2NYCA

Crystal structure of the bateman2 domain of yeast snf4
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
140
structure length
130
Chain Sequence
THFLKIPIGDLNIITQDNMKSCQMTTPVIDVIQMLTQGRVSSVPIIDENGYLINVYEAYDVLGLIKGGLSLSVGEALMRRSYTCTKNDKLSTIMDNIRKARVHRFFVVDDVGRLVGVLTLSDILKYILLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Nuclear protein SNF4
publication title Structure of the Bateman2 domain of yeast Snf4: dimeric association and relevance for AMP binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 36
structure length 130
sequence length 140
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 2nycA00
4IYSA 3L2BA 4NOCA 2OUXA 3KXRA 3OI8A 2PFIA 2YVXA 3OCMA 3FHMA 3I8NA 2OOXE 3LV9A 4GQWA 1YAVA 2YZQA 3SL7A 4HG0A 2QH1A 3FWRA 2UV6A 1XKFA 3T4NC 1O50A 5LXQA 4GQYA 4IY2A 3LQNA 3LFZA 3KPDA 3PC4A 3FWSA 3KPBA 3FNAA 2O16A 5K22B 2NYEA 4UUUA 3L31A 4GQVA 4O9KA 2QR1E 3DDJA 2EF7A 5MMZA 4COOA 2QREE 3KH5A 1PVMA 4FXSA 5KS7A 4ESYB 2QLVC 5K25C 4L3VA 2YZIA 3PC3A 2ZY9A 2NYCA 4DQWA 3LHHA 3GBYA 1PBJA 2D4ZA 2YVYA 4ESYA 1Y5HA 2YVZA 4L0DA 4FRYA 3K6EA 4IY0A 3K2VA 2EMQA 2QRCE 2P9MA 5IIPA 2UV5A 4L27A 3HF7A 3FV6A 3PC2A 4P1OA 2UV7A 4P1GA 2RIFA 2RC3A 2QRDE 2OOYE 4IY4A 3ORGA 3TE5C 4PCUA 2RIHA 5K24C 3TDHC 3KPCA 4L28A 3OCOA 4IY3A 2UV4A 5K23C
chains in the Genus database with same CATH superfamily
4IYSA 3L2BA 4NOCA 2OUXA 3KXRA 3OI8A 2PFIA 2YVXA 3OCMA 3FHMA 3I8NA 2OOXE 3LV9A 4GQWA 1YAVA 2YZQA 3SL7A 4HG0A 2QH1A 3FWRA 2UV6A 1XKFA 3T4NC 1O50A 5LXQA 4GQYA 4IY2A 3LQNA 3LFZA 3KPDA 3PC4A 3FWSA 3KPBA 3FNAA 2O16A 5K22B 2NYEA 4UUUA 3L31A 4GQVA 4O9KA 2QR1E 3DDJA 2EF7A 5MMZA 4COOA 2QREE 3KH5A 1PVMA 4FXSA 5KS7A 4ESYB 2QLVC 5K25C 4L3VA 2YZIA 3PC3A 2ZY9A 2NYCA 4DQWA 3LHHA 3GBYA 1PBJA 2D4ZA 2YVYA 4ESYA 1Y5HA 2YVZA 4L0DA 4FRYA 3K6EA 4IY0A 3K2VA 2EMQA 2QRCE 2P9MA 5IIPA 2UV5A 2JA3A 4L27A 3HF7A 3FV6A 3PC2A 4P1OA 2J9LA 2UV7A 4P1GA 2RIFA 2RC3A 2QRDE 2OOYE 4IY4A 3ORGA 3TE5C 4PCUA 2RIHA 5K24C 3TDHC 3KPCA 4L28A 3OCOA 4IY3A 2UV4A 5K23C
chains in the Genus database with same CATH topology
4IYSA 3L2BA 4NOCA 2OUXA 3KXRA 3OI8A 2PFIA 2YVXA 3OCMA 3FHMA 3I8NA 2OOXE 3LV9A 4GQWA 1YAVA 2YZQA 3SL7A 4HG0A 2QH1A 3FWRA 2UV6A 1XKFA 3T4NC 1O50A 5LXQA 4GQYA 4IY2A 3LQNA 3LFZA 3KPDA 3PC4A 3FWSA 3KPBA 3FNAA 2O16A 5K22B 2NYEA 4UUUA 3L31A 4GQVA 4O9KA 2QR1E 3DDJA 2EF7A 5MMZA 4COOA 2QREE 3KH5A 1PVMA 4FXSA 5KS7A 4ESYB 2QLVC 5K25C 4L3VA 2YZIA 3PC3A 2ZY9A 2NYCA 4DQWA 3LHHA 3GBYA 1PBJA 2D4ZA 2YVYA 4ESYA 1Y5HA 2YVZA 4L0DA 4FRYA 3K6EA 4IY0A 3K2VA 2EMQA 2QRCE 2P9MA 5IIPA 2UV5A 2JA3A 4L27A 3HF7A 3FV6A 3PC2A 4P1OA 2J9LA 2UV7A 4P1GA 2RIFA 2RC3A 2QRDE 2OOYE 4IY4A 3ORGA 3TE5C 4PCUA 2RIHA 5K24C 3TDHC 3KPCA 4L28A 3OCOA 4IY3A 2UV4A 5K23C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IYS A;  3L2B A;  4NOC A;  2OUX A;  3KXR A;  3OI8 A;  2PFI A;  2YVX A;  3OCM A;  3FHM A;  3I8N A;  2OOX E;  3LV9 A;  4GQW A;  1YAV A;  2YZQ A;  3SL7 