3I8NA

A domain of a conserved functionally known protein from vibrio parahaemolyticus rimd 2210633.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
124
structure length
124
Chain Sequence
PVTQVMTPRPVVFRVDATMTINEFLDKHKDTPFSRPLVYSEQKDNIIGFVHRLELFKMQQSGSGQKQLGAVMRPIQVVLNNTALPKVFDQMMTHRLQLALVVDEYGTVLGLVTLEDIFEHLVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A domain of a conserved functionally known protein from Vibrio parahaemolyticus RIMD 2210633.
rcsb
molecule keywords uncharacterized protein VP2912
molecule tags Structural genomics, unknown function
source organism Vibrio parahaemolyticus
total genus 30
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 3i8nA00
2YVXA 3KH5A 2NYEA 4IY2A 3K2VA 3TDHC 2YZQA 5K23C 3K6EA 4GQWA 2QRCE 3HF7A 2NYCA 3GBYA 4O9KA 2YZIA 3FV6A 3LQNA 4ESYB 3T4NC 1XKFA 3FHMA 3TE5C 2UV5A 4IYSA 4L3VA 5MMZA 2RIHA 4GQYA 4HG0A 3KPCA 4L27A 2EMQA 3SL7A 2UV4A 2PFIA 5LXQA 2YVZA 3KPBA 2QLVC 2EF7A 4ESYA 3PC3A 2YVYA 3ORGA 2P9MA 4FRYA 4DQWA 5IIPA 2QRDE 5KS7A 2RIFA 3PC2A 5K22B 2OUXA 4PCUA 1PBJA 1PVMA 4IY4A 3PC4A 4GQVA 2QREE 3OI8A 2OOXE 2OOYE 4FXSA 4L0DA 5K24C 3DDJA 4UUUA 1YAVA 3LFZA 4NOCA 1Y5HA 3L2BA 4P1OA 2UV6A 2D4ZA 5K25C 4L28A 4P1GA 3FNAA 1O50A 3OCOA 3FWSA 3KPDA 4COOA 3OCMA 2QH1A 2UV7A 2O16A 3FWRA 2RC3A 3KXRA 2QR1E 4IY0A 3LHHA 3LV9A 4IY3A 3L31A 3I8NA 2ZY9A
chains in the Genus database with same CATH superfamily
2YVXA 3KH5A 2NYEA 4IY2A 3K2VA 3TDHC 2J9LA 2YZQA 5K23C 3K6EA 4GQWA 2QRCE 3HF7A 2NYCA 3GBYA 4O9KA 2YZIA 3FV6A 3LQNA 4ESYB 3T4NC 1XKFA 3FHMA 3TE5C 2UV5A 4IYSA 4L3VA 5MMZA 2RIHA 4GQYA 4HG0A 3KPCA 4L27A 2EMQA 3SL7A 2UV4A 2PFIA 5LXQA 2YVZA 3KPBA 2QLVC 2EF7A 4ESYA 3PC3A 2YVYA 3ORGA 2P9MA 4FRYA 4DQWA 5IIPA 2QRDE 5KS7A 2RIFA 3PC2A 5K22B 2OUXA 4PCUA 1PBJA 1PVMA 4IY4A 3PC4A 4GQVA 2QREE 3OI8A 2OOXE 2OOYE 4FXSA 4L0DA 5K24C 3DDJA 4UUUA 1YAVA 3LFZA 4NOCA 1Y5HA 3L2BA 4P1OA 2UV6A 2D4ZA 5K25C 4L28A 4P1GA 3FNAA 1O50A 3OCOA 3FWSA 3KPDA 4COOA 3OCMA 2QH1A 2UV7A 2O16A 3FWRA 2RC3A 3KXRA 2JA3A 2QR1E 4IY0A 3LHHA 3LV9A 4IY3A 3L31A 3I8NA 2ZY9A
chains in the Genus database with same CATH topology
2YVXA 3KH5A 2NYEA 4IY2A 3K2VA 3TDHC 2J9LA 2YZQA 5K23C 3K6EA 4GQWA 2QRCE 3HF7A 2NYCA 3GBYA 4O9KA 2YZIA 3FV6A 3LQNA 4ESYB 3T4NC 1XKFA 3FHMA 3TE5C 2UV5A 4IYSA 4L3VA 5MMZA 2RIHA 4GQYA 4HG0A 3KPCA 4L27A 2EMQA 3SL7A 2UV4A 2PFIA 5LXQA 2YVZA 3KPBA 2QLVC 2EF7A 4ESYA 3PC3A 2YVYA 3ORGA 2P9MA 4FRYA 4DQWA 5IIPA 2QRDE 5KS7A 2RIFA 3PC2A 5K22B 2OUXA 4PCUA 1PBJA 1PVMA 4IY4A 3PC4A 4GQVA 2QREE 3OI8A 2OOXE 2OOYE 4FXSA 4L0DA 5K24C 3DDJA 4UUUA 1YAVA 3LFZA 4NOCA 1Y5HA 3L2BA 4P1OA 2UV6A 2D4ZA 5K25C 4L28A 4P1GA 3FNAA 1O50A 3OCOA 3FWSA 3KPDA 4COOA 3OCMA 2QH1A 2UV7A 2O16A 3FWRA 2RC3A 3KXRA 2JA3A 2QR1E 4IY0A 3LHHA 3LV9A 4IY3A 3L31A 3I8NA 2ZY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YVX A;  3KH5 A;  2NYE A;  4IY2 A;  3K2V A;  3TDH C;  2YZQ A;  5K23 C;  3K6E A;  4GQW A;  2QRC E;  3HF7 A;  2NYC A;  3GBY