3PC4A

Full length structure of cystathionine beta-synthase from drosophila in complex with serine
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
504
structure length
504
Chain Sequence
YERPADFIDPGKPSKCKWHLGTAEKSPHIHRGIAHRQQITPNILEVIGCTPLVKLNNIPASDGIECEMYAKCEFLNPGGSVKDRIGYRMVQDAEEQGLLKPGYTIIEPTSGNTGIGLAMACAVKGYKCIIVMPEKMSNEKVSALRTLGAKIIRTPTEAAYDSPEGLIYVAQQLQRETPNSIVLDQYRNAGNPLAHYDGTAAEILWQLDNKVDMIVVSAGTAGTISGIGRKIKEQVPSCQIVGVDPYGSILARPAELNKTDVQFYEVEGIGYDFPPTVFDDTVVDVWTKIGDSDCFPMSRRLNAEEGLLCGGSSGGAMHAALEHARKLKKGQRCVVILPDGIRNYMTKFVSDNWMEARNFKEPVNEHGHWWWSLAIAELELPAPPVILKSDATVGEAIALMKKHRVDQLPVVDQDDGSVLGVVGQETLITQIVSMNRQQSDPAIKALNKRVIRLNESEILGKLARVLEVDPSVLILGKNPAGKVELKALATKLDVTTFIAAGKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CG1753, isoform A
publication title Structural basis for substrate activation and regulation by cystathionine beta-synthase (CBS) domains in cystathionine {beta}-synthase.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Lyase
total genus 183
structure length 504
sequence length 504
ec nomenclature ec 4.2.1.22: Cystathionine beta-synthase.
pdb deposition date 2010-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 3pc4A03
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pc4A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pc4A02
2ZY9A 1TTPB 5K23C 3T4PA 3GBYA 4PCUA 1BKSB 1VE1A 4IY3A 5I7OA 1K8ZB 1Y7LA 3SL7A 3HF7A 3KXRA 1KFCB 4D9FA 2UV7A 2DH6A 4D8WA 2CLHB 3VBEA 4L3VA 4KKXB 1FCJA 2QR1E 2OUXA 3TDHC 1PBJA 1TZJA 2EGUA 2PQMA 2J9ZB 2RHGB 2RH9B 2GN1A 5K25C 4D9KA 2JC3A 2GN0A 4IY4A 1WKVA 3L6RA 1KFKB 3I8NA 3OCOA 4UUUA 3FV6A 5C3UA 4ESYB 4IY0A 2OOXE 1XKFA 3FCAA 4ZQCB 5BW6B 4DQWA 2EF7A 1A5SB 1J0BA 5B1IA 4D97A 1X1QA 4D9NA 4FRYA 5MMZA 1D6SA 3R0XA 1FUYB 5KINB 5B55A 5B3AA 1TZMA 3DDJA 4ESYA 2D1FA 3CEPB 1J0CA 3FGPA 2Q3BA 3PC2A 1K7XB 1TZ2A 3L31A 4GQWA 1A5BB 1C8VB 1O50A 1K8YB 3IQHX 5E0KB 4ZU1X 3LFZA 2QH1A 5DW0A 1CW2B 5T6MA 4NEGA 2ECOA 3LQNA 2P9MA 3DWGA 5KZMB 3VC3A 4XUGB 4GQVA 4HN4B 1KFJB 4D9EA 2J9XB 2Q3CA 1V8ZA 4JBNA 4O9KA 5IXJA 4IL5A 1RQXA 2UV5A 1TJPB 2QLVC 2QRDE 2WSYB 5IWCA 5LXQA 1PVMA 3ZEIA 1C29B 3T4NC 3VSAA 3TE5C 4HPJB 2Q3DA 3PC4A 3IQGX 1VE5A 4AECA 2GN2A 2RKBA 4P1GA 3IAUA 5D86A 4F4FA 1J0EA 1F2DA 4L28A 1V7CA 3X43A 3KPCA 1YAVA 5IW8A 3PC3A 5JISA 4NU8X 4FXSA 5J43A 1TYZA 1Z7YA 2NYCA 2EMQA 1M54A 1PWEA 4LMBA 2ZSJA 1C9DB 2CLFB 1KL7A 2YVXA 1WDWB 1K8XB 3PR2B 3LHHA 4NOCA 2NYEA 4LI3X 1E5XA 2RC3A 3AEXA 3K2VA 3VSDA 2QREE 3L6CA 4L0DA 5CVCA 4D9BA 1CX9B 4D9CA 4IYSA 3OI8A 1J0AA 2RIFA 5K24C 1WBJB 4D9IA 1O58A 4D9MA 5DVZA 1KFEB 2O16A 2CLMB 2YZIA 4ZU6X 5IIPA 5B36A 2YVYA 1A5AB 4D8TA 5KS7A 4QYSA 2D4ZA 1TTQB 5CGQB 5EY5B 4AIRA 2CLIB 4COOA 5D85A 1K3UB 2CLKB 4Y6GB 2YVZA 1UIMA 2O2JA 4JBLA 3SS9X 5DW3A 3DKIA 5I6DA 2ECQA 4HPXB 2ZPUA 3KPBA 3V7NA 2CLOB 2UV6A 5D84A 1KFBB 4WX2B 5I7WA 1PWHA 5DBHX 3LV9A 3FNAA 3FWSA 4GQYA 5D87A 3AEYA 2ISQA 1BEUB 1J0DA 1OASA 2DH5A 3R0ZA 3X44A 2RIHA 1TZKA 5I7RA 3IQIX 4OREX 3BM5A 4P1OA 1K7FB 1K7EB 3HMKA 4H27A 2C2GA 1UBSB 2TSYB 4D99A 3KPDA 3FHMA 2BHSA 1VB3A 4HO1X 2O2EA 1A50B 4D9GA 2QRCE 3TBHA 2UV4A 1TDJA 2OOYE 1Z7WA 3L2BA 5B1HA 4OFXA 4D96A 5HBGA 3OCMA 2TYSB 2YZQA 2TRSB 1QOPB 4D92A 4L27A 2PFIA 1JBQA 3L6BA 2C2BA 5B53A 4HG0A 3SS7X 3ORGA 5K22B 1V71A 2CLLB 4LMAA 1P5JA 5I7AA 2CLEB 2ZR8A 3SPXA 4I1YA 3DWIA 3FWRA 3K6EA 5J5VA 2BHTA 2EFYA 3KH5A 4IY2A 2J9YB 1QOQB 5JJCA 2V03A 4HT3B 4D8UA 1Y5HA 5I7HA 3VSCA 5DBEX 1WTCA 3RR2A 1UINA
