 2GZDA 2I8AA 1L3CA 2QVGA 5T3YA 3QX9A 1W0CA 3CJTA 3QE0A 1U2TA 2V5AA 3V3TA 4EFLA 1N2HA 1R50A 2VPPA 1OLUA 2BR5A 3FNGA 2FZVA 3GLTA 3PNVA 4AAYA 2YIDA 1Z73A 2ZIWB 2VTBA 4PC3A 3W2IA 1CF2O 2HQBA 3I52A 1ISRA 3JWPA 3NC1C 4QU9A 5DYGA 1PL8A 1VPDA 5CBKA 3L7YA 1C7IA 3ZIUA 1Z12A 1EG2A 3NEYA 4XR9A 2ZTVA 1XLTC 4MUHA 1XXHB 4E2YA 2OKGA 1LPBB 3PPYA 1V3UA 1IOWA 4FOOA 2C2OA 2PMWB 3RU3A 1QJCA 3RRNA 2A6PA 4ZVKA 2G88A 3C3BA 4KXWA 4J7UA 1SUIA 5AI6A 1M1ZA 1NXQA 1X9IA 2DF8A 4Q9HA 1U0TA 1QKJA 3L8GA 2CC2A 2G7MC 2R1VA 2C61A 3GCGA 3GRZA 4YQYA 4AMUA 1U3CA 2QG4A 4DDUA 3ICCA 2CBXA 4FOLA 3L8ZA 3QVKA 4R6XA 2RCYA 4IZIA 3RHTA 4NBRA 3WHLA 4DMCA 4RF2A 4G2TA 2CJWB 4H77A 5IM4A 5EZYA 1L7VC 1QIJA 4A03A 5AIBA 3M9WA 5THKA 5JXHA 4QOSA 1DBIA 4LMPA 4O1HA 1Z7BA 4EX6A 4ZK2A 2H06A 4F3CA 2W4MA 1TE2A 2PS1A 3NP9A 1NOIA 3UK2A 4D42A 1YFLA 1PWXA 2QRVB 2ZB3A 4HZIA 4LRQA 3LC0A 3K2IA 2P65A 1Z0ZA 2BCGY 4KFUA 1IZ9A 3P9PA 3UJAA 1IK6A 3K05A 3RFVA 2PKXA 4J7XA 3OTOB 1BU5A 1I9CA 1SD5A 3PGXA 5FFNA 1ZAKA 2RKWA 1G20B 1NJ6A 4AQDA 1KMIY 4HX5A 5IVHA 2QZSA 2CHEA 3C5EA 2F1RA 2P3OA 1E2NA 1BCRB 5FKJA 4DB4A 4H1VA 4ONEA 3VZSA 1PZFA 1HY3A 3A2MA 3RYHB 2X40A 1O7JA 4BMCA 3UVEA 2Z83A 2C42A 1KY5A 3FHMA 2JAQA 3KVVA 3QBJA 2YDXA 4L85A 5EJMA 3U3KA 4DYVA 1QK5A 2C7RA 3OZWA 3NHWA 3IC5A 3QVJA 5BWLA 3WJ2A 2ADOA 2PQMA 4JR0A 1W0KD 5AHRA 1Z6GA 4F60A 4OQPA 1XQYA 3EZ2A 1ZIPA 3HKDA 3NRJA 4HNVA 4KR0A 3HDTA 3PF9A 3EUWA 2FW8A 3L6DA 4FE7A 3GLGE 2W71A 5DN9A 4JP3A 2FU5C 1WY7A 1L4MA 3KT3A 2GNOA 4G0OA 4FUQA 3UWDA 5KSOA 3PEEA 2Q21A 1IHXA 2ZTLA 1WR8A 1B0ZA 2YZIA 1GQRA 1UKBA 2RIRA 2JGAA 3OE5A 4LGVA 4PCAA 1KDOA 4KIGA 2OA0A 1FMCA 3SR0A 1L4NA 2EF0A 1NZJA 3NO4A 3HUUA 1SCBA 4L16A 4WLOA 2C4VA 3DW3X 4FDAA 1T24A 2CXOA 4KXLA 4U5QA 2ETVA 3JWEA 5E3JA 1I94B 1HDEA 4RHFA 3ZWVA 4J0HA 2BMAA 2WJYA 1AMUA 1Z8HA 1VE7A 4U1RA 2F62A 1JEDA 1PEYA 5B30A 4YJHB 3RF7A 4TWZA 1H2ZA 2VNJA 3UT5B 3AKZA 1NQXA 2B34A 1T2UA 5J63A 1ZY2A 2EAUA 4Y7CA 3W1VA 1XDWA 2EATA 5CFQA 3NCTA 2VUIB 2V7GA 2JFNA 4DJEC 1JXQA 1ID1A 5AD1A 2RDMA 5SY9A 4OV6B 2WQZA 3MWJA 3RARA 1THGA 4LSGA 3KE8A 3GPDG 2WJVA 2QNRA 3C85A 3EQ6A 4LZNA 2VVTA 4LEIA 2YHUA 2YYAA 2FVXA 1W35A 4NG4A 1RWNA 4PYLA 4CV3A 2B1GA 2ZJ8A 2RGNC 5KYXA 1RJEA 4KRYA 4ZQHA 1RW4A 3L1HA 4TQAA 5KNCA 4D8WA 1Y7PA 3C70A 3I9LA 4ZCRA 3A28A 4K6CA 2IOFK 3WISA 3LHDA 5BNFA 3DUFB 5JSQA 2C88A 3QLVC 4WVFA 1XDBA 5DNDA 3VBCA 4YRCA 2TECE 4MCAA 1RXCA 1OW3B 2C5EA 3QUBA 2ZRGA 4IIJF 2OHFA 2X9NA 4JLBA 1CUIA 1U7TA 4UEKA 3FZQA 2QYTA 5A6VA 3TLKA 1ZMTA 1JLLA 1GPKA 2R00A 2RHHA 4HDNA 2GBIA 4MKIA 5JCOA 2J3HA 3VV2A 4CFYA 1VFNA 1TMOA 4IQGA 2QBYB 5GVSA 4QBTA 4F8YA 1ISJA 1UPFA 3HVKA 3TFQA 5EIOA 2GERA 4DSOA 1C4OA 3LCMA 2BFCA 2QJOA 2MYTA 3BIXA 4DKXA 3EF1A 1Z26A 4BGDA 1TC2A 4K6OA 2Q99A 5FCDA 1FJHA 1QIKA 1Y7HA 4WEOA 1UBOS 2AOUA 1G64A 1NN5A 1SM4A 1FPQA 2B98A 2QSJA 3AO0B 3ZKWB 5MFPA 3TX2A 3AUUA 3C5VA 3CSSA 4PS0A 1EXWA 3X2EA 2X15A 5K3SA 5DHTA 2H5JA 2VT7A 3BGDA 3KUCA 4OD0A 3T6KA 3UA4A 3W8FA 4YMTA 5CB8A 4H6VA 1X77A 2JFPA 3H1BA 4LBZA 2EJWA 4AKIA 4MULA 5AXDA 4EYSA 3Q72A 4EVRA 4B3SB 1MB9A 1RM5A 1CY7A 1ZESA 2I4OA 1OE0A 1U3FA 3GRCA 4PCLA 3BREA 4AP9A 2CUKA 1WV1A 4NP6A 3D2CA 3QJ5A 2BBOA 3EASA 3GJ8A 1G2OA 3OJOA 2Q46A 1ILWA 1VRWA 3CF2A 3PQEA 1WW8A 1NW4A 2HK7A 4YIHA 2Z30A 2NO0A 3AV3A 1CZNA 3E9QA 3RJ5A 3RUIA 3S5UA 5JWOA 3NOXA 1NHWA 3ROGA 4QJ3A 1QBKC 4QQFA 4R1UA 4YLGA 1B0AA 4DZZA 5JO0A 1QRSA 1QPBA 3EOBI 3ZWPA 4DLKA 3K4HA 3V8VA 3LGAA 4Q4AA 1P7PA 4RQTA 3QTBA 4D98A 1IJEA 2BGGA 4FDVA 2IYSA 5KOIA 3DT6A 3BEDA 1CJTC 3W9BA 2P2GA 1G2IA 5DV9A 4XX1A 3KVRA 1DKQA 4TS3A 5BQXA 1F7VA 5ICCA 3V4PB 3G9ZA 5EMJA 4EPXA 1OILA 1QIDA 1SQ0A 2G1PA 1OFIA 4IHJA 4UTVA 3T1OA 2BFMA 1ZH2A 4GR5A 1CFZA 4KVFA 1WLSA 4LZJA 5CDTA 2Q6IA 3ORHA 1NXSA 4PAMA 3IAS1 3HCFA 4DB2A 4AYXA 1T29A 1T1SA 3LP8A 3UT6A 4Y9DA 1SIBE 4JGBA 1HPLA 2B83A 3VAAA 4J1SA 4R4JA 1OXBB 3D64A 1B0UA 3KUXA 2I8LA 4HYYA 4ZZ0A 1BFUA 2HLDD 