4GQVA

Crystal structure of cbs-pair protein, cbsx1 from arabidopsis thaliana
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
156
structure length
122
Chain Sequence
VYTVGEFMTKKEDLHVVKPTTTVDEALELLVENRITGFPVIDEDWKLVGLVSDYDLLALDGKLVGDLMTPAPLVVEEKTNLEDAAKILLETKYRRLPVVDSDGKLVGIITRGNVVRAALQIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords CBS domain-containing protein CBSX1, chloroplastic
publication title Crystal structure of the single cystathionine beta-synthase domain-containing protein CBSX1 from Arabidopsis thaliana
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 33
structure length 122
sequence length 156
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 4gqvA00
3PC4A 3ORGA 2PFIA 4COOA 2QR1E 5K23C 3LHHA 2UV5A 3OCMA 5K24C 2OOYE 2NYEA 3FWRA 2QRCE 3L2BA 2UV6A 4GQWA 3TE5C 4IY2A 4O9KA 2UV7A 3PC3A 2YZIA 3SL7A 2D4ZA 2O16A 3GBYA 3LFZA 2UV4A 4L3VA 1Y5HA 4PCUA 3KPDA 3OI8A 1PVMA 3K6EA 4L0DA 3L31A 5K25C 2QLVC 2NYCA 3KPCA 3LV9A 3OCOA 2YVYA 3I8NA 5LXQA 3TDHC 4ESYA 3FWSA 2QREE 4L27A 4IYSA 2OOXE 4FXSA 4P1OA 2RC3A 4IY0A 5K22B 2QRDE 3HF7A 4ESYB 2RIHA 2QH1A 2YVXA 1PBJA 2ZY9A 4UUUA 4IY4A 1O50A 3KXRA 5IIPA 4P1GA 2YZQA 3FV6A 5KS7A 4FRYA 4IY3A 3FHMA 2RIFA 4L28A 5MMZA 4NOCA 2EMQA 1XKFA 4GQYA 3PC2A 4GQVA 3DDJA 4DQWA 2YVZA 3T4NC 3KH5A 3LQNA 1YAVA 2OUXA 3FNAA 3KPBA 4HG0A 2EF7A 3K2VA 2P9MA
chains in the Genus database with same CATH superfamily
3PC4A 3ORGA 2PFIA 4COOA 2QR1E 5K23C 3LHHA 2UV5A 3OCMA 5K24C 2OOYE 2NYEA 3FWRA 2QRCE 3L2BA 2UV6A 4GQWA 3TE5C 2JA3A 4IY2A 4O9KA 2UV7A 3PC3A 2YZIA 3SL7A 2D4ZA 2O16A 3GBYA 3LFZA 2UV4A 4L3VA 1Y5HA 4PCUA 2J9LA 3KPDA 3OI8A 1PVMA 3K6EA 4L0DA 3L31A 5K25C 2QLVC 2NYCA 3KPCA 3LV9A 3OCOA 2YVYA 3I8NA 5LXQA 3TDHC 4ESYA 3FWSA 2QREE 4L27A 4IYSA 2OOXE 4FXSA 4P1OA 2RC3A 4IY0A 5K22B 2QRDE 3HF7A 4ESYB 2RIHA 2QH1A 2YVXA 1PBJA 2ZY9A 4UUUA 4IY4A 1O50A 3KXRA 5IIPA 4P1GA 2YZQA 3FV6A 5KS7A 4FRYA 4IY3A 3FHMA 2RIFA 4L28A 5MMZA 4NOCA 2EMQA 1XKFA 4GQYA 3PC2A 4GQVA 3DDJA 4DQWA 2YVZA 3T4NC 3KH5A 3LQNA 1YAVA 2OUXA 3FNAA 3KPBA 4HG0A 2EF7A 3K2VA 2P9MA
chains in the Genus database with same CATH topology
3PC4A 3ORGA 2PFIA 4COOA 2QR1E 5K23C 3LHHA 2UV5A 3OCMA 5K24C 2OOYE 2NYEA 3FWRA 2QRCE 3L2BA 2UV6A 4GQWA 3TE5C 2JA3A 4IY2A 4O9KA 2UV7A 3PC3A 2YZIA 3SL7A 2D4ZA 2O16A 3GBYA 3LFZA 2UV4A 4L3VA 1Y5HA 4PCUA 2J9LA 3KPDA 3OI8A 1PVMA 3K6EA 4L0DA 3L31A 5K25C 2QLVC 2NYCA 3KPCA 3LV9A 3OCOA 2YVYA 3I8NA 5LXQA 3TDHC 4ESYA 3FWSA 2QREE 4L27A 4IYSA 2OOXE 4FXSA 4P1OA 2RC3A 4IY0A 5K22B 2QRDE 3HF7A 4ESYB 2RIHA 2QH1A 2YVXA 1PBJA 2ZY9A 4UUUA 4IY4A 1O50A 3KXRA 5IIPA 4P1GA 2YZQA 3FV6A 5KS7A 4FRYA 4IY3A 3FHMA 2RIFA 4L28A 5MMZA 4NOCA 2EMQA 1XKFA 4GQYA 3PC2A 4GQVA 3DDJA 4DQWA 2YVZA 3T4NC 3KH5A 3LQNA 1YAVA 2OUXA 3FNAA 3KPBA 4HG0A 2EF7A 3K2VA 2P9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PC4 A;  3ORG A;  2PFI A;  4COO A;  2QR1 E;  5K23 C;  3LHH A;  2UV5 A;  3OCM A;  5K24 C;  2OOY E;  2NYE A;  3FWR A;  