chains in the Genus database with same CATH superfamily
3SFVA 1E1RD 1HDYA 4I4CA 4QRDA 1P45A 4I50A 4IIYA 1EZ4A 2QX6A 4JGBA 2W2QA 1DXHA 3IAFA 1H2WA 2PX6A 3U4QA 5JO0A 2I6XA 3T1NA 4F5ZA 2BGWA 2E21A 5ALYA 5EP4A 2IHBA 3SEFA 1C1DB 1RM3A 4TMVA 1EJBA 1T5HX 1QLHA 3T5BA 5I7OA 3QMMA 2B21A 3I9MA 3USZA 4CQMB 3CWCA 1G6OA 3P1JA 4Q9NA 3PQ7A 3LW8A 2BAGA 1W8IA 5I45A 3G9XA 4YJ3F 1D6NA 1I01A 3GOHA 4N47A 1ZP6A 3AKCA 1MO2A 3LBIA 3QTLA 4DAOA 2MWMA 6NULA 4BL5A 1N5MA 5CXUA 1CHDA 2V98A 4JYAB 3I73A 4S0ZA 4IIJA 5DASA 3O90A 1YFZA 3EC1A 4HAZA 1P9OA 1DKNA 4G41A 3EQ2A 3F1LA 3R20A 1QQ5A 1ULUA 5CVEA 3UJPA 4IIXA 1EUDA 2NACA 3VPXA 2HADA 4AMZA 4B83A 1NPTO 3LKVA 3LPCA 1DLIA 4IUCS 3PE4A 2X19A 1N77A 3O0DA 1FX0B 2FEMA 3QVTA 3HHPA 4BE7B 2OOSA 4F8EA 4MI9A 1J06A 2DTXA 2ZLBA 1KF0A 3HJUA 4DLZA 2VP4A 3UICA 3KOWA 4DQLA 5KQPA 4E1VA 1I7DA 1L5VA 1MN6A 2NZXA 3WA6A 3DM9B 1T3HA 1J99A 2B9VA 1P44A 3EBLA 4AURA 1RZRA 1FUKA 1PS9A 1VMEA 3K30A 2ZYRA 2BFFB 2WF7A 2W2MA 3LJKA 4YJ3A 4CTNA 4OLJA 3W5SA 3DV9A 4YLEA 1UZLA 1YHNA 1Q44A 2O2ZA 5LZ8A 4B76A 3TFQA 3U2QA 3UMSA 2ZU0C 4M9QA 1GLGA 3FUVA 4B80A 2GO7A 3K0CA 2PZJA 5FT9A 2KM1A 3IDZA 3K0HA 1YUNA 4PCAA 2Q3EA 1FC0A 1Z73A 3B53X 2B1IA 2X8LA 1B73A 4HK4A 4EHKA 3VH2A 2RSLA 1NKTA 4P7FA 1NVUQ 3HCAA 3PQ3A 1RVDA 1UZMA 1WEHA 4M8IA 4KSYA 5DMXA 3U7RA 4E08A 3OPVA 1EFUA 4Y2PA 4X7RA 4K6KA 1Y89A 3GLFB 2OOXE 2BM8A 2FJUA 5BRNA 1ZICA 3JU3A 4H31A 5BWMA 1NSFA 1DV2A 4YTEA 3JYLA 1NXVA 5FNZA 4F97A 4YDRA 1TQHA 3FGZA 2DKNA 1Y1RA 4UMVA 5CCDA 2YYAA 1ZGBA 1GLNA 1WMDA 1ZY2A 4PC1A 5C7IO 1ITZA 4MP8A 2Z3VA 2EF7A 1EKXA 2L82A 2FPPB 4Q1DA 4HQOA 3EC7A 3ZI7A 3AR6A 4BE9A 1Z3IX 3SQNA 2OVFA 2A5GA 3KXLA 2D0PB 4OHKA 2CDAA 2NT3A 2R6FA 4QPPA 4CEHB 3Q3JB 1FNMA 2YQ4A 1F8GA 2FK7A 2FLWA 4FGJA 5CLFA 3FPGA 1CHNA 1G0NA 1LPBB 3KHUA 3ZCXA 2WJHA 3QOWA 4PPQA 3NBQA 1U7TA 5JRJA 5IZCC 1TZMA 3O6VA 1Y8RA 3GJ7A 4GMDA 5D5PA 4QUJA 5HX7A 1VIAA 4WKGA 2N3ZA 3ICCA 3PNOA 3STWA 2QN9A 3D8SA 1QRAA 3OZSA 4WRRA 1K5HA 2YY6A 3C8MA 2HGZA 2JKZA 3CEPB 4NHOA 1PUJA 4Z4EA 1DMSA 5EE9A 5K8TA 1UIRA 2UUOA 3EPKA 1WM1A 3L4BA 3MJDA 1D4ZA 4QDUA 3V8EA 2QVYX 5JBQA 4KR3A 4MV9A 3CZ5A 1W59A 1PVDA 4PFSA 2CV0A 2I6GA 5JZSA 2CVFA 3LNCA 5KNDD 1MVNA 1GA4A 3IQHX 2PPLA 1BH6A 4KN5A 2NUTB 4FZVA 3A06A 5EG5A 1ODSA 2AHOA 3WHIA 4NE7A 4Z9YA 1ZH2A 1VCNA 5T6MA 4EABA 1PR0A 3Q72A 3CWZA 4I08A 4LTNA 1NTOA 4CG0A 3E9ZA 2IZ5A 2CLDX 1FRNA 1XEWY 2W6CX 2NVUB 4QTZA 1ZN2A 1RLOA 2BGNA 1XRNA 4M7RA 1HLPA 3FMIA 1R3UA 1G8MA 4P6VF 1L4EA 4GVLA 1G9TA 3OAAD 1FQKA 3GEBA 3LI2A 4LHYA 4TWRA 2V58A 4URYR 5AKEA 3HH8A 1Z5PA 1D09A 4M7OA 2VP3A 4H6VA 1YRHA 2C98A 2H48A 4W9RA 1RMTA 2WG2A 3ENNA 1Q2XA 3DD5A 3ONNA 4OGFA 4Y2RA 2IYEA 4WD3A 3H99A 3FVRA 1YGPA 4U7TB 1IRIA 1ZRNA 2NYVA 3T0FA 4C0JA 1FFEA 4B5LA 2BJVA 4YJ2F 1HT2E 1ZMTA 1HORA 3FF4A 3E9YA 4R41A 4KPEC 4WJLA 4KACA 4K6CA 4M0UA 4N18A 4B44A 3WICA 2DT5A 2PAAA 3F47A 3FI0A 4US2R 4INAA 3JAMA 2FFAA 1G8HA 2E4AA 3AUUA 2CBGA 4DLSA 2WIGA 2NUPB 5JNUA 1CQXA 2V0CA 5BPFA 4NMWA 2CN1A 1QRTA 2IEBA 3VOBA 4HAOA 1XHEA 3CJTA 5JS1A 2F67A 3RVNA 3QU7A 4OKIA 3FX2A 4XAQA 1NNEA 3K5PA 4HAWA 3PKZA 4NAUA 4CIYA 2YR0A 2CYCA 4FFNA 4TS3A 3PL5A 4XQEA 4A15A 2WSLA 1OX6A 5BN3B 3ONDA 1KJ9A 2A59A 2PBFA 2Z2JA 4EMBA 4MW4A 2X1VA 3PNVA 5JH7F 3PXBA 1VRVA 1IUOA 1P1HA 4JT9A 3FOFC 4HDCA 4YJ2A 3KR0A 3PNYA 3ORQA 3PDUA 3JYPA 4CKXA 4NCHA 5DNCA 2Z8YM 5H02A 2WU8A 2BELA 2C84A 2IITA 3BSYA 3CNHA 