2Q8QA 1KYIA 2OUKA 2ZWMA 2O7SA 3C7TA 1JQBA 2XRYA 3MLEA 4U0JA 5ANRB 3RGGA 4BWYA 2AJTA 5BN1A 4V1CI 2QVCA 1XRQA 1C0PA 1QLJA 3WL5A 3LDGA 2OM6A 1YV9A 2W6PA 3AFMA 2ID9A 4MEAA 5KTPA 4P81A 3AFGA 3SMVA 4XYLA 1LV8A 1RNLA 1IN5A 3QV1A 3IO5A 4E70A 4YJFA 2RBEA 3NLLA 1XTBA 1W5TA 1DQRA 2JFVA 3GAMA 4OIFA 4RADA 2G9ZA 4ZPJA 2D6FA 4HH4A 4EJ6A 1L8AA 3U4CA 1N2EA 2ZAOA 2XMQA 2K2WA 1QHFA 2Z08A 4QG7A 1Z5VA 5BQOA 2G1JA 2Z2IA 4EJFA 3LY8A 2C5SA 1X0XA 2JIRA 5BR8B 4Y8VA 4M9QA 1DG9A 1DKOA 1GU0A 1TCUA 3WICA 3E2MA 4FYHA 3G6KA 3CVVA 1JEQA 2P2YA 4MJXA 5HVNA 1ENYA 5FBHA 3ZK7A 4DJDC 1FYEA 1TX4B 5NLLA 3G2HA 1RQLA 2ZE6A 2G80A 4CRWB 3KV1A 1J1ZA 1G1MA 4C76A 1JDBB 1UPAA 2IS1A 2J9ZB 2HSDA 3F74A 5K3OA 1JFFA 1YKSA 3QZUA 1MCZA 3UOAB 1SHKA 2EC5A 3E6AA 3DGEC 1NMYA 2FK7A 3M6LA 4NOMA 2Z4RA 1WDMA 2CXSA 2VJQA 4GNRA 3U37A 1W4CA 4NFLA 5JFTA 1NVAA 5IBRA 5CT9A 5FWDA 1JHUA 4XPIA 3G9XA 4AVYA 2GDZA 3SYMA 3W5JA 3A6DA 3LYUA 3RS8A 5EHQA 3C2QA 3NTOA 1TTPB 3PFFA 1VKJA 3WLRA 5LXQA 2HJ9A 1LSSA 1ZH0A 4TTAA 4C7OA 2X6QA 5HKLA 1SQGA 4E5UA 3NKFA 4OMCA 1P1KA 4TRMA 1QGDA 1X7HA 2QRZA 3GUYA 5ALZA 4CWAA 4BFTA 4Q3NA 1JJIA 1EQ2A 1I30A 5JYBA 1G8MA 2O7RA 2XECA 4MW0A 3BL8A 3I6ZA 5I9TA 3QU2A 2EKPA 4CVNA 3SIPA 1V8FA 4KQCA 1GNTA 4WBSA 1NYRA 2NXCA 2OGTA 3IHLA 1VPLA 3PFBA 2TSYB 1P7VA 4HZGA 4IIXA 5ELMA 1C1XB 2B7BA 5IH3A 4MB0A 5L3SB 2PUVA 1PFKA 4PFJA 1K3TA 2NYEA 1VIYA 3D9QX 1CUJA 3KSZO 4PR3A 3TM5A 1UM8A 1XLTA 3RIXA 3JYHA 2WFAA 4GI1A 3KEOA 2G36A 1ZGZA 4GT1A 1MAAA 3TLYA 5LU9A 5F9HA 4HDCA 1ULSA 2DHRA 5JAOA 2R11A 3A7EA 4G0ZA 5EAIA 4M89A 3DTVA 5CRIA 1KEPA 1Y81A 1HOXA 3PHGA 3PJDA 3QKRA 4R83A 4X71A 1AHHA 5HOQA 1JQAA 1VHTA 3C6XA 4RHTA 3FM9A 1JHPA 2LDBA 3A32A 4QASA 1UEXC 3RQIA 1Y4DE 5CDYA 3MWDB 3LLSA 1PR4A 4LBVA 4LOHA 3U7JA 5IJZA 1X7DA 5C3UA 3OT1B 1YCFA 5DTIA 5AM3A 1VKOA 5K8UA 4IV0A 1KP2A 1UZAA 3O4VA 4E03A 2HGZA 2YQZA 1MX3A 1UWLA 3DT8A 2D4HA 4FDMA 3GLIE 1U80A 4I1SA 4C4ZA 4QDUA 3OZ7A 1JJVA 3IURA 1DINA 1D6NA 2H6EA 2AOTA 2ZXFA 4K9KA 3HM2A 1DTWA 2W2PA 3COJA 4POOA 1T9AA 5F51A 2PXHA 3QI2A 3DOFA 3GROA 1U0BB 5F78A 3VGJA 1FRQA 1QYWA 1TDJA 4Z0HO 2IS6A 1PS0A 5HHTA 4OM8A 3ABZA 1T5IA 4YIKA 5FUYA 2UV7A 1U1DA 2ZTSA 3DEIA 4O4HB 3GFBA 2XB6A 4JOSA 1XDDA 3WKCA 3OWXA 1GQOA 1Y4ZA 2GJSA 1R0LA 3M4ZA 3WTBA 2ZJYA 4IXWA 3RRYA 4WAUA 2P69A 4ESYA 3VSBA 1A97A 4FXOA 3UTDA 5CXQA 3F6RA 1YZNA 2ZJAA 1MGOA 1A96A 4Q47A 1PBTA 4DV4B 1Y1LA 1PI3A 2OAGA 3GDHA 3LBHA 5AKGA 1AQYA 2Q0XA 3IH5A 3RHFA 3TZKA 1IG3A 2PKEA 2YHAA 4XSGA 4H60A 1QZUA 4HDSA 4QT4A 5I6DA 1H2XA 1TD9A 3HBNA 1N77A 2WU4A 2E5WA 2A9RA 2E89A 1YJCA 3I5MA 5IKMA 1KQGA 2GO1A 3EQ7A 3OJCA 2C77A 1J8YF 3DEJA 3A06A 3MNFA 4NAUA 2W2MA 5J2TA 3OFND 3T5MA 3PCTA 1RADA 1Y3IA 2ZR8A 3KKEA 4K9MA 5JANA 4FVTA 4F11A 4YMSA 3NW9A 1EVLA 1DX4A 1F0NA 1GPYA 1WUYA 1NBOA 1YS6A 3FCEA 4M6WB 5FDFA 3ASUA 1KR5A 4ECAA 4LZAA 5HJEA 4WN3A 3B3JA 4IDOA 1XFAA 2RARA 1KOGA 2C3YA 4WUVA 1Y3CE 3WGKA 2NU6B 2Q2NA 1QP8A 2L17A 3ESZA 1PV2A 1SXJD 2QL7A 1GTZA 2CW5A 2VYQA 3PLNA 3ZH2A 3TIGA 4MVJD 5FLEX 1W49A 5LUAA 2XTJA 4AK9A 2JG3A 1U1GA 1BG6A 4G5YA 5K3FA 3SWWA 2WV9A 1FW8A 4DCUA 5DT9A 5E95A 3TW4A 3VNQA 2UV4A 2WIDA 3FJOA 4PLWA 1SIUA 5ICFA 3GEDA 3HI4A 4X1KB 5IG2A 4HFNA 5ICSA 3EGXB 3KHTA 2Q2OA 3RCBA 2QMYA 3D59A 3RKSA 3S3TA 3HBFA 1WSBA 2JANA 4GI3A 5CT4A 4FCWA 1RLMA 4LYJA 2XUHA 3A37A 4IY1A 1F7UA 3DTYA 3AU8A 3EOAI 4FFBB 3T4PA 1J2UA 3P2EA 5AKYA 4JODA 2BMVA 3PNSA 3PEFA 1IUOA 3JZFA 1XNHA 1VYVA 1D2GA 4JWKA 3V34A 1XXLA 4DJTA 2F17A 1VHJA 3CV3A 1ZKDA 5ITZB 2XUKA 4NQRA 3M34A 1AXEA 5AP9A 5EVJA 1L5GB 4I50F 2WF9A 1YUNA 2FCRA 4YAFA 3AI1A 3SAJA 5AW1A 3GEBA 4P3PA 4OGGA 4CHTA 2C2YA 3NBXX 3VC3A 4H17A 2QWXA 1QZXA 1IOZA 1ODSA 5LA6A 4LHXA 1R12A 4YAEA 4S1TA 3TXXA 2J6HA 5EJ8A 1U2ZA 2X3UA 1TFUA 3NRCA 4YCAA 4JWTA 3HC7A 3EXHB 1K5DA 2IPXA 3WBKA 4EF5A 1XA3A 4EI2A 3RQSA 1BIFA 3W78A 1SXJB 1BDMA 1Z2EA 3R4VA 3C7KA 4U9IS 1KQPA 4MS1B 2GD6A 1SC6A 3AR8A 4Q7EA 1E1KA 