4P1OA

Crystal structure of the bateman domain of murine magnesium transporter cnnm2 bound to atp-mg
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
152
structure length
152
Chain Sequence
MEELNIIQGALELRTKTVEDVMTPLRDCFMITGEAILDFNTMSEIMESGYTRIPVFEGERSNIVDLLFVKDLAFVDPDDCTPLKTITKFYNHPLHFVFNDTKLDAMLEEFKKGKSHLAIVQRVNNEGEGDPFYEVLGIVTLEDVIEEIIKSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Metal transporter CNNM2
publication title Structural and ligand binding properties of the Bateman domain of human magnesium transporters CNNM2 and CNNM4
rcsb
source organism Mus musculus
total genus 42
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 4p1oA00
4UUUA 4O9KA 1O50A 2QRCE 2YVZA 2YZQA 4NOCA 2NYEA 5IIPA 3GBYA 3PC3A 4IY3A 2UV4A 3PC4A 3K6EA 4IY2A 2QLVC 2UV5A 1Y5HA 4FXSA 5K23C 2OOYE 2OOXE 4L27A 4L3VA 4L28A 5MMZA 1XKFA 2O16A 4IY0A 4L0DA 4DQWA 5K22B 3OCMA 2EF7A 3SL7A 5LXQA 2EMQA 2NYCA 2OUXA 3LQNA 3KH5A 3FWSA 3OI8A 3LFZA 1PBJA 5K25C 3FV6A 3OCOA 4HG0A 4IYSA 2D4ZA 4ESYA 4GQYA 2QH1A 3KPDA 4IY4A 5K24C 2QRDE 4GQVA 3L31A 5KS7A 2UV7A 3K2VA 2YZIA 2P9MA 2QREE 2UV6A 3FWRA 2RC3A 3FNAA 2RIHA 3KPBA 3I8NA 2RIFA 3ORGA 3HF7A 3FHMA 1YAVA 3KXRA 3LV9A 3DDJA 4FRYA 3PC2A 2YVYA 4ESYB 3L2BA 4COOA 2YVXA 3LHHA 2PFIA 1PVMA 4P1OA 4P1GA 2QR1E 3TE5C 4GQWA 2ZY9A 3KPCA 3T4NC 3TDHC 4PCUA
chains in the Genus database with same CATH superfamily
4UUUA 4O9KA 1O50A 2QRCE 2YVZA 2YZQA 4NOCA 2NYEA 5IIPA 3GBYA 3PC3A 4IY3A 2UV4A 3PC4A 3K6EA 4IY2A 2QLVC 2UV5A 1Y5HA 4FXSA 5K23C 2OOYE 2OOXE 4L27A 4L3VA 4L28A 5MMZA 1XKFA 2O16A 4IY0A 4L0DA 4DQWA 5K22B 3OCMA 2EF7A 3SL7A 2J9LA 5LXQA 2EMQA 2NYCA 2OUXA 3LQNA 2JA3A 3KH5A 3FWSA 3OI8A 3LFZA 1PBJA 5K25C 3FV6A 3OCOA 4HG0A 4IYSA 2D4ZA 4ESYA 4GQYA 2QH1A 3KPDA 4IY4A 5K24C 2QRDE 4GQVA 3L31A 5KS7A 2UV7A 3K2VA 2YZIA 2P9MA 2QREE 2UV6A 3FWRA 2RC3A 3FNAA 2RIHA 3KPBA 3I8NA 2RIFA 3ORGA 3HF7A 3FHMA 1YAVA 3KXRA 3LV9A 3DDJA 4FRYA 3PC2A 2YVYA 4ESYB 3L2BA 4COOA 2YVXA 3LHHA 2PFIA 1PVMA 4P1OA 4P1GA 2QR1E 3TE5C 4GQWA 2ZY9A 3KPCA 3T4NC 3TDHC 4PCUA
chains in the Genus database with same CATH topology
4UUUA 4O9KA 1O50A 2QRCE 2YVZA 2YZQA 4NOCA 2NYEA 5IIPA 3GBYA 3PC3A 4IY3A 2UV4A 3PC4A 3K6EA 4IY2A 2QLVC 2UV5A 1Y5HA 4FXSA 5K23C 2OOYE 2OOXE 4L27A 4L3VA 4L28A 5MMZA 1XKFA 2O16A 4IY0A 4L0DA 4DQWA 5K22B 3OCMA 2EF7A 3SL7A 2J9LA 5LXQA 2EMQA 2NYCA 2OUXA 3LQNA 2JA3A 3KH5A 3FWSA 3OI8A 3LFZA 1PBJA 5K25C 3FV6A 3OCOA 4HG0A 4IYSA 2D4ZA 4ESYA 4GQYA 2QH1A 3KPDA 4IY4A 5K24C 2QRDE 4GQVA 3L31A 5KS7A 2UV7A 3K2VA 2YZIA 2P9MA 2QREE 2UV6A 3FWRA 2RC3A 3FNAA 2RIHA 3KPBA 3I8NA 2RIFA 3ORGA 3HF7A 3FHMA 1YAVA 3KXRA 3LV9A 3DDJA 4FRYA 3PC2A 2YVYA 4ESYB 3L2BA 4COOA 2YVXA 3LHHA 2PFIA 1PVMA 4P1OA 4P1GA 2QR1E 3TE5C 4GQWA 2ZY9A 3KPCA 3T4NC 3TDHC 4PCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UUU A;  4O9K A;  1O50 A;  2QRC E;  2YVZ A;  2YZQ A;  4NOC A;  2NYE A;  5IIP A;  3GBY A;  3PC3 A;  4IY3 A;  2UV4 A;  3PC4 A;  3K6E A;  