2RHBA 3CINA 5B3JC 2BH2A 2P6OA 2PKQP 4H60A 2PT5A 5LOVF 3E4DA 3ZCPA 1Y1SA 5ILOA 3M1IA 4DWWA 4IMIB 3PHLA 2IUUA 3UAVA 4LJAA 1C2TA 4MRSA 5M5BA 2ZOSA 5TT0A 3CCCA 2XCRB 2RGUA 3W5IA 1KO4A 1KZ1A 5AOCA 2OORC 4R8MA 5JH7A 3VR2A 1FJ2A 3M1AA 2UU9B 1WB6A 2Q1XA 3PC3A 4QDKA 3VAAA 5M29A 1PT6A 1Q1NA 2AYYA 2BF7A 4URHA 1VIDA 1E7MA 1S2LA 5ADHA 4WXPA 2ZR0A 2DUMA 1P0PA 1YQDA 3GMTA 4GMFA 3K0SA 2XDQA 5JS7A 3QKIA 3H4VA 2C59A 3PR3A 5CAEB 2KS6A 1IEVA 3G1UA 4YREA 3I9LA 4WK2B 5EKUA 2WU1A 3L4SO 3N2KB 5HJEA 3JR7A 3LRXA 5LOVA 3HCEA 2VHUA 3OKAA 3L4KA 3HBLA 1YDHA 4PPGA 5MFPA 4XQ9A 1CE8A 1L7QA 5MGBA 1GTG1 3T7TA 4ZYVA 2WJAA 2ZJZA 1S3IA 4Z51A 3C3AA 2AWNA 1PFVA 4Q1FA 4WN3A 4ZXPA 1GGFA 1S2DA 1WY7A 3GJ3A 3OM9A 4ARUA 3QPAA 3VVMA 2IHVA 4I5FA 3DXZA 1ANKA 3DW1X 3ZIUA 1MC1A 1X1CA 2QVXX 1IBKB 1FLDA 4EITA 3A2MA 2XB9A 4D1YA 2NTJA 1B43A 1QH0A 4LK2A 4IQ8A 2O54A 3NBYC 1NBMD 1R0XA 5JNVA 4ETIA 2GILA 2XGOA 3NAZA 1MOZA 1RAEA 2ACWA 3DKVA 1GAQA 1IYZA 1JXMA 2IA5A 2GYWA 3AJDA 1RU3A 3EY9A 3PIIA 4HDSA 5K0CA 4Q9AA 3FOWA 2NV2B 1T5DX 3RGGA 1YD7A 4LRSB 3TQFA 4A16A 1BCRB 3MOGA 5EIHA 1W29A 2BFCA 2OMKA 3NQ41 4WXEA 4C3UA 1U5AA 3FG9A 3TZBA 1V45E 5L6LB 3P0IA 3R7FA 5HRUA 1S6YA 2ZG6A 4IS2A 4R3WA 2V55B 3JV7A 1JSRA 2OCBA 3RYCA 3WLTA 3RH0A 1CUCA 4J3FA 4PPYA 1HDXA 3FPCA 1ZNZA 1FTSA 1F1BA 2AVNA 4NU0A 4OGGA 2F1IA 4PLYA 4CKCA 5EUQB 5SY6A 3BBPA 4FMBB 2NZ2A 2V45A 3TLXA 3TNLA 5EHGA 4X90A 3AF2A 4WESA 1RXYA 3AILA 5J63A 3UXHA 5AI5A 1JNYA 2G3YA 2NXEA 2ZBPA 5CXSA 4BU1A 5B1DA 2Z6QA 1Y3CE 3EG9A 1IU9A 4FDAA 1STOA 4X6LA 1VXOA 2Q0HA 1L4LA 4PHCA 3STVA 3SJBA 4FS8A 3C39A 1TLTA 1CR4A 2I6QA 3TJZA 1WTAA 1CQIA 13PKA 1NUTA 3FGNA 4G97A 1EBFA 4KDEA 4ND8B 4TLAA 3WRVA 5AW6A 5EY5B 5CGQB 5C8XA 1VECA 1Q50A 3N87A 3LL7A 3VJMA 3JXEA 2NO5A 4N7BA 4LAFA 5H3HA 4DPLA 4F9FA 5BN1A 4M8NE 4TRMA 5LYJF 3Q5GA 5EXTA 2YOFA 3IT2A 4WZAE 2Z98A 5DEIA 2D5CA 1ZCZA 5LMNB 1O96B 4NESA 3OOSA 2XTJA 2HQ1A 3U3JA 3VZPA 1TM7E 3COZA 4X3PA 4FMDF 1RC8A 3ZG6A 4HUQB 3B6KA 2AZTA 3BORA 3G2OA 1PDWA 1SBHA 2LD4A 5CLJA 1A1VA 1W96A 1M2VB 2L18A 2CVHA 1T6YA 1MJFA 4C06A 4DKXA 4MIKA 3F9CA 2MSKA 2Q4BA 3W6UA 1QQ6A 3OEHD 1N2ZA 3FVQA 4ILEA 2DQKA 2HAEA 3R77A 4OI1A 2CXQA 3SM3A 2NXJA 4UHBA 1ZVVA 3WWYA 3GD5A 1LVHA 1ZBDA 3NNSA 3UK6A 1PD0A 2WHYA 4ZO9A 3S2FA 4CYMA 1LSSA 3TQRA 2X6QA 3OVMA 4EF5A 5LYJA 3PFCA 1WU7A 4A23A 5KYYB 3FNAA 2HCFA 1ZMBA 3V4FA 2VQEB 2IUFA 2QM7A 5D6NA 1MHPA 3SN6A 4W8OA 1N25A 4EG5A 4F7DA 2FZEA 2VTDA 2Q1UA 4YEDA 3HO1A 3NEJA 1NWHA 5ALJA 4EUHA 2VJQA 1A9YA 2OG2A 4PSKA 3ANMA 3ZI4A 3RIGA 1HH4A 1KS2A 1TD1A 2WG0A 4M0DA 1MPTA 4RZIA 4TTQA 5GY7A 3RVMA 4EFLA 3CUEF 3LYLA 5FL7D 5LB4A 1PQPA 1UC5B 2H7XA 1S8OA 3FPLA 1DX9A 3UVEA 4CV1A 1JT9A 3DKPA 5B30A 1CVRA 4ND4A 4OQLA 2FQXA 3NIFB 4OHWA 1K7EB 3UJ6A 4ZYUA 4TYYA 2XA1A 2HA4A 4Y2QA 2XHZA 1JTEA 6GPBA 1PT7A 3GZTB 1UBSB 4WXRA 4Z5XA 3VYRB 2FLVA 2A35A 1YZNA 3ND8A 3V2HA 3CO0S 1M2EA 4YR9A 3QLVC 2GLTA 5JI2E 4BMZA 2GCIA 2DFNA 3DOFA 4RW0A 1AD2A 3O7MA 1W1IA 3FCCA 3EW9A 2PAFA 4WGFA 2FPIA 1Z0UA 2QN6A 2QP9X 1ZO8A 2RGBA 2RAVA 3DHVA 4XPIA 4BMYA 4MICA 2Z2KA 2VDWB 2FHSA 3IOEA 3DQPA 3N2ZB 2OHHA 1FS4A 2CKDA 4V02A 4RTRA 4A8HA 4L6CA 4M0EA 4OMFG 3AONB 1FDOA 2WF9A 1M5UA 4HQ6A 1ADGA 2W5UA 3L40A 1XX6A 3BDVA 4ZEOA 3UC5A 5E6UA 3WK6A 1V96A 5BNWA 1JR4A 2KX7A 2R6CA 4NJMA 3KSMA 5JAPA 4LBZA 4RDXA 1XNQB 2XECA 1MG5A 3JQQA 1IQ0A 4Y9UA 5AM0A 1CPYA 5FH9A 2R8EA 2YKGA 1OWPA 2ZJ0A 2VQFB 4Q4AB 3X1YA 3RQSA 3ROQA 3NEYA 3THSA 3V97A 4DANA 