1UKZA 5GADl 4V3CA 4JVMA 3BX1A 4IVNA 2UYOA 2MJLA 1WMEA 3IIJA 2OXEA 4HAVA 4QDTA 5JMPA 3OLZA 4QTZA 3HI6A 2DGDA 2Q1XA 1M34E 2A1TS 2ORWA 3DB2A 5HFNA 3RBZA 1ZXLA 3UH0A 5AVWA 1M2GA 5KC9A 5EQJB 1YWGO 1Z0DA 2WSMA 4NS4A 1PJAA 3WLPA 4JLSA 4KIFA 5EESA 4DQXA 1JBQA 1U4OA 3TRFA 1R18A 1RQ2A 2RGGA 2FEMA 3LPNA 5FOVA 5JJKA 5TGTA 3QKIA 1FZQA 1KZ6A 3SVZA 1O6ZA 3UXMA 3KWMA 5HZHA 1T2CA 4LWQA 3UMCA 1XZFA 4OK5A 4XJXA 5BORA 4YBRA 2A92A 1D07A 2XE7A 5T6BA 3R5TA 1VDMA 3ND6A 3UUGA 3SEQA 4FHEA 3HSKA 2NYCA 5LIPA 4MW4A 3TDKA 5KTRA 2JHPA 4F9TA 5A0TA 5CAEB 4OXIA 4ARUA 4DC9A 3VR5H 3PUXA 3GJZA 1EFPB 1E62A 2PL3A 5COBA 5D86A 1KP3A 3HB0A 4LQLA 4Y9UA 2QUBA 5CYPA 5DXJA 4D6PA 2DSNA 2OHOA 3FLBA 2APJA 2GEBA 5LD2C 3UBMA 3RU2A 1ST3A 3VPAA 4EATA 2NG1A 1Q11A 1QX4A 3V33A 1JGTA 1AHPA 1TUBB 3T8YA 1PFQA 1BJKA 1R27A 2ACEA 2D1TA 2YOGA 3BFPA 3DWGA 3FIUA 3GCZA 5CHEA 1GRVA 4R16A 5JZOA 1Q0UA 2OCPA 1C30A 4F71A 1Y6ZA 2VJKA 3AG6A 2CCKA 2IPLA 3DEAA 4G0NA 3WKDA 1G38A 3UG7A 4DCOA 4G8CA 4HGYA 4EF6A 1YZ3A 1VPWA 4WPGA 2NUAA 5BW5A 1UZUA 1ZH8A 2ORYA 3OIGA 4TL9A 3FTQA 1D6MA 5EJ2A 2FPWA 2FEWB 1F2UB 4O29A 1S7GA 3VMMA 3OCZA 3O8NA 5ALEA 5BRNA 4BLRA 3PPVA 1EWRA 2PGAA 3B85A 1X13A 2Y8EA 3D8BA 4Y2XA 2E6UX 1GNQA 2FOXA 4PVCA 3VJKA 1IONA 1DAMA 1TMKA 2PMBA 2WWIA 5CHYA 5C52B 2KJQA 4BCDA 3H8JA 4BJ1A 2O0LA 1WVGA 3FHOA 4WEQA 1D7OA 4HHEA 3BXZA 3NZEA 5A62A 1NLZA 4YT4A 2GAJA 1JIKA 1G2PA 3KLMX 2A58A 4LJKA 2QDKA 4DSTA 2V3WA 1OPXA 4LV5B 3GOHA 4WXYB 4AKGA 1NUTA 1OLSB 2PKQO 1KS2A 1OY1A 2WM8A 2WYUA 4HAXA 4ZYLA 4B32A 3VHXA 5IXYA 2V9PA 5C81A 3U62A 4PSAA 4AX4A 4E5PA 3P27A 4WKBA 3QPVA 4LXUA 2ZUTA 4EARA 1G8HA 4JMPA 2WYHA 1T5LA 2ODAA 2P9GA 5BNIA 2D54A 4AI6A 3N2KB 4N1AA 2B78A 2WG1A 3FR8A 2B21A 4FHDA 1C8BA 1D4ZA 4DW8A 4CEHB 1BKDR 4I5GA 1Y9AA 5H70A 1MENA 4Y6SA 1P0MA 1J2EA 2D8AA 4N54A 1TEVA 3L6CA 2SBTA 3GCWA 3QVWA 5B7GA 3A31A 4WKNA 3GF4A 1H5NA 2WWFA 3ZDXB 2P75A 2X1HA 2FPOA 3Q7SA 4KMRA 3RJMA 2WHYA 4MMYB 3U0BA 4D9HA 5C4MA 5LLTA 3ZXYA 4R2IA 1G98A 3H16A 3HN2A 1R4MA 2RGCA 3NBMA 4GYKA 4R71A 5COAA 2E82A 2OE2A 2UV8A 2L82A 2UAGA 4IMRA 4OU4A 3QXCA 2JDID 5HCNA 2Y0EA 1E6UA 1I0IA 3D4PA 4P8RA 1RHQA 1RYHA 2OTCA 3C6QA 4RX1A 3TZ6A 2DJ5A 5JCPA 1K4YA 2MWMA 1P33A 2FETA 2NSJA 3E5MA 3DBHA 4CLXA 1P5ZB 1CS4C 2XT9A 1NONA 1SC3A 5EUQB 2W6OA 2NO5A 3OCCA 4RZ2A 3WP0A 1XEWY 3F8WA 2VJAA 4BC0A 2EP7A 1PAUA 4JENA 2H17A 2WWWA 1C4WA 3G49A 4NCBA 4PX5A 1Y8QB 2P9BA 4ZDJA 5BN3A 1MC1A 5LQKA 3KALA 3HCEA 2XY4A 5DT2A 3NP7A 1AIPA 4EY6A 4M55A 4QGSA 3ONNA 3G9UA 4EY4A 5DTQA 3DFMA 3F49S 2BW0A 4MNTA 1E3MA 1QWOA 1NV8A 2WT8A 3COZA 4RVOA 4IXMA 1EH5A 5JSZA 3LXXA 1WAMA 4LFAB 3B78A 4IWYA 3ANNA 1Y9JA 2O06A 1USUA 3BWXA 2OGWA 4IUDS 1NVDA 4QRIA 1I3NA 3E0XA 4RL6A 2A5JA 2PAFA 3OHMA 3I2KA 1CG6A 4U02A 5FNZA 3OBBA 3TRHA 2QRPA 1EIWA 3I9FA 2HO4A 3S2YA 4DBLC 1F4VA 1A5TA 4PXYA 2HSWA 3AZOA 2OVFA 2WEKA 4GLBA 4YRFA 4C4SA 3ZHUA 4HQKA 5AKLA 3ZDYB 2QUKA 3MJFA 3SSMA 1MX5A 2O6LA 3G9QA 4TYPA 3RTDA 4UZEA 3AFOA 4P1ZA 3SYLA 3S1AB 5KTYA 1YUBA 2KMLA 4O6VA 4G5HA 1VECA 5E7IA 2P4UA 3R8XA 4UJ3A 3SQXA 3ZBQA 1Z37A 4HNAA 2AF4C 1G4UR 2QZ4A 3CXRA 4OSOA 1NV9A 5C8DA 3OESA 4J07A 1K2VN 3CIOA 5EKDA 1REQB 4I81A 4QULA 4BNIA 3ZY6A 1H4VB 1CY1A 4NG5A 3U0VA 4JFRA 4ALIA 3HSYA 4A2PA 3CX6A 2LXNA 2XQJA 3O90A 4OH7A 4DJJA 5FOXA 1ZUNB 1N6HA 3PGA1 4JX9A 5AJHA 5JY1A 1BHO1 1EK5A 1ZFNA 4ZYUA 3HMKA 5A7GA 4MI3A 3VTZA 4LJYA 3BA1A 2J46A 2Y4OA 1N6KA 3OPMA 4HTFB 1LX7A 4YGYA 2CHFA 2FFQA 5KQGA 1E6MA 4IY4A 1LBHA 1LS1A 1NXVA 1E5XA 1YMUA 5LDDC 2B94A 5A6SB 1T9ZA 5G0TA 3WGMA 4CUZA 1QYXA 4GWGA 1Y4UA 2XPCA 3KKPA 3WLIA 4GECA 1RFLA 5JHHB 3W04A 3CNBA 5LYJA 2FGKA 3LBNA 4RKWA 4HNGA 2Q3BA 2R2AA 2R62A 4HRXA 4ADSG 5B64A 3ZDAA 3GDOA 2ZB7A 1NWHA 3ZGVA 2WJIA 2A4MA 4TL7A 1S2MA 3A0UA 1UADA 4FBGA 2QE7A 1KVTA 1N1EA 4ALKA 2I9PA 3TOVA 4OBWA 3A9VA 3OFJA 7YASA 3BVPA 3U26A 1SWVA 1H6BA 4XJTA 5FL7D 1YCHA 4WKCA 5H3LA 4BYGA 1F4LA 1U8CB 4XEUA 