5KS7A

Crystal structure of listeria monocytogenes opuca cbs domain dimer in complex with cyclic-di-amp
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
DVTQVAQIMNTNPVSITADKSLQAAITVMKEKRVDTLLVVDEGNVLKGFIDVEQIDLNRRTATSVMDIIEKNVFYVYEDTLLRDTVQRILKRGYKYIPVVDKDKRLVGIVTRASLVDIVYDSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cyclic di-AMP targets the cystathionine beta-synthase domain of the osmolyte transporter OpuC.
pubmed doi rcsb
molecule keywords Carnitine transport ATP-binding protein OpuCA
molecule tags Hydrolase/hydrolase inhibitor
source organism Listeria monocytogenes
total genus 32
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature ec 7.6.2.9: ABC-type quaternary amine transporter.
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 5ks7A00
3FHMA 4GQYA 2EF7A 2QREE 4L27A 4P1GA 2UV4A 1PBJA 2RC3A 5K24C 2NYCA 2OOXE 2YZIA 3KXRA 3SL7A 2ZY9A 4NOCA 2D4ZA 4GQWA 2EMQA 4IY4A 4DQWA 4FRYA 4PCUA 2UV6A 3K6EA 1XKFA 5K22B 3L31A 2YVYA 2YVZA 3LHHA 2QH1A 1PVMA 2QLVC 2RIHA 4UUUA 4IY2A 3DDJA 5MMZA 2PFIA 4O9KA 3LV9A 4L3VA 2RIFA 3FV6A 3L2BA 4HG0A 2YVXA 3KH5A 1Y5HA 4FXSA 2NYEA 5K25C 5LXQA 4IY0A 4L28A 4IYSA 3TDHC 3I8NA 3FNAA 3PC3A 3HF7A 3GBYA 1O50A 2QRDE 3K2VA 2OUXA 2O16A 4GQVA 2P9MA 4ESYA 3PC4A 3LFZA 3KPBA 4P1OA 3KPDA 1YAVA 4IY3A 3ORGA 2UV5A 3FWRA 3KPCA 3OCMA 3T4NC 5IIPA 5KS7A 2YZQA 4L0DA 3TE5C 3FWSA 3OI8A 2QR1E 2QRCE 3OCOA 4COOA 2OOYE 5K23C 3LQNA 2UV7A 4ESYB 3PC2A
chains in the Genus database with same CATH superfamily
2J9LA 3FHMA 4GQYA 2EF7A 2QREE 4L27A 4P1GA 2UV4A 1PBJA 2RC3A 5K24C 2NYCA 2OOXE 2YZIA 3KXRA 3SL7A 2ZY9A 4NOCA 2D4ZA 4GQWA 2EMQA 4IY4A 4DQWA 4FRYA 4PCUA 2UV6A 3K6EA 1XKFA 5K22B 3L31A 2YVYA 2YVZA 3LHHA 2QH1A 1PVMA 2QLVC 2RIHA 4UUUA 4IY2A 3DDJA 5MMZA 2PFIA 4O9KA 3LV9A 4L3VA 2RIFA 3FV6A 3L2BA 4HG0A 2YVXA 3KH5A 1Y5HA 4FXSA 2NYEA 5K25C 5LXQA 4IY0A 4L28A 4IYSA 3TDHC 3I8NA 3FNAA 3PC3A 3HF7A 3GBYA 1O50A 2QRDE 3K2VA 2OUXA 2O16A 4GQVA 2P9MA 4ESYA 3PC4A 3LFZA 3KPBA 4P1OA 3KPDA 1YAVA 4IY3A 3ORGA 2UV5A 3FWRA 3KPCA 3OCMA 3T4NC 5IIPA 5KS7A 2YZQA 4L0DA 3TE5C 3FWSA 3OI8A 2QR1E 2QRCE 3OCOA 2JA3A 4COOA 2OOYE 5K23C 3LQNA 2UV7A 4ESYB 3PC2A
chains in the Genus database with same CATH topology
2J9LA 3FHMA 4GQYA 2EF7A 2QREE 4L27A 4P1GA 2UV4A 1PBJA 2RC3A 5K24C 2NYCA 2OOXE 2YZIA 3KXRA 3SL7A 2ZY9A 4NOCA 2D4ZA 4GQWA 2EMQA 4IY4A 4DQWA 4FRYA 4PCUA 2UV6A 3K6EA 1XKFA 5K22B 3L31A 2YVYA 2YVZA 3LHHA 2QH1A 1PVMA 2QLVC 2RIHA 4UUUA 4IY2A 3DDJA 5MMZA 2PFIA 4O9KA 3LV9A 4L3VA 2RIFA 3FV6A 3L2BA 4HG0A 2YVXA 3KH5A 1Y5HA 4FXSA 2NYEA 5K25C 5LXQA 4IY0A 4L28A 4IYSA 3TDHC 3I8NA 3FNAA 3PC3A 3HF7A 3GBYA 1O50A 2QRDE 3K2VA 2OUXA 2O16A 4GQVA 2P9MA 4ESYA 3PC4A 3LFZA 3KPBA 4P1OA 3KPDA 1YAVA 4IY3A 3ORGA 2UV5A 3FWRA 3KPCA 3OCMA 3T4NC 5IIPA 5KS7A 2YZQA 4L0DA 3TE5C 3FWSA 3OI8A 2QR1E 2QRCE 3OCOA 2JA3A 4COOA 2OOYE 5K23C 3LQNA 2UV7A 4ESYB 3PC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FHM A;  4GQY A;  2EF7 A;  2QRE E;  4L27 A;  4P1G A;  2UV4 A;  1PBJ A;  2RC3 