4IY2 A;  2QLV C;  2UV5 A;  1Y5H A;  4FXS A;  5K23 C;  2OOY E;  2OOX E;  4L27 A;  4L3V A;  4L28 A;  5MMZ A;  1XKF A;  2O16 A;  4IY0 A;  4L0D A;  4DQW A;  5K22 B;  3OCM A;  2EF7 A;  3SL7 A;  5LXQ A;  2EMQ A;  2NYC A;  2OUX A;  3LQN A;  3KH5 A;  3FWS A;  3OI8 A;  3LFZ A;  1PBJ A;  5K25 C;  3FV6 A;  3OCO A;  4HG0 A;  4IYS A;  2D4Z A;  4ESY A;  4GQY A;  2QH1 A;  3KPD A;  4IY4 A;  5K24 C;  2QRD E;  4GQV A;  3L31 A;  5KS7 A;  2UV7 A;  3K2V A;  2YZI A;  2P9M A;  2QRE E;  2UV6 A;  3FWR A;  2RC3 A;  3FNA A;  2RIH A;  3KPB A;  3I8N A;  2RIF A;  3ORG A;  3HF7 A;  3FHM A;  1YAV A;  3KXR A;  3LV9 A;  3DDJ A;  4FRY A;  3PC2 A;  2YVY A;  4ESY B;  3L2B A;  4COO A;  2YVX A;  3LHH A;  2PFI A;  1PVM A;  4P1O A;  4P1G A;  2QR1 E;  3TE5 C;  4GQW A;  2ZY9 A;  3KPC A;  3T4N C;  3TDH C;  4PCU A; 
#chains in the Genus database with same CATH topology
 4UUU A;  4O9K A;  1O50 A;  2QRC E;  2YVZ A;  2YZQ A;  4NOC A;  2NYE A;  5IIP A;  3GBY A;  3PC3 A;  4IY3 A;  2UV4 A;  3PC4 A;  3K6E A;  4IY2 A;  2QLV C;  2UV5 A;  1Y5H A;  4FXS A;  5K23 C;  2OOY E;  2OOX E;  4L27 A;  4L3V A;  4L28 A;  5MMZ A;  1XKF A;  2O16 A;  4IY0 A;  4L0D A;  4DQW A;  5K22 B;  3OCM A;  2EF7 A;  3SL7 A;  2J9L A;  5LXQ A;  2EMQ A;  2NYC A;  2OUX A;  3LQN A;  2JA3 A;  3KH5 A;  3FWS A;  3OI8 A;  3LFZ A;  1PBJ A;  5K25 C;  3FV6 A;  3OCO A;  4HG0 A;  4IYS A;  2D4Z A;  4ESY A;  4GQY A;  2QH1 A;  3KPD A;  4IY4 A;  5K24 C;  2QRD E;  4GQV A;  3L31 A;  5KS7 A;  2UV7 A;  3K2V A;  2YZI A;  2P9M A;  2QRE E;  2UV6 A;  3FWR A;  2RC3 A;  3FNA A;  2RIH A;  3KPB A;  3I8N A;  2RIF A;  3ORG A;  3HF7 A;  3FHM A;  1YAV A;  3KXR A;  3LV9 A;  3DDJ A;  4FRY A;  3PC2 A;  2YVY A;  4ESY B;  3L2B A;  4COO A;  2YVX A;  3LHH A;  2PFI A;  1PVM A;  4P1O A;  4P1G A;  2QR1 E;  3TE5 C;  4GQW A;  2ZY9 A;  3KPC A;  3T4N C;  3TDH C;  4PCU A; 
#chains in the Genus database with same CATH homology
 4UUU A;  4O9K A;  1O50 A;  2QRC E;  2YVZ A;  2YZQ A;  4NOC A;  2NYE A;  5IIP A;  3GBY A;  3PC3 A;  4IY3 A;  2UV4 A;  3PC4 A;  3K6E A;  4IY2 A;  2QLV C;  2UV5 A;  1Y5H A;  4FXS A;  5K23 C;  2OOY E;  2OOX E;  4L27 A;  4L3V A;  4L28 A;  5MMZ A;  1XKF A;  2O16 A;  4IY0 A;  4L0D A;  4DQW A;  5K22 B;  3OCM A;  2EF7 A;  3SL7 A;  2J9L A;  5LXQ A;  2EMQ A;  2NYC A;  2OUX A;  3LQN A;  2JA3 A;  3KH5 A;  3FWS A;  3OI8 A;  3LFZ A;  1PBJ A;  5K25 C;  3FV6 A;  3OCO A;  4HG0 A;  4IYS A;  2D4Z A;  4ESY A;  4GQY A;  2QH1 A;  3KPD A;  4IY4 A;  5K24 C;  2QRD E;  4GQV A;  3L31 A;  5KS7 A;  2UV7 A;  3K2V A;  2YZI A;  2P9M A;  2QRE E;  2UV6 A;  3FWR A;  2RC3 A;  3FNA A;  2RIH A;  3KPB A;  3I8N A;  2RIF A;  3ORG A;  3HF7 A;  3FHM A;  1YAV A;  3KXR A;  3LV9 A;  3DDJ A;  4FRY A;  3PC2 A;  2YVY A;  4ESY B;  3L2B A;  4COO A;  2YVX A;  3LHH A;  2PFI A;  1PVM A;  4P1O A;  4P1G A;  2QR1 E;  3TE5 C;  4GQW A;  2ZY9 A;  3KPC A;  3T4N C;  3TDH C;  4PCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...