4LZLA 2XNDA 4GKJB 4TMWA 5DHQA 3BD6A 2Q2VA 2QP4A 3M6AA 2HHJA 2HZ7A 2Q3DA 3O26A 2WLTA 4TZTA 4V38A 2H52A 5AJYA 2QGZA 3GP8A 3QVXA 2X9VA 5IYZF 4KQFA 3MRTA 2Q4RA 1CRWG 1E1YA 4URHA 3RJZA 3UC5A 5CLIA 4HMPA 4IIJB 1WBDA 2WYVA 3BQNB 4EHHA 4EYOA 1KAOA 1OMOA 4MWZA 4MKGA 1X8JA 1H1DA 2TYSB 4MUJA 4ZZ2A 2HJGA 5FEUA 2Y2VA 4UNIA 5LZ7A 5HTKA 3OFVA 2EW2A 4LJ4A 4NVRA 4PYRA 3CBGA 4GOJA 5F77A 4TMYA 2Z5VA 3D4LA 3H9BA 3WAKA 3FHLA 1MB2A 2BT4A 2WD8A 3LY7A 1KVUA 3M4XA 4US0R 1S1CA 3BMQB 3W7VA 1OAKA 1SUSA 2UUOA 3U2QA 3W5HA 3G2NA 3L6BA 1WUJS 5F23A 3GU3A 4K5QA 4DAEA 3E9EA 1QRRA 3QOWA 1MG5A 3STHA 3GVHA 1TECE 1ZCFA 3I9NA 4FD2A 4ZOLA 4CKWA 4L22A 4QUGA 1EFLA 2PL1A 3AWIA 3ZXUB 4AKSA 5AW8A 5KMGA 4YRDA 5KWVA 3C3KA 3G5AA 3T1QA 5CDGA 1SZJG 3QLUC 5FPKA 5DM0A 2JNWA 1XAJA 5HG0A 2GPYA 1UFRA 3H97A 4K9RA 5THXA 4P82A 2A3NA 1Y9EA 3S2ZA 1XX6A 2OV2A 2XHZA 4LF9B 1TQHA 3HY6A 4J76A 4MZXA 1Q7EA 1H93A 3RSOA 2AEFA 2Q7DA 1LUAA 1JKMA 1Y6JA 2N47A 2OEPA 3NXKA 3RVDA 1FS4A 3K2BA 3QF7A 1GUZA 3R5JA 4MVJI 3P9YA 3VX4A 3AONB 3K0AB 4O1MA 4AZTA 4Q02A 4YAGA 2X4LA 3EG9A 1CY0A 3NHYA 3RS2A 4B6GA 3NV7A 4FCVA 1GWNA 2JEOA 5HOEA 4M53A 4PG7A 1U0RA 3UHAA 2C1EA 3KP1A 5AHXA 1QHNA 2OZLB 4MKFA 5LVAA 5CA0A 4WCDA 5FBLB 4Y0AA 3PYLA 1VJ1A 4Q4HB 5AK6A 1VCOA 3UAXA 4EY8A 3QOXA 5IVPA 1BGVA 3CXUA 3H2ZA 3VR5A 4CI9A 1USGA 3C6BA 2PUTA 5IBPA 4ZV4A 3SJBA 4TS1A 1H0HA 4GZ3A 4X66B 1DPFA 1OF1A 3L7KA 4ON9A 1T2FA 2OGZA 1QK4A 3JD1A 1UDCA 1Z18A 3F9IA 3MGCA 4LYGA 2HFKA 5KSPA 4WFKA 3K9QO 4BX9A 4EL5A 1R0KA 2J9GA 4B84A 1E3WB 4EMTA 2E6KA 4C06A 4D5EA 2VPWA 1HG1A 2ZETA 1G8PA 2QZPA 3MTAA 4ILEA 1PR9A 2ODWA 1LK0A 2MSWA 3KKKA 4XQGA 2ETXA 5G3ZA 5KYXB 3G88A 3CKYA 3LBAA 5IP5A 4DMHA 3SP1A 3M5DA 2I8CA 2WWGA 3I83A 5BMVF 4KQGA 4V3BA 4HH0A 1A8UA 1FP6A 4UNSA 3GB9A 3C4VA 3RASA 3PPXA 4QICA 2Z6AA 3D2AA 5FWAA 1OU0A 5ALSA 1Z7GA 4L74A 3I01M 4GZMA 3UM9A 3DL0A 4YRNA 4ABTA 2OXIA 5EJIA 3PU6A 5C51B 1H0RA 5J40A 1DP4A 2GZHA 4M1MA 4H1WA 1X86B 4RQBA 1ZJJA 2JIZA 3KJNA 2EBFX 3TLZA 1JE1A 2JGMA 4MQUA 4WXRA 2AC7A 3PFCA 5DX0A 4E5VA 1T0UA 2ZT8A 1GYRA 2ZSJA 3FUXA 3OOWA 2QMOA 3B70A 2HC9A 4FX5A 5KNBH 4FR5A 9LDTA 3I6MA 1NJSA 1TT7A 2WU8A 1WS6A 2R8RA 3N2GB 4YJGA 5DMHA 5DE3A 1AC5A 3O7MA 3GLHB 3PIRA 3GH1A 4DREA 3FWSA 1QDUA 1TB4A 4L9RA 2QI9F 2ZBGA 2JCXA 3EW7A 2DVMA 1P7CA 1CIPA 1Q6YA 2AEMA 1T3LA 4AMGA 3QEMB 1BC5A 2WB2A 3O3NB 4HP8A 2X3YA 4MPTA 5F1KA 4GEGA 4I8XA 1A7AA 1YHZA 2IYZA 4Y2JA 3MGGA 3LDFA 2Y0CA 1K4KA 2VT6A 3IIMA 1RI2A 2HBRA 2H48A 2XOXA 3QG5A 3EG5A 5KKAA 1NA5A 3JQAA 3LC2O 1A5SB 4KNWA 5LKRA 1B76A 1NBAA 1GRRA 1X6VA 2VZ9A 5TEWA 4ZCQA 4RGVA 4EIWA 3L4SO 3USCS 4B0PA 3G59A 2BSAA 4DQUA 3QXHA 1QE3A 5BSFA 1OCEA 2ZQYA 4YYEA 1Q0TA 5EIWA 2QMEA 2WJJA 4TV9B 2F3SA 3NT4A 4XGKA 5K1ZA 4RFSA 1JAZA 1Z0KA 4QYTA 1DV2A 1XTKA 4R1TA 4MV6A 4PE5B 2BKVA 4AJJA 3S1LA 2GZ1A 4FKMA 4I55F 2JVJA 3CUVA 2ASEA 2ZBRA 3L4BC 5EKTA 5FR2A 4B2LA 1YZYA 2HOQA 3DXXA 1QCCA 4BQEA 3SPXA 4CQMA 1I51A 2GJ4A 1YRAA 1WCYA 2DBRA 2C3UA 3NIWA 4ZOAA 3SN6A 4P54A 2H7CA 4X5OA 5J4HA 2IYAA 1QYDA 3OEHD 4BX3A 1AMNA 1UJ6A 2RI6A 2FZKA 3RSLA 3MIZA 4R40A 5LUBA 4AJ4A 1FFWA 1PLKA 1YS1X 1NG1A 4CDGA 4IEIA 4AUEA 2J3IA 1GPAA 4UKDA 2HIGA 2I7VA 4XTRA 1FX0A 1V96A 3TEMA 3F3SA 5EERA 5L7YA 1N5JA 3Q3JB 1M2VB 4C0LA 1XMXA 1P5RA 4QBFA 1NMXA 4EEZA 5JASA 2B7CA 3NFYA 3NVMB 2CNWA 2PKQP 1BRTA 2QXTA 4JKIA 5DX1A 4YUVA 1Y6FA 3CVXA 3QF4B 2C03A 2ONKA 1ZGHA 3SF8B 5JNRA 1V47A 1Y1SA 3GVCA 2VIIA 2QRNA 4GM1A 3JASA 2DB3A 1LF0A 4KFRA 4V24A 4ZVOA 4AZVA 1O57A 1SVNA 3AHHA 2YRXA 2GZ3A 3PJFA 4MS4A 1KDPA 3DZCA 5HF8A 4EB8A 2D5IA 4J29A 2YDYA 4R1NA 1BS2A 1B0PA 2HYDA 1N7GA 1Z2CA 3GRPA 3ADBA 4WNYA 1U8XX 5B3JC 1CR4A 2ECPA 4DWOA 3QRWA 3K96A 2A5GA 2QAJA 2RH8A 2VHTA 4IFEA 1PJCA 3RD5A 4AMZA 1VZ2A 5TRTA 3ZWAA 2P6RA 1FZTA 1MRSA 4OGKA 4F56A 2ZSUA 4BMDA 2F1IA 3U09A 2JI6A 2UZIR 3AL3A 4EDFA 2CBGA 1RRPA 4P84A 1PVDA 3QHAA 2IV2X 2P9JA 2X9LA 4G2NA 3TQSA 3VMFA 5ALJA 1VKHA 