A;  4HG0 A;  2QH1 A;  3FWR A;  2UV6 A;  1XKF A;  3T4N C;  1O50 A;  5LXQ A;  4GQY A;  4IY2 A;  3LQN A;  3LFZ A;  3KPD A;  3PC4 A;  3FWS A;  3KPB A;  3FNA A;  2O16 A;  5K22 B;  2NYE A;  4UUU A;  3L31 A;  4GQV A;  4O9K A;  2QR1 E;  3DDJ A;  2EF7 A;  5MMZ A;  4COO A;  2QRE E;  3KH5 A;  1PVM A;  4FXS A;  5KS7 A;  4ESY B;  2QLV C;  5K25 C;  4L3V A;  2YZI A;  3PC3 A;  2ZY9 A;  2NYC A;  4DQW A;  3LHH A;  3GBY A;  1PBJ A;  2D4Z A;  2YVY A;  4ESY A;  1Y5H A;  2YVZ A;  4L0D A;  4FRY A;  3K6E A;  4IY0 A;  3K2V A;  2EMQ A;  2QRC E;  2P9M A;  5IIP A;  2UV5 A;  4L27 A;  3HF7 A;  3FV6 A;  3PC2 A;  4P1O A;  2UV7 A;  4P1G A;  2RIF A;  2RC3 A;  2QRD E;  2OOY E;  4IY4 A;  3ORG A;  3TE5 C;  4PCU A;  2RIH A;  5K24 C;  3TDH C;  3KPC A;  4L28 A;  3OCO A;  4IY3 A;  2UV4 A;  5K23 C; 
#chains in the Genus database with same CATH topology
 4IYS A;  3L2B A;  4NOC A;  2OUX A;  3KXR A;  3OI8 A;  2PFI A;  2YVX A;  3OCM A;  3FHM A;  3I8N A;  2OOX E;  3LV9 A;  4GQW A;  1YAV A;  2YZQ A;  3SL7 A;  4HG0 A;  2QH1 A;  3FWR A;  2UV6 A;  1XKF A;  3T4N C;  1O50 A;  5LXQ A;  4GQY A;  4IY2 A;  3LQN A;  3LFZ A;  3KPD A;  3PC4 A;  3FWS A;  3KPB A;  3FNA A;  2O16 A;  5K22 B;  2NYE A;  4UUU A;  3L31 A;  4GQV A;  4O9K A;  2QR1 E;  3DDJ A;  2EF7 A;  5MMZ A;  4COO A;  2QRE E;  3KH5 A;  1PVM A;  4FXS A;  5KS7 A;  4ESY B;  2QLV C;  5K25 C;  4L3V A;  2YZI A;  3PC3 A;  2ZY9 A;  2NYC A;  4DQW A;  3LHH A;  3GBY A;  1PBJ A;  2D4Z A;  2YVY A;  4ESY A;  1Y5H A;  2YVZ A;  4L0D A;  4FRY A;  3K6E A;  4IY0 A;  3K2V A;  2EMQ A;  2QRC E;  2P9M A;  5IIP A;  2UV5 A;  2JA3 A;  4L27 A;  3HF7 A;  3FV6 A;  3PC2 A;  4P1O A;  2J9L A;  2UV7 A;  4P1G A;  2RIF A;  2RC3 A;  2QRD E;  2OOY E;  4IY4 A;  3ORG A;  3TE5 C;  4PCU A;  2RIH A;  5K24 C;  3TDH C;  3KPC A;  4L28 A;  3OCO A;  4IY3 A;  2UV4 A;  5K23 C; 
#chains in the Genus database with same CATH homology
 4IYS A;  3L2B A;  4NOC A;  2OUX A;  3KXR A;  3OI8 A;  2PFI A;  2YVX A;  3OCM A;  3FHM A;  3I8N A;  2OOX E;  3LV9 A;  4GQW A;  1YAV A;  2YZQ A;  3SL7 A;  4HG0 A;  2QH1 A;  3FWR A;  2UV6 A;  1XKF A;  3T4N C;  1O50 A;  5LXQ A;  4GQY A;  4IY2 A;  3LQN A;  3LFZ A;  3KPD A;  3PC4 A;  3FWS A;  3KPB A;  3FNA A;  2O16 A;  5K22 B;  2NYE A;  4UUU A;  3L31 A;  4GQV A;  4O9K A;  2QR1 E;  3DDJ A;  2EF7 A;  5MMZ A;  4COO A;  2QRE E;  3KH5 A;  1PVM A;  4FXS A;  5KS7 A;  4ESY B;  2QLV C;  5K25 C;  4L3V A;  2YZI A;  3PC3 A;  2ZY9 A;  2NYC A;  4DQW A;  3LHH A;  3GBY A;  1PBJ A;  2D4Z A;  2YVY A;  4ESY A;  1Y5H A;  2YVZ A;  4L0D A;  4FRY A;  3K6E A;  4IY0 A;  3K2V A;  2EMQ A;  2QRC E;  2P9M A;  5IIP A;  2UV5 A;  2JA3 A;  4L27 A;  3HF7 A;  3FV6 A;  3PC2 A;  4P1O A;  2J9L A;  2UV7 A;  4P1G A;  2RIF A;  2RC3 A;  2QRD E;  2OOY E;  4IY4 A;  3ORG A;  3TE5 C;  4PCU A;  2RIH A;  5K24 C;  3TDH C;  3KPC A;  4L28 A;  3OCO A;  4IY3 A;  2UV4 A;  5K23 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...