A;  5K24 C;  2NYC A;  2OOX E;  2YZI A;  3KXR A;  3SL7 A;  2ZY9 A;  4NOC A;  2D4Z A;  4GQW A;  2EMQ A;  4IY4 A;  4DQW A;  4FRY A;  4PCU A;  2UV6 A;  3K6E A;  1XKF A;  5K22 B;  3L31 A;  2YVY A;  2YVZ A;  3LHH A;  2QH1 A;  1PVM A;  2QLV C;  2RIH A;  4UUU A;  4IY2 A;  3DDJ A;  5MMZ A;  2PFI A;  4O9K A;  3LV9 A;  4L3V A;  2RIF A;  3FV6 A;  3L2B A;  4HG0 A;  2YVX A;  3KH5 A;  1Y5H A;  4FXS A;  2NYE A;  5K25 C;  5LXQ A;  4IY0 A;  4L28 A;  4IYS A;  3TDH C;  3I8N A;  3FNA A;  3PC3 A;  3HF7 A;  3GBY A;  1O50 A;  2QRD E;  3K2V A;  2OUX A;  2O16 A;  4GQV A;  2P9M A;  4ESY A;  3PC4 A;  3LFZ A;  3KPB A;  4P1O A;  3KPD A;  1YAV A;  4IY3 A;  3ORG A;  2UV5 A;  3FWR A;  3KPC A;  3OCM A;  3T4N C;  5IIP A;  5KS7 A;  2YZQ A;  4L0D A;  3TE5 C;  3FWS A;  3OI8 A;  2QR1 E;  2QRC E;  3OCO A;  4COO A;  2OOY E;  5K23 C;  3LQN A;  2UV7 A;  4ESY B;  3PC2 A; 
#chains in the Genus database with same CATH topology
 2J9L A;  3FHM A;  4GQY A;  2EF7 A;  2QRE E;  4L27 A;  4P1G A;  2UV4 A;  1PBJ A;  2RC3 A;  5K24 C;  2NYC A;  2OOX E;  2YZI A;  3KXR A;  3SL7 A;  2ZY9 A;  4NOC A;  2D4Z A;  4GQW A;  2EMQ A;  4IY4 A;  4DQW A;  4FRY A;  4PCU A;  2UV6 A;  3K6E A;  1XKF A;  5K22 B;  3L31 A;  2YVY A;  2YVZ A;  3LHH A;  2QH1 A;  1PVM A;  2QLV C;  2RIH A;  4UUU A;  4IY2 A;  3DDJ A;  5MMZ A;  2PFI A;  4O9K A;  3LV9 A;  4L3V A;  2RIF A;  3FV6 A;  3L2B A;  4HG0 A;  2YVX A;  3KH5 A;  1Y5H A;  4FXS A;  2NYE A;  5K25 C;  5LXQ A;  4IY0 A;  4L28 A;  4IYS A;  3TDH C;  3I8N A;  3FNA A;  3PC3 A;  3HF7 A;  3GBY A;  1O50 A;  2QRD E;  3K2V A;  2OUX A;  2O16 A;  4GQV A;  2P9M A;  4ESY A;  3PC4 A;  3LFZ A;  3KPB A;  4P1O A;  3KPD A;  1YAV A;  4IY3 A;  3ORG A;  2UV5 A;  3FWR A;  3KPC A;  3OCM A;  3T4N C;  5IIP A;  5KS7 A;  2YZQ A;  4L0D A;  3TE5 C;  3FWS A;  3OI8 A;  2QR1 E;  2QRC E;  3OCO A;  2JA3 A;  4COO A;  2OOY E;  5K23 C;  3LQN A;  2UV7 A;  4ESY B;  3PC2 A; 
#chains in the Genus database with same CATH homology
 2J9L A;  3FHM A;  4GQY A;  2EF7 A;  2QRE E;  4L27 A;  4P1G A;  2UV4 A;  1PBJ A;  2RC3 A;  5K24 C;  2NYC A;  2OOX E;  2YZI A;  3KXR A;  3SL7 A;  2ZY9 A;  4NOC A;  2D4Z A;  4GQW A;  2EMQ A;  4IY4 A;  4DQW A;  4FRY A;  4PCU A;  2UV6 A;  3K6E A;  1XKF A;  5K22 B;  3L31 A;  2YVY A;  2YVZ A;  3LHH A;  2QH1 A;  1PVM A;  2QLV C;  2RIH A;  4UUU A;  4IY2 A;  3DDJ A;  5MMZ A;  2PFI A;  4O9K A;  3LV9 A;  4L3V A;  2RIF A;  3FV6 A;  3L2B A;  4HG0 A;  2YVX A;  3KH5 A;  1Y5H A;  4FXS A;  2NYE A;  5K25 C;  5LXQ A;  4IY0 A;  4L28 A;  4IYS A;  3TDH C;  3I8N A;  3FNA A;  3PC3 A;  3HF7 A;  3GBY A;  1O50 A;  2QRD E;  3K2V A;  2OUX A;  2O16 A;  4GQV A;  2P9M A;  4ESY A;  3PC4 A;  3LFZ A;  3KPB A;  4P1O A;  3KPD A;  1YAV A;  4IY3 A;  3ORG A;  2UV5 A;  3FWR A;  3KPC A;  3OCM A;  3T4N C;  5IIP A;  5KS7 A;  2YZQ A;  4L0D A;  3TE5 C;  3FWS A;  3OI8 A;  2QR1 E;  2QRC E;  3OCO A;  2JA3 A;  4COO A;  2OOY E;  5K23 C;  3LQN A;  2UV7 A;  4ESY B;  3PC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...