4G1BA 3RUPA 3N05A 3IRVA 3L5KA 4RZQA 2BHRA 1AZLA 4ZRDA 1KDRA 1D03A 4GP9A 1BE6A 4RQAA 3HWRA 1T3HA 5A04A 1P1IA 3JD4A 4YP5A 3AY7A 4F5DA 3QX7A 3FSEA 1V8DA 1KE2A 1ZLXA 4BP8A 3A9RA 4LHZA 1YTUA 3EULA 4IS2A 3DEHA 4EVSA 1M3SA 4J9UE 3B1JA 3BB1A 5LLDA 1ONSA 2RE8A 2HHHB 1V2GA 5AMXA 1UBCA 1ZNWA 3M9XA 1YR7A 3QM1A 1Z2PX 2ACKA 4MW5A 5PGMA 5CD1A 3MTJA 3TCKA 4NPAA 4C88A 1ONNA 3H9CA 1M6VB 1YRLA 3ZDCA 1CF4A 1MOZA 1NVBA 3DXYA 4G1FA 4WX2B 4XB2A 4Q03A 5H4GA 3AJEA 4FTWA 3T0GA 3FMGA 3P9RA 2NV6A 3GGDA 3DB1A 4BBZA 2IH5A 1OT3A 1GRNA 1I4EB 5DBHX 1MJNA 4S1VA 1TKCA 2JGDB 1P0FA 4UDYX 3AJRA 2WAMA 2FW6A 4RGYA 4IUCS 3PXDA 5JT1A 2GBFA 5ITVA 1QO0A 5CITA 1A9XB 4XGQA 3DJFA 1N0UA 1YR3A 3M89A 1AH2A 5ICEA 1G7TA 2A0KA 3B6EA 2HIHA 4W8HA 1FFYA 1LJLA 1HT3A 1OGJA 2FPKA 3E7XA 1FFDA 1GPH1 1ZSVA 3C7DB 3KZ1E 2WKRA 5F7OA 2DUUA 4HAZA 3T9FA 4RK7A 4MRNA 3BK7A 4NBVA 5H0IA 4ZYTA 2B4AA 2WKQA 1U7PA 3GDWA 1PEDA 1EWKA 3IV7A 4Q48A 3Q2KA 5IDXA 2B5WA 3TIXB 1RZRD 1ITZA 2YJ3A 3M0EA 4NS1A 2V4UA 2DUMA 1ZS9A 2PAAA 4IGKA 3NIFB 5JARA 2ODTX 5B58C 3BJEA 3LF1A 2O3QA 3WHIA 1GZVA 1R4ZA 2WLSA 1WY5A 5FLYA 1CY4A 3UF0A 1M8PA 3AI7A 5CEJA 2DRIA 3ITKA 4AW9A 2HNBA 5CLJA 1Z8FA 2AMVA 5K8TA 5J47A 3IAXA 5DNUA 4OAOA 1J0AA 4PANA 1RJ9B 4CYMA 1Z2NX 3LAWA 3BICA 4IUYA 4O02B 3GYGA 1YBVA 4C4TA 6CHYA 5KX5F 3OF3A 4G24A 4XUGB 3ZE1B 2AQKA 5SICE 4RA6B 4TMXA 2RB4A 3ZE0B 3CUWA 4PFSA 4CIDA 3TQTA 2DAPA 2A7XA 421PA 1FJXA 2V8BA 1SXHA 4CTJA 3TG2A 1RIIA 1UDAA 2QTBA 2V54A 2X9GA 3B60A 5ALGA 4C21A 3FB4A 3I04A 3KKOA 4P5DA 3MJDA 4AC9A 1AQUA 2DWCA 3N0RA 4IJWA 2GXUA 1FLNA 3KNZA 3N5CA 4CDNA 3KM0A 1ZM2A 3EEBA 2OBNA 4WY8A 5AXCA 3WIDA 2VTVA 3C48A 5FOUA 4EA6A 3SC3A 2P27A 4C7JA 4GMXA 4FFOA 1CLUA 2PKWA 3BHMA 3ESXA 2C9ZA 4XARA 5AM4A 3FOFC 1L8XA 1PYOA 2TMKA 1WKCA 2V7TA 3QLUA 4D0NA 1P6UA 2O5VA 4Q3DA 2J3EA 3VZCA 3EJWA 3O1JC 2UKDA 2I55A 3E7FA 3AIKA 3ONEA 4IIHA 4LHEA 4M0DA 4Q16A 1CDDA 3HM9A 2EU8A 4KGDA 3DE3X 3OX2A 2BR3A 2DETA 3P9CA 1HDOA 4N03A 4YRPA 4O4JA 5EE1A 3V9PA 4CT5A 1OD6A 4YRLA 4UQOA 1CRZA 1L4FA 2VSOA 2YUTA 5HM6A 4YWHA 4NPHA 1HZJA 2PN1A 3VI4B 4LKOA 4RCYA 1V1MA 3QMWA 1GG8A 3H19A 1G3IA 2JD2A 2ZUWA 4EQZA 1E2FA 5F1YA 4YC7A 4BNDB 2YXDA 4Y30A 1JFVA 3HTXA 1K2WA 4MQLA 1NKTA 1YZHA 4OX9B 4C1NA 2FH5B 4BKMA 4B8ZA 2JGJA 5HKAA 2Z8ZA 1E1CB 5B4UA 2NN3C 2FXVA 3HR8A 2CJYA 5GONB 4R9SA 3BXFA 4QGGA 3HWSA 4Q3OA 5JO9A 2OAP1 3HXKA 1C1YA 4MP8A 4R41A 3EGEA 4WTOA 4XSHA 4YRMA 1H2BA 3AFIA 4RHUA 4CHGA 1BYIA 1U9YA 5ALLA 1KO5A 3I0ZA 5AVSA 1HX7A 3PFHA 1TQ4A 4UAGA 3QA3E 5LQDA 3EZGA 3HUEA 1ZD9A 4JH0A 1DT3A 4N7JA 1VL1A 1XHLA 3DLTA 3GFPA 2EKZA 3LOPA 3MT7A 4A9AA 5KNBA 1DFGA 4Z0TA 1FYDA 1EFAA 1NW6A 4ID3A 3QJYA 2WFMA 2WQ6A 5JBNA 1UUFA 3F2IA 3C3EA 3BRQA 3QTTA 4DQ0A 3TMYA 2Q1TA 4TWBA 3ASZA 4R2HA 3ZZNA 1OH5A 7REQA 3QGMA 1L4UA 4KE8A 1PD1A 4JI4B 1WXIA 3CNQS 3L7JA 3ROMA 2JLUA 1U3UA 1UWVA 1VI6A 1A1SA 2Y76A 3CZ5A 3G79A 1EZ4A 1U2QA 2PS3A 5ENVA 4YX9A 2ZUDA 3OTGA 2CBZA 2K87A 4QDXA 4ANFA 7MDHA 2W2KB 3L49A 3PXEA 2BEVB 2BR4A 1DBWA 3LLUA 1TQ8A 4O9KA 2DXIA 2ZZKA 2FN8A 3H11A 2EERA 1EVZA 5TGDA 1OFGA 5G0UA 4Y2VA 4ZCPA 3DUWA 4QVKA 1S7CA 3PNYA 1MQ9A 1QGUA 1IY9A 1UM9A 4G0PA 4DR3B 1SVOA 1W1WA 3W1WA 1QCDA 2LPMA 3C87A 2XIQA 4QYWA 2A7QA 3WRVA 3A9SA 3E9YA 4QLAA 3Q9UA 2UXDB 4M3NA 4A2QA 1JA0A 4UEJA 3H5TA 1GRCA 4JL6A 1ZW1A 3K32A 2FFBA 4HJRA 4EUKA 3D2LA 4FZVA 2Q29A 3DPIA 1D0IA 1NNUA 1SCAA 3EDQA 4R7ZA 1F2TB 3LUFA 3WDMA 3HCWA 1XYGA 2ZSIA 3KEFA 4U8GA 4XX0A 5I9SA 4C7MA 3ZGZA 4ZOCA 1X7XA 3UV3A 3A4IA 1XDZA 1D2AA 4X7RA 5JQGA 3P19A 1S3GA 1RYNA 4B76A 1GGJA 3F9CA 4NNOA 4OQ4A 3I4FA 1R15A 4C0KA 4KWTA 2VH2A 1FTNA 1RJGA 1U0GA 3I64A 4N3AA 3DS8A 3BRWD 3ZWYA 3MWGA 1CY8A 1K0FA 2ZYSA 3QBDA 4Q18A 1SPXA 4B09A 1HURA 1RYFA 2JI8A 3ZX4A 1R8QA 2D59A 3NDJA 3LQNA 1E2JA 3L4BA 3RYCB 3QFRA 2XWBF 2WDZA 4MLZA 4P4TA 4AD8A 1SCNE 3GRKA 3Q11A 1AJEA 1YQGA 1XWFA 3W5UA 3PC4A 3FLAA 4N49A 2CWDA 4MRVA 2AW3A 5H5JA 4ZJZA 1OI4A 