3RI3A 3PWSA 3DDCA 3BWXA 3H05A 3E22B 3QJ5A 1EFAA 2TRSB 1R8YA 3FWZA 2ZAOA 4JSRA 2VA9A 3N2YA 1KBOA 4PGAA 1RI5A 1XPRA 1P0IA 1UEXC 2XUPA 3PQFA 3QU5A 3JALA 3E3AA 2HTEA 1PLJA 4Z6KA 3IUNA 4S12A 1K4MA 2JLYA 5TB5A 4N3AA 4X7PA 1GL7A 5JCJA 1MNAA 2W6MA 2ZIFA 4GYKA 1QG4A 5AHRA 5ADVA 1TJ5A 2FXVA 2PCJA 2WYUA 3MGGA 5KVSA 4RSHA 4OHUA 2VDRB 1JLRA 4IJ5A 2IXEA 4KXQA 4L2IA 2NUAB 1Y6QA 1ZN7A 2PSDA 3OE1A 4L7QA 1PD1A 4BPRA 1NV9A 2F3RA 3E5HA 1O9GA 3CZPA 1GNLA 2B6NA 1Y3HA 2W0SA 2WM8A 2VVTA 4MCHA 3PUWA 3KH5A 3L7KA 3QFHA 3V32A 1U7XA 2C9YA 4FFRA 4UE6A 4CLRB 4LRQA 1CYDA 3KZ1E 2WUWE 5CX1B 1WVIA 2OHJA 3TBKA 4QARA 1NF9A 2CC2A 1E4OA 2V03A 4IQ0A 1YNOA 3DFUA 2EP7A 2QD4A 1LDBA 4XIYA 4YMGA 1OH8A 4K0KB 3NOOA 5K1ZA 1U5CA 4X1KA 4CDRA 4ZGGA 3ND9A 4PBSA 1JA9A 1SVKA 4R1NA 4B34A 4L8GA 2A33A 5F3DA 5A03A 2YXNA 2Z3WA 2QMZA 3O4RA 3KOUA 5CDFA 4MS3A 1ST2A 2YASA 1L6IA 4K87A 3EFEA 3LFTA 1SC9A 1H2EA 1Q21A 2H4WA 2C2OA 3NBMA 3F6EX 4YRSA 2HT1A 2J32A 3RR2A 1QJCA 4RTOA 1PSWA 2DAPA 3MPOA 4WY2A 3TDNA 1JAHA 3ICPA 3MQ2A 3EG5A 4NBVA 4P3YA 4XEUA 2AXPA 5TMPA 2ZROA 5K23C 1R6AA 1PS8A 2YJ6A 1GKYA 1XKLA 3N2IA 2JFOA 3PC8C 2E0IA 2BYTA 1FDWA 1Q17A 3KJNA 3WWEA 2OGTA 2I22A 2X5OA 2JLQA 5AW1A 3EPLA 3AVXA 2HRRA 4EY6A 4Y30A 4Q0MA 1K8ZB 3KHSA 4YC7A 5DYIA 2FSSA 2O20A 5AKHA 2P91A 3LT5A 2ASEA 2QL9A 3OCCA 5LZ5A 1UAYA 1E9DA 4N01A 3B5JA 1GPNA 1QV9A 1T6NA 2R87A 3GH3A 3U16A 3QE2A 1I32A 3FETA 3I01A 2PQ0A 5K6AC 4BRZA 4W9MC 3GA7A 3DHWC 2NU9A 3OCVA 3OMWA 4RQBA 4ALKA 5FRDA 3WWOA 3G79A 5JFTA 5JWOA 2RAFA 1ND6A 2YHUA 3BJIC 4KKXB 1NR1A 1FCJA 1WF6A 3T7AA 1VBNA 3VDQA 1QWSA 1MRZA 1T36B 2GS9A 2JBWA 4KXXA 4F3TA 2D0DA 1G21A 3NVKI 4XWKA 4COKA 1OLOA 3UC9A 4LTDA 4J0GA 1XN4A 1WUYA 1FMTA 2P4QA 1ZNWA 2FWRA 3SAJA 1JR2A 3C7CB 4MEAA 2ZI9A 2HBZA 1T1RA 1MAAA 1VC2A 1INLA 1VRWA 1T5IA 1WXEA 1PLKA 2ANBA 5TS3A 2PGXA 5IWAB 3QNMA 4KN6A 1IULA 3TRFA 1MAHA 4D0RA 1PFKA 1Y9JA 1SPBS 2C4MA 2GN1A 4FP9A 4OOEA 4IDEA 2RB5A 1R0ZA 3DE2X 3JASB 4AC9A 3QKTA 2FPOA 4N7JA 2Z5FA 1XCBA 1V41E 3HI4A 3HKCA 4G0ZA 4H08A 5G2OA 2V7UA 4P80A 3SXUA 3W2TA 3ZN2A 2B7BA 2JJ1D 1NRIA 5A2QA 1RRFA 2DGDA 1KOLA 3PHCA 4P3KA 4XX0A 1H9CA 4ZO7A 5IYZF 4ZZ1A 3V5NA 1I94B 1PJLA 3LDUA 5B2EA 2ORED 5DJ5A 1ISJA 3CUSA 3TX2A 1R6TA 3BK7A 1TKAA 1M6EX 3WYAA 4PEVA 3WYFA 4FGLA 3DXFA 5HUJA 2VSOA 4ZQCB 5ECDA 2X0NA 4OL9A 3SXJA 1JFTA 3O1JC 2AR0A 2PUFA 2YW2A 4I1SA 5KHOC 4NYIQ 3WMRA 2C97A 3U4HA 1ZGJA 4GSYA 2XQGA 4YVFA 1J8QA 3N8GA 2GTIA 1KYQA 5JDIC 4GBJA 2FJ0A 2FR1A 2AL7A 4LCEA 3EGCA 3BX1A 1EVEA 1KEWA 1A4UA 2HLPA 2VG8A 2RGYA 4I19A 4KRYA 4OFZA 3AY3A 5GOZA 3TCXB 4ETWA 1JEQB 2J3MA 2HHJA 1JDZA 4YAWA 3NM6B 2ZWPA 3AVOA 4MYHA 5IYZA 2XMCA 3EAGA 2J7PA 4EP1A 5L7YA 1I6MA 3IVAA 1N6HA 1YZLA 4GT1A 4Q48A 1U7UA 2BH9A 4KNVA 3KKQA 4LY9A 1MJGA 3HCNA 3WLRA 4BCDA 4ZKDA 2PXXA 4JFRA 4NZYA 5EZ5A 1QIEA 1U2PA 1N33B 3PNLA 2Z2IA 2GD6A 2ZDQA 3BCHA 4FFLA 1N0WA 4M0MA 3RU3A 4G81A 4UAUA 5AI4A 3VTFA 4YWJA 5GADl 1HBJA 2OESA 4MQUA 4GL2A 5GONF 2ZI7A 3N0XA 3BIFA 2IGTA 2VPWA 3F74A 4LS3A 1N5OX 3L4JA 4JLAA 2XHEA 4GXQA 1PK7A 2VAMA 2QH1A 4N7MA 4NCIA 5T67A 1V7QA 2NSJA 4JXXA 5KYNA 2WJZB 3AIMA 2MSWA 4FMCF 4K3VA 4RJJA 4H7JA 1DXOA 1M1ZA 2B3TA 1XKTA 2R85A 3T5MA 2O4CA 3T7EA 2QQ0A 1DBQA 3PSAA 1UC4B 4V3CA 1YOVA 3MVEA 5BW8A 1UKVY 2W90A 1LVUA 4L7VA 3UT6A 3V4LA 4KAAA 1GU1A 1LWNA 4F3CA 2ZE8A 3ERCA 4OHXA 3IA7A 5IP5A 3F4LA 1MP0A 4BNJA 4KQIA 1PJRA 4HMPA 4DQDA 5GONA 2V7VA 5GQSA 3OLQA 4PQRA 1MABB 4R8SA 1EM6A 3CT4A 1NY6A 4LZNA 