A;  4O9K A;  2YZI A;  3FV6 A;  3LQN A;  4ESY B;  3T4N C;  1XKF A;  3FHM A;  3TE5 C;  2UV5 A;  4IYS A;  4L3V A;  5MMZ A;  2RIH A;  4GQY A;  4HG0 A;  3KPC A;  4L27 A;  2EMQ A;  3SL7 A;  2UV4 A;  2PFI A;  5LXQ A;  2YVZ A;  3KPB A;  2QLV C;  2EF7 A;  4ESY A;  3PC3 A;  2YVY A;  3ORG A;  2P9M A;  4FRY A;  4DQW A;  5IIP A;  2QRD E;  5KS7 A;  2RIF A;  3PC2 A;  5K22 B;  2OUX A;  4PCU A;  1PBJ A;  1PVM A;  4IY4 A;  3PC4 A;  4GQV A;  2QRE E;  3OI8 A;  2OOX E;  2OOY E;  4FXS A;  4L0D A;  5K24 C;  3DDJ A;  4UUU A;  1YAV A;  3LFZ A;  4NOC A;  1Y5H A;  3L2B A;  4P1O A;  2UV6 A;  2D4Z A;  5K25 C;  4L28 A;  4P1G A;  3FNA A;  1O50 A;  3OCO A;  3FWS A;  3KPD A;  4COO A;  3OCM A;  2QH1 A;  2UV7 A;  2O16 A;  3FWR A;  2RC3 A;  3KXR A;  2QR1 E;  4IY0 A;  3LHH A;  3LV9 A;  4IY3 A;  3L31 A;  3I8N A;  2ZY9 A; 
#chains in the Genus database with same CATH topology
 2YVX A;  3KH5 A;  2NYE A;  4IY2 A;  3K2V A;  3TDH C;  2J9L A;  2YZQ A;  5K23 C;  3K6E A;  4GQW A;  2QRC E;  3HF7 A;  2NYC A;  3GBY A;  4O9K A;  2YZI A;  3FV6 A;  3LQN A;  4ESY B;  3T4N C;  1XKF A;  3FHM A;  3TE5 C;  2UV5 A;  4IYS A;  4L3V A;  5MMZ A;  2RIH A;  4GQY A;  4HG0 A;  3KPC A;  4L27 A;  2EMQ A;  3SL7 A;  2UV4 A;  2PFI A;  5LXQ A;  2YVZ A;  3KPB A;  2QLV C;  2EF7 A;  4ESY A;  3PC3 A;  2YVY A;  3ORG A;  2P9M A;  4FRY A;  4DQW A;  5IIP A;  2QRD E;  5KS7 A;  2RIF A;  3PC2 A;  5K22 B;  2OUX A;  4PCU A;  1PBJ A;  1PVM A;  4IY4 A;  3PC4 A;  4GQV A;  2QRE E;  3OI8 A;  2OOX E;  2OOY E;  4FXS A;  4L0D A;  5K24 C;  3DDJ A;  4UUU A;  1YAV A;  3LFZ A;  4NOC A;  1Y5H A;  3L2B A;  4P1O A;  2UV6 A;  2D4Z A;  5K25 C;  4L28 A;  4P1G A;  3FNA A;  1O50 A;  3OCO A;  3FWS A;  3KPD A;  4COO A;  3OCM A;  2QH1 A;  2UV7 A;  2O16 A;  3FWR A;  2RC3 A;  3KXR A;  2JA3 A;  2QR1 E;  4IY0 A;  3LHH A;  3LV9 A;  4IY3 A;  3L31 A;  3I8N A;  2ZY9 A; 
#chains in the Genus database with same CATH homology
 2YVX A;  3KH5 A;  2NYE A;  4IY2 A;  3K2V A;  3TDH C;  2J9L A;  2YZQ A;  5K23 C;  3K6E A;  4GQW A;  2QRC E;  3HF7 A;  2NYC A;  3GBY A;  4O9K A;  2YZI A;  3FV6 A;  3LQN A;  4ESY B;  3T4N C;  1XKF A;  3FHM A;  3TE5 C;  2UV5 A;  4IYS A;  4L3V A;  5MMZ A;  2RIH A;  4GQY A;  4HG0 A;  3KPC A;  4L27 A;  2EMQ A;  3SL7 A;  2UV4 A;  2PFI A;  5LXQ A;  2YVZ A;  3KPB A;  2QLV C;  2EF7 A;  4ESY A;  3PC3 A;  2YVY A;  3ORG A;  2P9M A;  4FRY A;  4DQW A;  5IIP A;  2QRD E;  5KS7 A;  2RIF A;  3PC2 A;  5K22 B;  2OUX A;  4PCU A;  1PBJ A;  1PVM A;  4IY4 A;  3PC4 A;  4GQV A;  2QRE E;  3OI8 A;  2OOX E;  2OOY E;  4FXS A;  4L0D A;  5K24 C;  3DDJ A;  4UUU A;  1YAV A;  3LFZ A;  4NOC A;  1Y5H A;  3L2B A;  4P1O A;  2UV6 A;  2D4Z A;  5K25 C;  4L28 A;  4P1G A;  3FNA A;  1O50 A;  3OCO A;  3FWS A;  3KPD A;  4COO A;  3OCM A;  2QH1 A;  2UV7 A;  2O16 A;  3FWR A;  2RC3 A;  3KXR A;  2JA3 A;  2QR1 E;  4IY0 A;  3LHH A;  3LV9 A;  4IY3 A;  3L31 A;  3I8N A;  2ZY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...