3DMTC 3A4MA 1EU1A 2JI7A 2I3DA 2POQX 2QD2A 1QHGA 2ZI6A 4KXNA 4LMRA 3H86A 3T5BA 3BGVA 1M54A 4LWZA 5C5EA 1FQJA 5JC8A 2A86A 3DMPA 2FFHA 1RPJA 2F55A 1CKEA 1MPTA 4X7BA 4D9MA 3ORSA 1J2TA 4FKZA 2CFRA 3CB2A 3TTWA 3HEBA 4A15A 4Y6LA 5BQ3A 2OPHA 4C43A 2G6BA 3GJSA 2IU6A 1YB1A 3G2JA 3H04A 4YP6A 4W5OA 5GIPE 2ODNA 3B1WA 1ZM7A 3FRIA 4O4IA 3IVRA 3L6OO 4F7WA 4Z7OB 2A14A 3EXEA 3O95A 4NECA 3ZWKA 3GP5A 2J0UA 1NM5A 1YQTA 5EGSA 1JW9B 3PBKA 3LY5A 4OOFA 3DSRA 1NL3A 2CFOA 3L92A 4IKOA 1FRVA 3AB3A 4KX5A 5FTLA 4YCNA 4X20A 4HDKB 3PNOA 2WSSD 5HGXA 1NXTA 4QRHA 5B3JA 5A02A 4URUR 2Q50A 3D8HA 1P1CA 2FE4A 4EGSA 3LE8A 2QSYA 5KDLA 3QELA 3E35A 2FPRA 5DGHA 3AFNA 4L2IB 3N0XA 3KDSE 1SCQA 1MPXA 5A71A 2G67A 4KJZA 5EJ7A 2ZVQX 1USWA 3OQ1A 2Z0MA 2E87A 4CV0A 5DI3B 4LNUB 1DKPA 2VP9A 4UXHA 2YNMC 4AO8A 3ZNNA 3B8EA 2VRNA 4EPWA 4H7EA 2VRCA 3UXHA 2QV0A 1QF6A 2WJAA 1SUFA 1T0IA 2GILA 2X0RA 3QYPA 4IXTA 1IVNA 4NWIA 5C32A 1OAAA 5DI9A 4D9IA 3CC8A 4A36A 2EV9A 2YJNA 2OV6A 2A1UA 5I9MA 2PLWA 3CR7A 3TKYA 1F8YA 2QX7A 2MU1A 5K3EA 2X22A 3CWQA 3RLIA 3L7AA 1HT2E 2R8BA 2ZG6A 1G8AA 1ZGGA 2VAWA 5AKKA 3HB7A 1E6WA 3DDCA 4LE2A 4N76A 1JKXA 5E2AA 3Q5EA 3OFKA 1OVMA 3DKKA 3SHFA 3NC0C 4N82A 1DC4A 4OHOA 4XH9B 5CT6A 3U4GA 5AVRA 1I5OA 2CL6X 2ZI5A 5LP6F 1W85A 2FUEA 1JU3A 2O57A 3AV0B 3KB1A 4OGWA 3IKJA 4CFSA 2QVBA 4RM2A 3LVFO 5B3LA 3TGPA 1NXOA 2YFHA 1Q57A 2GBGA 3PZRA 5ESDA 4RTQA 2QPLA 3SHVA 1PP4A 1HEUA 1BCSB 2NU7A 2DR3A 4DUGA 5ED4A 1RPNA 4QEZA 3URKA 2ODPA 2GYYA 2V7QA 3AL2A 1E77A 4PZ9A 3STVA 4XDYA 2AZDA 3E22A 5AICA 3T06B 4D3ZA 2I2AA 2R86A 1RCFA 1LC3A 2HF8A 1U6JA 2J7KA 1QYCA 2YFKA 1W75A 2PH7A 3VX3A 1K4MA 1YQQA 1JQ5A 4IDPA 5GP1A 2WD9A 4LDRA 2F8SA 5CEEA 2MSEB 4DR7B 4GD3Q 3Q7TA 3WRYC 5GV8A 2DLDA 2LNDA 1WDKA 2N3ZA 4HCJA 5HBRA 1T4CB 2X6TA 1HQYE 1EVKA 3CY6A 2V6GA 1FNCA 4G01B 4UHEA 1RR6A 4NBLA 2OO5C 1RQNA 2B37A 1QE0A 3FPKA 2RGDA 4OJMX 5L3VA 2CNLA 3IHWA 4DG9A 4NEHB 1ZYUA 2FP3A 4QATA 1DBPA 1SCUA 1TVKB 3U7QB 2RG1A 3VPFA 1F6WA 4B7XA 1DC3A 1WCIB 4XQ0A 3PENA 3REGA 3UFXA 3PKJA 5CGZA 5LQAA 3KJIA 4GBJA 4DV7B 4F4FA 1J6UA 1JG1A 1PN3A 2D00A 1EA5A 2M6KA 3P5BA 3WOHA 1W4BA 4XUEA 4INZA 1C9NA 4CEJA 2R8EA 3UCXA 1YACA 3CZMA 1FP4A 1XP8A 3ITDA 5HZMA 3OPNA 4AJPA 3G1WA 5A3SA 4W7IA 4U5XA 3VU9A 4CM9A 4DLBA 5JSUA 2UZ3A 3EPKA 1DS6A 3D3WB 2BH2A 1HE8B 1V43A 4PHFA 4WZAB 4JJFA 3QLEA 3BIWA 5JMWA 1E2PA 4KIJA 3AY0A 3AJ9A 3MK31 1E79D 5EXEA 1EFRA 2CHVA 4FYVA 1JR3E 5IS2A 4NYIQ 2PA0A 1QH8B 1XRLA 3LQ4A 2XGMA 3DE1X 5IX8A 3B1XA 3WR5A 3ZWQA 5FYQA 3O92A 4QJBA 2UYQA 1SMKA 1JAHA 1HYEA 2C97A 1OTYA 3IAFA 5ALHA 2LTAA 3IMKA 1NSFA 3OCUA 1IOLA 3Q7IA 3V2HA 3BDAA 4FE4A 3X1JA 4YY3B 3FSRA 3OWOA 5G1NA 2DFPA 1HI9A 3FNEA 4RETA 4ARZA 1II0A 2ERYA 4B47A 3DEZA 3Q3EA 3F96A 3TLEA 4W7SA 1KO7A 4J91A 1UXHA 1FJ2A 1QTNA 1YCGA 3EDOA 4W8OA 1FTWA 4QWWA 1K6MA 1PGQA 5CB6A 1E9FA 5HDBB 4ENTA 4EKNB 3AM5A 1L9XA 3R0XA 1AQJA 1DJOA 3OCWA 4LYYA 2PR2A 4LVOA 1XALA 1K89A 1W59A 4GQWA 2HLPA 2ID7A 2RHJA 1RCUA 1B26A 3EN0A 1CEQA 1NR1A 2O1XA 2P8JA 2IYFA 3MWYW 3V42A 1E7RA 3GRVA 2HNAA 5JSHA 1SK9A 3MMZA 3TW8A 3BF8A 3ROFA 3V1NA 1QQAA 2PKRA 2X1MA 3JU3A 3EGWA 4DTIA 3QPDA 2YICA 1DIAA 3FGPA 2Y1XA 5SY4A 4EPVA 1UH5A 1X7WA 2QZJA 2G1UA 4QO8A 5F9FA 1L7PA 4JA0A 1NDUA 1T8RA 3IFSA 3KT8A 3OZFA 4LGCA 3WLLA 4C30A 3FHTA 2YVYA 5JPIA 1FTYA 4I1UA 5IDWA 3NTXA 1GPLA 2R7LA 2WA1A 3SEZA 4RO0A 4BRWA 4TZ6A 2RK3A 3RVOA 4D81A 3DVLA 3URMA 2HTFA 1VLJA 2C96A 2SCUB 3L7DA 5JVDB 2RJOA 1KPIA 3D7KA 1IK4A 4G6ZA 5T64A 1Y7TA 1BHQ1 2QAIA 4B0OA 1BMQA 2F9FA 3TSOA 2VP6A 1GTRA 2PUAA 3M6FA 1VA4A 4TLEA 1Y1RA 4TQGA 1TL7C 1NJGA 2Q3FA 3L82B 2B4KA 1KOLA 4JI1B 3RUEA 3G0HA 2H2AA 2JAOA 4Z3DA 3SVLA 1H2EA 3HXQA 3A14A 3ZXXA 4P53A 3OTWA 2R44A 4CKBB 5FOWA 5J9FA 2JA1A 1E5VA 2IUSA 3E53A 4Y1EA 1AXGA 4E6EA 3TQIA 1FVHA 2P0AA 3AF5A 3PICA 5KQRA 3V1UA 1JEAA 4F84A 4ARSA 1ZEMA 1XF9A 2CLSA 3CLTD 1NE7A 3DBIA 1CTQA 1EFHA 5D5HA 4ASUD 4DAOA 4KODA 5LMUB 