4UCXA 1T9CA 1Z13A 1LFAA 4DEYA 2HNAA 4J0QA 3PPXA 3SKVA 3IMGA 4PLZA 2WTEA 4IY1A 2BMEA 4H6XA 3VKGA 3C41J 2FRVA 1B93A 3KQQA 1Y8CA 2QTWB 4U0KA 4MP6A 3A9TA 4I8DA 4XJVA 3S7ZA 1JEYB 2P90A 3NH6A 3S0JA 5GIPE 3KQHA 1GKUB 2J48A 5I9SA 3M6WA 5AK5A 1CU1A 3JATB 4L74A 1PJ8A 3NHMA 1ENYA 3E9EA 3W2FA 2QJRA 3ONEA 4IJ6A 3PUHA 1WDLA 4WUVA 1KI7A 4KITB 1SRRA 2AWOA 5BR7A 3B6JA 3DL4A 3A6JA 2PMCA 3MXOA 2VJCA 3KOXA 1OD6A 3D6MA 3R5SA 3MWGA 1XTZA 3T7RA 2E4XA 3LVFO 2YIDA 3TMKA 2Y9MB 1HYGA 5L45A 5JVDF 4BVJA 2FRDA 5J4LA 1W73A 4X20B 1LW7A 2A5DA 2XW6A 5KWVA 3SVTA 2GCPA 2R8OA 3B2NA 3IXQA 3UO8B 4AQDA 1V7CA 1VG9B 4LNUA 3G7UA 2YZKA 3DEFA 5CT6A 3ZXUB 4BNMA 1IWOA 1DC8A 2EIXA 1YK1A 4UHEA 1PG5A 1NKSA 3JQ8A 2FPSA 3IAHA 3R5KA 3STYA 1SUIA 2A58A 2O7NA 3KX2A 4HRAA 1DJQA 1NIPA 2CSXA 3O1LA 3IQWA 4JB2A 4MDFA 4PSUA 1DBWA 1RTTA 1DTSA 1MC5A 1TEVA 2BTOA 2RBEA 4NU8X 4UVHA 5FQOA 4FXSA 1EE9A 1L5FA 2WRZA 3OOJA 5BT9A 3TW6A 4EQZA 3JVVA 3GQVA 4J0JA 3EGIA 3LTEA 3ROEA 3CLSD 3ZWAA 1JQ3A 3ZWBA 4H3HB 5JVDA 2XEDA 3PWKA 1NDHA 2GRUA 1QCDA 1V5IA 1G98A 2AKYA 1WG8A 2EZTA 4ZI2A 4N3BA 2R11A 4M49A 1BXGA 1ZYUA 2IGBA 2W2XA 2XE7A 2P30A 2GHRA 3D6JA 5J5AA 4EENA 1DQPA 1SC6A 3GJ8A 4OHZA 3U17A 1C9DB 1E5TA 4ZAZA 2V6BA 3DYIA 1VLLA 2WV7A 4DXAA 4O25A 3V8BA 1P1KA 3LGSA 3VJKA 2LKDA 3SHFA 1M3SA 3JQFA 4RPJA 7GPBA 4Q16A 2A1TS 5CB6A 2YVXA 2AN3A 3WLMA 1D1QA 2OUIA 4Q3BA 1H3FA 1E1NA 1USKA 1Y6RA 2R84A 1MFZA 1JPJA 1BOFA 1SXPA 2QRJA 2B4AA 4ARBA 2DR2A 1HOTA 5DULA 4C03A 4E6PA 4CLXA 1WP4A 4MW7A 5CLQA 1JPVA 3DSRA 1HE2A 1ZA2A 3DT6A 3ZDRA 4K40A 1N36B 2WEKA 3FJ1A 1UP7A 3WGLA 4DUGA 2DFVA 4BVLA 4X1OA 1HDGO 1CJCA 1RQPA 1Y5MA 4Y6QA 3CF2A 5T4FA 7AT1A 1H5UA 1N0VC 2MR6A 5K05A 3AM1A 3DE3X 1CQJB 3B82A 1GRCA 3HFJA 1XZAA 1ZVQA 4XYBA 2WB2A 4H4CA 1S8AA 5AXDA 3PGXA 1BG6A 3O31A 1V47A 3AF0A 3FD8A 1FK8A 4J94A 3RUEA 5HQ3A 1KYVA 3KAQA 4CF6A 3D4LA 4BB9A 3OEWA 1EFHA 3GIWA 2A88A 2D5LA 1ZH8A 4R2LA 5J4YA 4RH1A 1SELA 4FJ1A 1GCIA 3OMXA 4RF5A 1I7LA 1PGQA 3DLIA 3IHLA 3JPYA 1FSFA 3IVGA 4ON9A 5HJ2A 3O2JA 2I4TA 4GICA 4UCQA 2QG9A 3JYHA 1KFEB 1S2OA 4BUZA 3SIRA 3FWHA 4S04A 2D2IA 4RJ2A 1EGHA 1NASA 2QD3A 5IAKA 1KTIA 4GXTA 4WZAB 2XBMA 2LW7A 1J8YF 2IBSA 1BQEA 4EKNB 4L9RA 1E8NA 1Y9EA 2FZKA 1U0OC 4ZJZA 4OHRA 3KVOA 4KTTE 2WVHA 3U1VA 5CEFA 5IXSA 4W5RA 3U3ZA 1IB0A 1E5VA 2OD7A 4B7AA 2ATIA 1E9CA 3CEMA 2D4ZA 1JJIA 4RE5A 4DM3A 2F4VB 1E2QA 2CLIB 3TG8A 2QLJA 3IDFA 2ZGVA 4HDMA 2O8VA 4JJZA 5AVSA 4HFRA 1ARZA 1N8NA 1V1MB 2QY6A 3MBIA 2YRXA 3D8NA 4MWZA 1RLJA 3CIFA 3QLTA 5FO0A 1O95D 4YXWA 4P84A 3SS9X 1ABBA 2JLUA 2FUNB 2DMRA 3KFVA 2B92A 4F56A 4IMRA 1NI4B 5JAOA 1C30B 3ER9A 2BRUA 1V8OA 3K53A 4M9UA 4PXYA 1ESEA 5L51A 4OCZA 3C3JA 5KSYA 2F43B 2UV6A 4PRZA 4HXGA 3T7CA 4CM1A 1W5BA 4HEA6 4EFNA 4KSCA 2VP6A 5KNLA 4WJKB 1C9KA 3HSYA 3OLYA 4I4NA 1RI1A 1HQKA 2A30A 1DC5A 5EUBA 3KBOA 2C61A 1TB4A 1XI2A 2QG4A 3KYBA 3QEOA 3T3NA 4K88A 6LDHA 5DHFA 3U9SA 3FWSA 4FGSA 1QGOA 3PVZA 1W9MA 2F1RA 2HCTA 2ZSKA 3GJ6A 4G2TA 1BSVA 3RNLA 1U65A 4HNAA 2POCA 3F6CA 3CR7A 1CF4A 4HWOA 5CP8A 2JAQA 2AD1A 2BHRA 1QPGA 1WVMA 2IW1A 3F6SA 4GE3A 2I91A 1NC1A 4GYJA 3DYVA 3FPAA 4L16A 3S2EA 4KH0A 2QN1A 2CXNA 2Z9DA 4H18A 1KIMA 4QYMA 1C1DA 4A26A 4Q7JB 4FT4A 2OK7A 5EXDA 4CQMA 5BQ5A 5L6MB 1SVOA 2ZTUA 3SYRA 1O5IA 5ENVA 3SC3A 4RSRA 2G8NA 3DZHA 4LYEA 1II8A 2A5LA 1CY2A 3D3EA 4IRMA 3LUAA 5LMCA 4QGSA 5DLDA 2WHXA 3IBFA 4UATA 3RSHA 3O3MB 3TJMA 5DHQA 5JI3E 2GJ4A 5JMOA 3A3KA 4MCIA 4HGPA 4C88A 1UQTA 1PF7E 