2QRC E;  3L2B A;  2UV6 A;  4GQW A;  3TE5 C;  4IY2 A;  4O9K A;  2UV7 A;  3PC3 A;  2YZI A;  3SL7 A;  2D4Z A;  2O16 A;  3GBY A;  3LFZ A;  2UV4 A;  4L3V A;  1Y5H A;  4PCU A;  3KPD A;  3OI8 A;  1PVM A;  3K6E A;  4L0D A;  3L31 A;  5K25 C;  2QLV C;  2NYC A;  3KPC A;  3LV9 A;  3OCO A;  2YVY A;  3I8N A;  5LXQ A;  3TDH C;  4ESY A;  3FWS A;  2QRE E;  4L27 A;  4IYS A;  2OOX E;  4FXS A;  4P1O A;  2RC3 A;  4IY0 A;  5K22 B;  2QRD E;  3HF7 A;  4ESY B;  2RIH A;  2QH1 A;  2YVX A;  1PBJ A;  2ZY9 A;  4UUU A;  4IY4 A;  1O50 A;  3KXR A;  5IIP A;  4P1G A;  2YZQ A;  3FV6 A;  5KS7 A;  4FRY A;  4IY3 A;  3FHM A;  2RIF A;  4L28 A;  5MMZ A;  4NOC A;  2EMQ A;  1XKF A;  4GQY A;  3PC2 A;  4GQV A;  3DDJ A;  4DQW A;  2YVZ A;  3T4N C;  3KH5 A;  3LQN A;  1YAV A;  2OUX A;  3FNA A;  3KPB A;  4HG0 A;  2EF7 A;  3K2V A;  2P9M A; 
#chains in the Genus database with same CATH topology
 3PC4 A;  3ORG A;  2PFI A;  4COO A;  2QR1 E;  5K23 C;  3LHH A;  2UV5 A;  3OCM A;  5K24 C;  2OOY E;  2NYE A;  3FWR A;  2QRC E;  3L2B A;  2UV6 A;  4GQW A;  3TE5 C;  2JA3 A;  4IY2 A;  4O9K A;  2UV7 A;  3PC3 A;  2YZI A;  3SL7 A;  2D4Z A;  2O16 A;  3GBY A;  3LFZ A;  2UV4 A;  4L3V A;  1Y5H A;  4PCU A;  2J9L A;  3KPD A;  3OI8 A;  1PVM A;  3K6E A;  4L0D A;  3L31 A;  5K25 C;  2QLV C;  2NYC A;  3KPC A;  3LV9 A;  3OCO A;  2YVY A;  3I8N A;  5LXQ A;  3TDH C;  4ESY A;  3FWS A;  2QRE E;  4L27 A;  4IYS A;  2OOX E;  4FXS A;  4P1O A;  2RC3 A;  4IY0 A;  5K22 B;  2QRD E;  3HF7 A;  4ESY B;  2RIH A;  2QH1 A;  2YVX A;  1PBJ A;  2ZY9 A;  4UUU A;  4IY4 A;  1O50 A;  3KXR A;  5IIP A;  4P1G A;  2YZQ A;  3FV6 A;  5KS7 A;  4FRY A;  4IY3 A;  3FHM A;  2RIF A;  4L28 A;  5MMZ A;  4NOC A;  2EMQ A;  1XKF A;  4GQY A;  3PC2 A;  4GQV A;  3DDJ A;  4DQW A;  2YVZ A;  3T4N C;  3KH5 A;  3LQN A;  1YAV A;  2OUX A;  3FNA A;  3KPB A;  4HG0 A;  2EF7 A;  3K2V A;  2P9M A; 
#chains in the Genus database with same CATH homology
 3PC4 A;  3ORG A;  2PFI A;  4COO A;  2QR1 E;  5K23 C;  3LHH A;  2UV5 A;  3OCM A;  5K24 C;  2OOY E;  2NYE A;  3FWR A;  2QRC E;  3L2B A;  2UV6 A;  4GQW A;  3TE5 C;  2JA3 A;  4IY2 A;  4O9K A;  2UV7 A;  3PC3 A;  2YZI A;  3SL7 A;  2D4Z A;  2O16 A;  3GBY A;  3LFZ A;  2UV4 A;  4L3V A;  1Y5H A;  4PCU A;  2J9L A;  3KPD A;  3OI8 A;  1PVM A;  3K6E A;  4L0D A;  3L31 A;  5K25 C;  2QLV C;  2NYC A;  3KPC A;  3LV9 A;  3OCO A;  2YVY A;  3I8N A;  5LXQ A;  3TDH C;  4ESY A;  3FWS A;  2QRE E;  4L27 A;  4IYS A;  2OOX E;  4FXS A;  4P1O A;  2RC3 A;  4IY0 A;  5K22 B;  2QRD E;  3HF7 A;  4ESY B;  2RIH A;  2QH1 A;  2YVX A;  1PBJ A;  2ZY9 A;  4UUU A;  4IY4 A;  1O50 A;  3KXR A;  5IIP A;  4P1G A;  2YZQ A;  3FV6 A;  5KS7 A;  4FRY A;  4IY3 A;  3FHM A;  2RIF A;  4L28 A;  5MMZ A;  4NOC A;  2EMQ A;  1XKF A;  4GQY A;  3PC2 A;  4GQV A;  3DDJ A;  4DQW A;  2YVZ A;  3T4N C;  3KH5 A;  3LQN A;  1YAV A;  2OUX A;  3FNA A;  3KPB A;  4HG0 A;  2EF7 A;  3K2V A;  2P9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...