3PLAE 1T6YA 3ZVLA 1I7DA 4I6JA 5B1HA 3H13A 1P2FA 1YQDA 4CG3A 1Q0RA 2FX2A 3R3UA 1QOPB 3O31A 3LP5A 3SFVA 2FR8C 1T6BY 1LPMA 1YVEI 2FW1A 2YYZA 3BK2A 5DNWA 5ALUA 2X19A 4MRMA 3AF4A 4S3MA 2Q5OA 1ATIA 2O2GA 2QRLA 2QS9A 3RSSA 1PVOA 2QRGA 2X0JA 1Q50A 1E63A 1XYYA 3B48A 3IAHA 3Q87B 4XSVA 1O08A 1EXMA 1UC4B 3EIXA 3OZUA 4GMKA 5DIFA 3WK5A 1V9LA 4NHEA 5CB4F 5D3MB 1G2QA 2GCIA 3VR6H 1CUUA 5K6RA 4FLMA 4A8TA 3ABSB 1UBMS 5EYPB 1FXWF 3G89A 2HEGA 3P0EA 4YUWA 1U8EA 1H0KA 4D96A 1R7RA 3P2YA 4DT1B 3PUZA 4KJXA 3OU7A 5T4BA 3K3PA 3MRVA 1SBNE 3N87A 1VMDA 3EVCA 3LVQE 1HMYA 4O2BA 2O8CA 5BQFA 4X64B 5HK8A 1T5SA 3GMDA 4BFCA 3PV0A 4YJ2F 3LC7O 4I55B 1QRUA 1SVSA 4OQYA 5FPPA 5AVUA 3VR4D 5CFLA 1E1LA 2CZCA 4CLRB 3ICPA 4JYPA 4WI1A 2GXQA 4BECA 1XROA 2UVQA 1XJWA 1GQFA 2QAGA 1U0HC 3JQ7B 4FDTA 4QECA 5C8VA 1V7ZA 3AEKB 1ECCA 2ODEA 4A73A 3LOUA 4L8LA 4M0EA 3SNKA 2JFHA 1PLLA 3FYHA 2E49A 5EN4A 2ANCA 2WU1A 1OXKB 2NV0A 1KXZA 4HATA 4ENSA 3NUQA 4G9GA 3BC1A 3EBLA 3AY6A 3FZNA 2PT9A 3I5YA 1E1DA 1MB4A 4PGFA 3UWSA 2HJRA 2XYQA 1FFHA 3E8MA 3ESAA 3ZV5A 4BVJA 3OA0A 2JGRA 1UBSB 1JHRA 2BOVA 3TDHC 3CPHA 2GHIA 2ZRCA 2XTNA 3PR1A 5HDQA 4BKRA 1M10A 2I76A 4TKUA 4D8TA 2VAMA 1U8UA 3DMTA 5CPBA 4YJ3B 5JRJA 3JATA 4AKEA 2IYWA 1OV4A 1CP2A 1PJSA 1IBSA 1X1TA 2D5BA 4KN9S 1Z7YA 3TMKA 4J75A 4MUMA 4TT3D 2QIPA 2OUXA 2XUFA 3EPRA 1NIPA 3F97A 4KUHA 4PLPA 5LXTF 3ONDA 3KQQA 2BP7A 1S01A 1ESCA 1Q1EA 1WZUA 3N8HA 4YFVA 4TGLA 3TI7A 4FYMA 3CEPB 4NLLA 4BYMA 1GY8A 2JCSA 2J9LA 1XKTA 3PUVA 4GAEA 1OROA 2GX6A 2PSJA 1XAHA 5ALWA 5CNMA 4AXXA 5EP3A 1BN6A 3U6BA 3H6KA 2J33A 2HUNA 3FJYA 2E4ZA 3HHEA 3EBPA 1TZJA 1RBZA 3GQBA 2Y1CA 3N8NA 2A5FA 3S40A 3HXLA 3UJBA 2E37A 4A6PA 2BFFB 3KLNA 1EDBA 3I9V1 2XCOA 1ETHA 3MELA 1QP4A 3AM1A 1JG3A 1YC2A 4BNHA 4R1QA 3VUEA 4CF3A 1FC0A 2G8LA 4JC5A 1EWTA 2XNCA 3V3KA 1GAJA 2BFEB 3CUYA 2XV1A 3ETDA 1VLZA 3GDGA 4Y6PA 4GNKA 4LFCB 5KQLA 2UYYA 2MSCB 5E4TA 5TQ0A 3RUAA 3IQEA 4HB2A 4CL3A 4MCHA 3S2GA 1V9SA 3LDUA 2H4ZA 3HU5A 2W6JA 3EZYA 3T7KA 1JIUA 1W1UA 2AR0A 2HD4A 4GHWA 4PAWA 3WMGA 2HW8A 5FWXA 3WWCA 2A0WA 2X6RA 3TAUA 4EELA 4MAMA 2QUIA 1NFRA 1FTGA 4C0BA 4LSWA 3OZXA 3DLAA 4M1OA 1XVUA 5EMKA 5C2JB 3AVVA 4BX2A 1DOZA 1TLLA 3L02A 1AY0A 1FMLA 4J3NA 3SXUB 2Q4TA 3G5LA 1ABFA 5TVKA 4G5FA 1QMGA 3VRHA 1JFLA 1WU8A 3R5KA 3VHRA 1YA6A 3P26A 3GYBA 4E2WA 3I2IA 1Y8RA 1EI9A 4OKIA 2RONA 4OUDA 1GR1A 1Y8ZA 3TQHA 2QTMA 3CNHA 3LT2A 3ITNA 1T8WA 2H2FA 1NBME 3B53X 3DWFA 1O95C 3R2JA 3HKBA 4P32A 3RVBA 1U7UA 3MBKA 4FSHA 1E2IA 1VJCA 4K87A 5DYYA 3TR5A 2YZKA 3JD2A 3UMJA 4JU8A 2LE0A 1YOVA 1XZCA 4RD4A 3ZQKA 2HLNA 5G1OA 3TAHA 4DDWA 1HNZB 3TINA 3EFOA 1YE5A 1DQPA 1YRHA 3LWBA 5IAGA 3RVMA 1OOEA 2CMKA 3FOCA 4Y0NA 4BMZA 5ULLA 2QQEA 2XQVA 2HRDA 2YZ2A 3EEYA 3KZMA 4UE3S 3T52A 3K2VA 4MVXA 1UBFA 3DAFA 3CLKA 4BEJA 4JI7B 5HPYB 1KAHA 1PCXA 3WAGA 4FYXA 4CM8A 3AHGA 3EYAA 1E6CA 4ZEXA 1SUWA 5AW2A 5TEVA 2FDRA 3JYPA 2RH5A 4FYWA 3KXPA 5TT1A 1NVEA 2QN8A 3QXJA 2XKBA 2BUCA 3H18A 4ZP1A 5JTUA 4IOMA 2B3DA 1GLNA 4OQXA 4H18A 4RS4A 3W90A 1R4AA 4CM6A 1KZYC 4NZ9A 7GPBA 3E5RA 3PE3A 3WGNA 1OZGA 3MPUA 4FHCA 4U6QA 5DP1A 4TMVA 3WYBA 2YY5A 1M5TA 4KTVE 4TVBA 3QU7A 1JF8A 4ENQA 4FC7A 3WRYA 1JXAA 4PN3A 1JJBA 3CW9A 4QXPA 1GCOA 2OO5A 5DK6A 2PSFA 4ERXA 4U7JA 4Z3KA 1VKZA 1AV6A 3TLCA 2ZAMA 3BGWA 2AHOA 4DLRA 4G26A 4R69A 1I6KA 1E4OA 4CKXA 4DOMA 1TCBA 3DXZA 2GEDA 1M2EA 4K6HA 4M9UA 5EQTA 4X00A 1U2PA 3KVYA 5AW5A 1L8QA 2JFOA 4RH0A 3RWMB 3ZYCA 3I0MA 3VZBA 1G7CA 1KJ9A 3D2BA 4E2FA 3IP9A 1Z7EA 3QU4A 2XHEA 2X4GA 1DADA 3BXPA 4CF4A 4K9SA 1R64A 4PNEA 4RTOA 4YMVA 3LCUA 4ZZ1A 3EGOA 1R3DA 4X1IB 2FSSA 1TAUA 2W2NA 3DZJA 2O3RA 3H3XA 1L7XA 3P0JA 2YY6A 5JDIA 3I32A 2WAXA 4OA5A 3WBBA 4IINA 3FD8A 3NH9A 3O38A 3Q98A 5ALMA 1CR6A 1ZPDA 2FRDC 3NPAA 5E2BA 1J2RA 4PXSA 1GAQA 2Z57A 4BZPA 3R20A 3A2NA 1ENZA 2PRYA 5BQ5A 5JD5A 1V6SA 3NKVA 3HKEB 5FO1A 3UYKA 1Z36A 5JADA 5L51A 4E1AA 1OA1A 4J4TA 4ZHQA 5ECYA 4TUYA 