1KYYA 2A9JA 4Q9JA 4BNZA 4D9GA 2AV6A 3EDQA 3FUXA 4KGZA 2ZRCA 5FPSA 1DFGA 1GZ5A 1HFWA 1P91A 4FI3C 1Z8HA 3OLCX 4YJHA 4ZXFA 3EIUA 3ZHZA 1E3DA 2FR8C 4PZZA 2H1HA 4MOWA 1YB4A 2WYVA 3DO5A 1KR5A 3OZDA 4FFOA 4O0MA 2BCJQ 2XWBF 4NYJQ 5HNKA 1DEKA 1QCCA 3B51X 1X1RA 2O1XA 5JBIA 3VGJA 3WIOA 1C2YA 4CLOB 1KZ7B 2QTRA 3S4YA 4DF3A 2BHNA 1JI3A 1GYRA 3F46A 3RVSA 4XUDA 3EZXA 3JS5A 3S70A 4G84A 3TSOA 2H63A 5FUXA 2OV1A 3H5WA 2XTAA 3MAGA 1NI5A 4U0JA 2IV2X 4UASA 4ESEA 3K2EA 4ZJPA 4FWTA 1KZ9A 3L0SA 1BNCA 4O1HA 3R74A 3DMYA 1B74A 2Z0MA 3DFZA 1Y81A 3CLUD 4H59A 4ZQEA 5JPIA 1PHRA 3HWRA 4ENQA 3VR6D 1EB9A 1L4UA 2G70A 4ZCPA 3WL7A 4XGKA 1M7BA 3IKVA 5KNCA 4K9SA 5E7JA 4L27A 4UMFA 2F8SA 1JBQA 2I7VA 2WHRA 4G8JA 4LRWA 3HXOA 1JEAA 2DWUA 3L1HA 1B16A 4KW7A 4LZPA 4NZPA 2PLRA 2QSJA 3B5IA 1G5RA 5B53A 2RARA 4QGAA 3SS7X 221PA 1NVVR 1F0NA 3PRYA 4FHZA 1W75A 2G09A 1UBCA 2YCBA 4LMAA 3VKVA 1IBRA 1T13A 2J3LA 2X9LA 4KR2A 3TR6A 2GXUA 3RBZA 3INNA 4II7A 4N03A 2BGTA 5J5VA 4CETA 3G82C 5JCOA 2GF2A 1J70A 2NU6A 4UBIA 3EHDA 2VBCA 1WXFA 5ESRA 3RTDA 5CYFA 2FPPA 1KQFA 3ZWNA 2EFHB 3P0FA 2IEYA 3L8YA 3ZCSA 2OCGA 3B9BA 1AUPA 1QS0A 3EA4A 1WCV1 3PHIA 3W2EA 3Q3IA 4I4TF 3W7BA 5B7NA 4JL6A 2WD7B 1JALA 1Z82A 4URXR 1Q12A 4K9QA 1K2WA 4EUSA 4C04A 4BX3A 2XTNA 1PX2A 2I34A 2QGZA 1CUZA 2ZEJA 5DBFA 1D7AA 1UP4A 3P8ZA 5I7HA 2XMRA 1RYDA 1W30A 3DF7A 2H1VA 1O0SA 1QORA 3R4VA 4OOFA 4YMUA 1GA6A 2PH3A 3UJ8A 3IP6A 4DV0B 1T4MA 2JFGA 3ONVA 4CV0A 1H05A 2AZMA 3OE7D 5LBUA 3PC7A 4WCFA 5JROA 4W5TA 4NLLA 3ZGLA 4Q3DA 4HX9A 5KYKA 2YNMD 1T25A 4H16A 4JAVC 1NBHA 2NIPA 1N6PA 2WA2A 2WFLB 1L5HB 3CHYA 3ABSB 3LY7A 5J2TF 3D5EA 4B3IA 4I4TA 1XXHA 3UOWA 2O50A 1GZ7A 1LV8A 1NBOA 2IYTA 1AKWA 3T41A 4YUAA 3DLCA 1CWUA 3F5QA 2EF1A 4XW2A 5JMWA 2II6A 3QU9A 5HF9A 3C8DA 4BCCA 4XYMA 3K0CC 5LPNA 2PDAA 4NZOA 1DAFA 4P93A 1EHYA 2P0YA 4ZANA 4OH7A 3PEWA 1Y8QA 7REQB 3CNLA 3I30X 1ZWKA 4FX5A 4QUIA 4E5MA 1YFLA 1EJ6A 1O94A 1SCJA 2OECA 4G5FA 1V9LA 4BEVA 1P3DA 4OHBA 2FF7A 2RC6A 4CDMA 5ARCA 5L3QB 3GVPA 3AEUA 3VVCA 4AJEA 3AIKA 2V7QA 1WL8A 3D2BA 3KTDA 3AVTA 2PSSA 2BY4A 4AMVA 3BXFA 3NLLA 3TAHA 5J2TA 5IXYA 2GZAA 5JECA 1I4OA 2QVCA 2ZTMA 3CVUA 2EQAA 4JJ7A 3OQ6A 4J7UA 1RHQA 5KTYA 1DC6A 3L8GA 1W4ZA 3ONWA 1L7PA 3RKSA 4RK0A 1TYEB 4BNKA 4YCCA 2JBAB 4G1CA 2I8AA 2JK1A 4D8VA 4NEQA 1VPTA 3KUUA 1ZQ9A 3QK7A 5DLPA 1I3KA 3AHCA 1R2QA 3UHAA 1R0BA 1NVVQ 2G1UA 2NUPA 4X54A 1SUDA 2ZJ7A 4FVTA 1CS4C 1XD8A 4HQRA 1HC7A 1FYFA 1FTGA 4LHXA 1MKYA 2I4IA 3TK1A 2IH4A 3L8DA 3CRRA 2PBZA 3ADOA 3HL0A 5C8VA 4MCAA 1DRWA 3FYTA 4FWBA 1B0UA 1IIRA 2CMDA 3DBOB 1RNLA 2AOUB 3E84A 5G1OA 1D07A 1I1QB 4S1WA 1PWZA 2FEPA 2X41A 3H1BA 3L6RA 3L82B 3EAQA 4K9MA 4B71A 4GNKA 4J3NA 1CNMA 4RZQA 1X9HA 1M34E 2O2HA 5J58A 4KMMA 4JXJA 4MPJA 4C7MA 3PRHA 1TA0A 2IY9A 3DZDA 4IGKA 5BMVB 5JQWA 3IR7A 2E37A 3JQGB 4GKVA 3UFBA 1HRKA 4CCAA 5KYXB 3WLKX 1A04A 4TQ9A 3PS9A 3T3HA 4ZCIA 3F5MA 1XNJA 1WW3A 1E5QA 4MR8A 3ETJA 1X1DA 5IUKC 1PU2A 1YDMA 2CZCA 3LCCA 3R2JA 4LOHA 2RK4A 4BNHA 2CD7A 2XSZD 4GYYA 1GU0A 1U7PA 4P81A 2DPMA 4LTMA 4XM1A 5G0TA 1FFCA 2ACVA 2CL5A 2HF2A 2PZEA 3PFHA 4RCVA 5IT9A 5I9IA 4EYOA 2I03A 2IYRA 3GXOA 3N6VA 4N6OA 1WMAA 2AG5A 2W93A 5EWLA 5LXTB 4JQCA 2FPGB 2YH2A 2OAGA 2ODBA 5FJJA 3EPHA 2RBKA 2PYZA 4O2BB 1JDVA 3FPBA 5FCDA 1CEYA 3GYGA 4D6PA 4AO6A 4RVFA 3V9AA 2PZBA 5CDHA 4H4EA 4NZNA 2HFJA 5L95A 1QONA 2JJMA 2D2EA 2IELA 1X7XB 4YPVA 4LHWA 4KI7A 4PG5A 2K4MA 3N2KA 3ETHA 2QLTA 2X5NA 2OGWA 3DUFB 3UUWA 4NCXA 1XROA 1CY0A 4N3CA 1ZDMA 3X1JA 1YS1X 4ZYLA 2Z8YA 1A5BB 4KO2S 1XZMA 2HREA 4MTCA 4UXIA 1Z0AA 5CNKA 1ODTC 1VE7A 1OFHA 3QXXA 4TM7A 3LFZA 4K8OA 2AH5A 2QOEA 1E1CA 4CQLB 2IOFK 3RM3A 4A5SA 1XLWA 2O2CA 4LX0A 2X0EA 3ZJ4A 2IS4A 1NXQA 5F35A 3MWEB 1DDOA 4R9SA 3EFBA 4KDFA 5CH3A 5IJAA 1Z4NA 4NNPA 1OXVA 4JLJA 4O1MA 4QULA 1E4EB 4W1PA 3W79A 3WLQA 3ZV5A 1ZXBA 1BFKA 4MUAA 5ALSA 1UDWA 1RZ3A 2WJWA 4OQXA 2VS1A 4MYUA 1IH8A 2W0MA 1VRCA 2D3TA 4NFSA 4UFPA 1K6JA 3IV7A 4I8IA 4ZVTA 2VTBB 4XFJA 1H2FA 4MNTA 3VYUB 3ABOB 4XJXA 4OFBA 1GGEA 2IY8A 1QP7A 4J49A 4AKIA 1V0JA 3FMVA 4B0PA 4AJJA 2ZUSA 2GM9A 3DNMA 2AC4A 3NRCA 4PLGA 1BCSB 1U6KA 1CTQA 1XE3A 2AJ8A 2PANA 1E69A 2N0SA 3ACBA 2G25A 4MQEB 3WNDA 4C5AA 5EHZA 3HB5X 1VIVA 3FSGD 2IV7A 5EN4A 4XM0A 2GN4A 5A9SB 4F12A 2X9VA 1PX0A 4UUQA 2XJ9A 3TNJA 2XRMA 1ZK1A 5IWCA 3CRNA 3I9FA 3JD4A 3WK4A 3TEJA 3WSTA 3LXUX 1U0NA 4ZAFA 4RORA 3ZW9A 1RAFA 1ZC4A 2R8YA 1C80A 2VUIB 4KXNA 3CSDA 1G18A 5EQFA 3W34A 4RM3A 1S9DA 2UYGA 4F06A 2GHQA 3PRJA 2I6UA 3SWWA 3BXPA 5KJ6A 4B3HA 5HQ3B 2CE7A 3ZDCA 3IDAA 3REOA 2RGRA 4NBUA 1Z83A 2CVQA 3NIBA 1Z35A 4QUEA 3KKZA 3BXEA 2MSLA 3NDJA 1MB0A 4OBBA 3OUZA 5F1YA 2RKBA 5LQDA 2X7XA 1ZGCA 2PGLA 4EK9A 3KQTA 5KEIA 1UM9B 1CY1A 5BRJA 3GGGA 2ADFA 1F8FA 1DKQA 1L3CA 1YJ5A 2VP2A 3DG9A 5DM60 2R6DA 4CU2A 3T3MB 1KDRA 5LL6P 2PLFA 2QM0A 1AKRA 4IMJB 1X7WA 1RACA 2V8OA 1L1RA 5TR9A 4Y8VA 3D3NA 5AM3A 1FW6A 4KQMA 4JBIA 2FKNA 3W4JA 3QGMA 2PD6A 1M2VA 2VP5A 1ZNQO 3GG2A 1EK1A 4E6EA 4CLHA 3WLOA 1RKXA 3TR0A 5I4BA 2X40A 3RUDA 5BN4A 3CIOA 1TO2E 1N4AA 1KO8A 3O3OB 1XEAA 3MCVA 2PWPA 2FV8A 1I4WA 5CLGA 3URKA 3UUEA 2FMHA 3Q8WA 4CL3A 2YIMA 1G8GA 3Q10A 1KI9A 4K2HA 4KR7A 4E46A 3S44A 1CD5A 5MFZA 4EGQA 4IGEA 2P9HA 3EVCA 4Q4HA 4V3BA 2ZVJA 4G5OA 5SZJA 5K03A 5GGYA 3HKBA 3U7QB 4D5GA 4O29A 1GM5A 2GD2A 2PRKA 3EULA 4UOZA 4JEUA 1ECCA 1GR1A 3J7AC 4IEIA 3HP7A 1WA5A 3E61A 1SK9A 3H9GA 3RSQA 3IL2A 2QTAA 3G49A 1OFGA 3LTNC 2YBEA 2EEPA 4E2ZA 4EYEA 3VQTA 1YJBA 2H1OA 3GAMA 4JZYA 1BMQA 1X14A 2YWBA 1GRQA 1TF2A 3C6YA 4NH4A 4B3CA 2WF8A 5DCWA 2OA0A 3TNDA 2ID4A 4Q9IA 1NLZA 3ZY5A 1JLLA 1NM5C 1H3NA 2RGNC 4WT7A 1DJLA 2IV3A 3S68A 4EPTA 3IKTA 2RE8A 4UHJA 2DKFA 4HGYA 3KZKA 3P19A 1K4YA 3BBLA 3FOAA 4ZVNA 1I13A 3KB2A 1SQ6A 2ZYIA 1ONNA 1AGNA 4V0MA 1T2FA 1X94A 3ZGXA 3SD7A 2LIVA 2JRLA 2F17A 1HE1C 1H6DA 5B4TA 1QYVA 4XEHA 4HYYA 4F2PA 2QXYA 4TL9A 1WUJS 3QY0A 2AUMA 1NJ5A 1QO0D 3L6CA 3PUIA 3SJAA 2C9DA 4NFHA 5AXAA 1XD2B 4FUTA 5JASA 4L0DA 4HGRA 2BFEB 4PANA 1TVKB 3OZEA 4R2MA 5GOTA 2OCIA 1LDEA 3TSZA 4EW2A 3RC1A 1NF3A 3KG2A 2OWEA 2BT4A 3OF3A 1JDBC 4IXNA 4R83A 2GZMA 1ZVKA 3LCJA 3ESBA 2IYVA 3TGWA 4KE9A 2Q41A 4TMKA 5COQA 3ZIDA 4AJ4A 3IEMA 3SDZA 3MS2A 3Q4GA 1GWNA 1O58A 2ZVQX 4JIMA 3WIUA 5BOSB 1FL9A 2BLNA 1EUYA 4A27A 2A0UA 5D3ZA 4G0YA 2JD2A 2O16A 1V8BA 1J6UA 1L7MA 1XL1A 2ESRA 1FSGA 2GGSA 1P18A 1VL8A 2VWPA 3E6AA 2C78A 2UYOA 3OJEA 2FUKA 5EPOA 1CDZA 2DWQA 3HYCA 5FV7A 1UMCB 1E1LA 4BAUA 5B36A 2SKEA 3DZKA 3FZQA 3VPDA 3ZQ4A 3ZX4A 5LKRA 5HW0A 3E81A 2BLLA 2LE0A 4A0SA 2ETVA 3O5AA 4Q1AA 1L5MA 5KB3A 4BLTA 4QASA 1P2UA 2WIAA 5E1MA 1AZLA 5DT2A 1M6HA 3RYFA 4P4GA 4IIVA 1F7VA 4GRAA 4FHDA 2WBLC 5IANA 5B2FA 5AVJA 1G8JA 4IH1A 2ZETA 3ZBUA 4B6EA 4TTRA 4ZC1A 1PZEA 3FYUB 3P4UA 4DJJA 3I5XA 3VA7A 3L7AA 4B3TB 4M7PA 1MB3A 1BN6A 3HL4A 4MVJP 1L5GB 5FTMA 2JLWA 4EELA 1R5NA 4M86A 1P2BA 3KT0A 3G0HA 1JE1A 3HVUA 4CQJA 4CG1A 2KI5A 3E9NA 5LZ7A 3ML1A 1OMOA 3NUQA 4M1EA 3CT6A 1RLTA 1XGKA 1PFYA 3B6EA 