1SRQA 1FUEA 3L0SA 1PQWA 2BSXA 3DDWA 2OGUA 2R6CA 5CD9A 5TT0A 1M6WA 4V2UA 3OZRA 3DNFA 4HVTA 3OICA 1TOAA 2YVKA 4LJRA 1SOWA 3ENKA 4IVPA 2ZI7A 3IR5A 4K2HA 1X1CA 1KI6A 3GD7A 1E7MA 2FZ4A 3MIIA 2PNJA 3ZCXA 3L4KA 4Z3OA 1MHTA 3K2EA 2HLHA 4PW0A 3N0WA 2ZRFA 1VKNA 5DN6D 1K8RA 2QKYA 5JMOA 3AVOA 1DLIA 1W0JD 4HXGA 3Q9SA 3AEQB 5KYGA 4HAWA 4OI2A 1T2EA 2OV1A 3O74A 1OXUA 1KI7A 1RE1A 4CIBA 1QV9A 1KXJA 3OLQA 2ZI4A 3CLUD 4UTRA 3ED5A 2NVWA 2J0SA 2VJMB 1G18A 3I23A 2GN1A 4G89A 2F8LA 4ZT7A 4Y67A 4V0ME 2HWXA 1Q2UA 5EINA 4QUEA 2V3CC 5K3DA 1IUNA 4TKLA 5TMEA 5EUCA 1I3KA 1R8YA 4D80A 3G17A 3ZI0A 3NJRA 4BNZA 4Q3CA 5IVKA 1AVTA 2H1CA 4MS3A 1ACLA 3THSA 4E4RA 4IF4A 1U63A 3LS2A 4EO9A 4BAGA 4EGCB 2BGUA 5EPOA 5EHZA 1WPXA 5HIAA 1HNWB 1TO1E 2GD2A 3PT9A 1P3DA 4XA8A 3SC2B 4ENPA 4L3VA 3E1GA 1ZVJA 3FMPB 2O2HA 1NYQA 2A35A 3A1DA 5TQ2A 1ZGBA 3KOYA 2O8EB 4JU9A 3LP6A 3ACDA 3NVDA 2V6FA 2M6SA 1XTJA 2HFJA 5IC4A 1F12A 1YRYE 3N39C 4FP9A 5THQA 1TZMA 1FUIA 1J7JA 2EFJA 5D5QA 3JQ6A 3ABRB 1IIBA 4D3DA 3O3MB 1U90A 1GL6A 4FT4A 4RU1A 4UE6A 3TNJA 3VR6A 2IEAA 1V2HE 5CBPA 4BTEA 5GZ6A 3QEOA 3ICOA 4KOAA 2ZYUX 3D54D 2E4AA 2VDJA 3F3MA 1J7KA 4OJTA 1TKAA 1YZUA 4RH1A 5TS2A 2C2XA 2HSJA 2ZSDA 4CBVA 3Q7EA 2Z2XA 1FOEB 3S68A 1E0AA 3BK1A 2P6NA 2R9VA 3T12A 1K9SA 2FR8A 2WPNA 1G7SA 3K6JA 3OLXA 4HH1A 4PYMA 5C35A 1M34A 1ORDA 1ULUA 1LV7A 1TYAE 3CGWA 4EQ6A 3N2EA 3Q4GA 5CEFA 1GVNB 4ZTZB 5F98A 4ZU6X 2F3PA 2W2VA 2XE6A 4MKZA 1LWOA 1T43A 2QW0X 4HFMA 5H80A 4L57A 3VQTA 1OJLA 3CVOA 3M4YA 1WZCA 2CV1A 2EX0A 3F6PA 1T36B 1UPBA 1ZD1A 4QA9A 1S2DA 3SFZA 4DQVA 3KSDO 1JIXA 3WO1A 3EWNA 3W5BA 1JIQA 3E84A 3JQ8A 3FV6A 1E1RD 2WA2A 3ILHA 3CINA 4UM7A 1TA4A 3LX5A 1D04A 4Y98A 4IJQA 3I8XA 4US2R 5E9AA 2C0QA 1EAMA 2Y9PB 4UAVA 1PGPA 2XUQA 3H4TA 1LJUA 4G4SP 2UVPB 1KRHA 1VPVA 3MOIA 1RS0A 1YA4A 4TSFD 3LDAA 1XZKA 2TMGA 3QWAA 3ZU4A 4PU0A 2VTDA 2ERCA 2ZYWX 1M7HA 2RAPA 2Y1KA 3OURA 4HPJB 5SY6A 3UK0A 4EJSB 3OAAA 5JXGA 3CIFA 4FEGA 3WHPA 4C6TB 1QQ6A 1BQEA 2TMYA 1MA3A 3FMOB 4G1VA 1KZGB 1SIWA 4PYNA 4NOLA 3K6SA 2OCAA 1QDEA 2QT1A 3SS7X 2PWYA 4DGSA 1KETA 4UD2A 3PUJA 2CVQA 2V6BA 3MUFA 1E5DA 3RHZA 3TDNA 4BRSA 5DBFA 2YX1A 4FRYA 4JELA 4Z4CA 3CMCO 1P17A 13PKA 2PSHA 2X42A 3LUJA 3A7DA 4DMMA 2MINA 1F1BA 2O14A 3RRBA 4QYSA 4AZWA 5KYWB 3U56A 3CZCA 1VYHA 4QEKA 3Q10A 2VJYA 2IFTA 2XUPA 3II6X 1D5CA 5AKJA 3RV3A 3UV7A 2P2CA 3UGQA 4KVZA 2O59A 1C3LA 1XFDA 3HFJA 4DWJA 2CNBA 4J0QA 4EBFA 2FPMA 1O8CA 4E31A 3QHPA 2OMEA 4BNFA 4F5WA 4L95C 4UHHA 1UZMA 4AJEA 4B6FA 2WG2A 4BNGA 5BV7A 1U3TA 4HJXA 5M04A 2PGLA 2FPIA 3I2FA 5K3AA 2QF7A 4P4GA 4EF4A 1NRIA 2B25A 3VO1A 1DO2A 4MUYA 1CERA 1JDBC 1N6OA 1BQ4A 3T7CA 4DLTA 5C1PA 5JSFA 3DZGA 1ID8A 2CHGA 4IXNA 2AEJA 2OQVA 2GYWA 1T8UA 4P4NA 4TSRA 5BVHB 1GNVA 2VDOB 3IJRA 4CUJA 4HYTA 2J3QA 2EQ5A 1COZA 1IZ7A 2GNAA 4GI7A 4K9OA 4IYSA 2B5OA 3G3EA 3YASA 3MHPA 4HF7A 4I1YA 4FYPA 4BMXA 5KDOA 4REMA 4YR9A 3U4QA 1ZO8A 3E7WA 4ZT6A 4B79A 4D9NA 1DBVO 2YYYA 4IG9A 4AWBA 4YUZA 3FPEA 1MORA 2OHJA 2OORA 3OX1A 1MABB 1L3IA 3S7TA 2C4UA 2I91A 3GJ7A 2WOJA 1QC5B 2QQFA 3N7TA 2OBLA 3P9KA 3C8ZA 5IDQA 3E15A 4RIEA 4DDKA 1UXGA 1VL5A 1Y3BE 2FQXA 4M60A 4TXNA 5ITWA 1GZDA 3AVWA 2I3ZA 1ZCZA 3PQ5A 5BOSA 1JPNA 2JB9A 4RV4A 5LFAA 3SICE 1P4GA 4B4DA 1AE1A 3O8OA 3IP1A 4KXQA 4MQMA 1ZA1A 3JQ9C 4S0XA 3ZU2A 3GUCA 3DBLB 5JW6A 2QJTA 2EF7A 4I4TA 4URFA 4DPMA 2WSLA 3HLTA 3ICEA 3KX2A 1OHHA 3OLVA 4K7JA 3QMVA 2CLCX 3U4AA 2Z4SA 3MJCA 3IAS6 3K0EA 1YRBA 3M5PA 2GPTA 3P20A 3GFOA 1XXHA 2RHCA 2GA9A 3I37X 5KOHB 1NN0A 5U4QA 2YWHA 2FEKA 1VXOA 4NI5A 1BHJA 5HUQA 1JVSA 4GXNA 1NF9A 1WJGA 2NO7A 4TQ9A 4A91A 1FP7A 2RGRA 4Z8XA 2K4MA 4LF7B 1ZN2A 4OYYA 4PLGA 4N6OA 5BN5B 2ZUEA 2AW5A 3RSQA 1A9YA 4CG1A 2FSUA 3RC3A 2HYIC 1CULC 2A9KA 5KREA 4RXTA 3SHTA 5HRUA 4AN1A 3MYRA 4ZTUB 2GAAA 2WMDA 2JFYA 2GJKA 1EK0A 4YI5A 3MMNA 3P8ZA 3UMSA 1NQAO 3WGGA 1SXQA 2QLJA 521PA 2PZFA 1THTA 4ZK6A 2CXTA 2IEYA 2QRVA 1VLLA 3AOEC