1TC2A 2IYXA 5IASA 3U6KA 521PA 4HPWA 2PWZA 4INJA 1XRMA 1XNRB 4LRYA 2IYWA 2OCAA 3Q6NA 5CX1A 4KJZA 3EEFA 4L4RA 2O48X 2ECKA 4F0JA 5FR1A 3EF1A 1DCKA 2PMDA 5FQNA 1DBPA 4GGPA 4EA6A 2BSXA 3E3MA 4P08A 3OJOA 5EOVA 1O1YA 3SE7A 2PZMA 3RBXA 1LDNA 2X1LA 3KBBA 4PSCA 4RMHA 3I62A 1FFXB 3D6TB 3ETGA 4EUFA 4NMXB 1NAHA 1WPQA 4GF5A 4HNHA 4MYCA 3ASYA 5E4JA 3CNOA 4MA5A 3RARA 2YMPA 3TTTA 4P38A 3MTQA 2NXWA 5K0EA 2W2OA 5AVXA 3H2HA 4UZSA 2I8CA 2VF7A 3R5FA 3U0VA 5H7XA 2A7QA 4Z8YA 2IODA 3HJGA 4ND6A 3RTGA 1GQYA 3FBTA 1ENOA 3EZGA 3KL2A 5HR5A 5HILA 2REQB 2NSHA 2IBTA 3MBOA 4WZBE 2PGOA 4JA0A 5A05A 3WQHA 5AW7A 4UE2A 4ED9A 1DV1A 1XQWA 4R1MA 1KRXA 1TTTA 1JT2A 4XB2A 1K7FB 4G4GA 3PP8A 2PRYA 5F33A 3P2JA 3NU1A 4H3SA 2DBRA 2O8CA 2VH1A 4LKRA 3QUAA 5FL7A 1F2TB 5KREA 2J3QA 1BVHA 3KPDA 1E66A 5EZSA 1M1YA 5CT4A 3ZS9A 2O2DA 3Q87B 1K6EA 2MYPA 2OKCA 1YQWA 2BFNA 2Q2OA 4RPLA 2NU7A 3RS4A 4IJVA 1Y82A 5ICCA 1TT7A 4U5XA 5JSFA 3MTBA 4GNRA 2ZJFA 1L5OA 1KSFX 2JBHA 4ZDIA 1WABA 4K9OA 3JPWA 4QXQA 3TBHA 1T2EA 3DEAA 5KDDA 3WK8A 1KWKA 2JI6A 2UV4A 4OSEA 5E8RA 5AKXA 1LC0A 2Y1CA 3IP8A 5DX1A 5JE8A 4D46A 1U2QA 1WHSA 4GMXA 4UC0A 2HKIA 4P83A 2AW5A 1RHJA 3H6KA 1KH1A 3O82A 3U44A 2QE6A 4OFXA 1IQRA 5JS2A 1C7EA 2XWJI 5HRCA 2E7ZA 1BQ3A 3ZBQA 3V1MA 1M0EA 1BFDA 3QW2A 3WRXC 3ENKA 1P72A 3RYTC 4DQVA 3R6GA 3OF5A 4YMTA 1E5DA 3E8XA 4F1KA 3FYCA 2Q21A 1OAAA 1BHQ1 4MGIR 3R7SA 4AO8A 1CBUA 2W8BB 2P79A 3RRXA 5I3ZA 1WB5A 2D1SA 5AI9A 1UDXA 1RCFA 2YW9A 1X80B 4HADA 1ORRA 1RJEA 3EYWA 4HLQB 1EQAA 2YMMA 5AKLA 5F2EA 4CKYA 1L5KA 1JIKA 2D3WA 2IP2A 1AQIA 1OX4A 3G5UA 1R6XA 3AESA 4YRAA 5BW5A 2R5WA 5KTNA 2GN8A 3AY0A 2O8BB 5HIAA 1FSPA 4IDGA 3I0NA 4RY2A 3I9V1 4MUJA 3STHA 4N5IX 3PJGA 2PD3A 4XWOA 3GN1A 3K6EA 2VHWA 1YBVA 4K7JA 3EVGA 1H4QA 5E7QA 2MMCA 1MVOA 4UNSA 4DIUA 1KY5A 1ZM3A 3QWAA 5KC9A 4QTXA 2NSYA 3QOXA 4Y6PA 2VDKB 3DQQA 1M6VB 1P39A 4L5IA 1N6KA 3DR5A 5JANA 4L4UA 1D2NA 3NTQA 3PCRB 4BHTA 2SCUB 3FR7A 1V8DA 1HFJA 1N2GA 4K81B 3F90A 4Y2GA 5TVGA 4BN0A 2VRCA 3GAZA 4RWZA 1H1LA 2J7KA 4YCJA 2JFHA 1I80A 1MO5A 3AVQA 2FW9A 1NBEA 3C5HA 4BQSA 1CLUA 1IY2A 5ESXA 4MPPA 4CCYA 4EG4A 1G5HA 2WABA 1JYFA 4BIMA 1F0KA 2ODEA 1ZONA 2BP7A 2WJYA 2JHFA 1K5PA 2B4RO 1YMVA 2YMLA 3EC2A 1GFIA 2BFWA 1N0UA 5ALWA 4LJ7A 4F3YA 5T3UA 1GL6A 3DZ8A 3R7DA 2PTGA 1UZUA 2R47A 4L5BA 1T1SA 2AMLA 3JQAD 1ZXXA 2VJAA 3VMFA 5IJWA 4RQAA 2H0QA 2QENA 3BWMA 3FHLA 1CUEA 5DIFA 4ZGBA 2HMYB 2PUTA 1YDEA 2QL5A 2JA3A 3RSOA 4CT0A 2CFCA 1ZL0A 1T9DA 3LQ2A 3VMMA 2VOJA 1E1QD 3ROMA 1L7EA 3AF1A 3CLVA 3GZJA 3QY9A 4Q82A 1UFRA 3V1NA 2CY0A 2VJPA 3N39C 2H1IA 1DRUA 4Q1VA 3U39A 4BECA 1DAIA 4B4UA 3GEIA 4D3XA 2X22A 3ISVA 4XSGA 1Q7GA 4BNXA 2VPZA 2XX3A 1KK3A 1JH9A 3THWB 2B1GA 2CNKA 3K3PA 3AERB 3GEDA 1IJEA 2Q2VA 4N0PA 1MJ5A 4PXAA 2W6JD 5K0ZA 3AKEA 1MABA 1U8AA 5A5VA 3RSSA 4R01A 1GTL1 1TF5A 2NO6A 1QLWA 2EFDB 3ETNA 3OFND 4FBGA 4Y18A 4BO3A 4D2IA 5KWSA 3PVCA 3FZYA 3K9WA 2E49A 1QBGA 4G9EA 4J6FA 2EGUA 4BY9E 4MVJH 1QVAA 4MK4A 1NR7A 1NT2A 2G82A 3I2JA 4OXKA 3DCYA 2RH9B 4Y2HA 4ZVPA 3WI7A 4MVYA 2FG6C 1JQLB 5K25C 3V2GA 3H1FA 5F1PA 1C0EA 2WQ6A 2BZGA 4Q01A 3IERA 4KO3S 5K8UA 2PUAA 4IY4A 5EJ8A 5LNK1 2OO3A 4F4JA 1CLEA 4FNGA 3D7NA 4X00A 1KEKA 1QGUB 1QXSA 5DM1A 1J23A 3M5PA 4PR0A 3ELUA 3OCOA 2CMGA 3MW8A 4HNVA 1LTQA 1SO8A 2Q45A 1RWMA 2L17A 2I6SA 4TVOA 4UPVA 5K3FB 3V8MA 1Z06A 4EG3A 2ILVA 4DZZA 4YCLA 5LYYA 2JJ1A 1L8QA 3UV6A 3U3XA 1NP3A 4LDAA 3LX5A 1AQUA 6ABPA 3QI2A 3GP8A 1RKBA 4XA8A 3RFUA 3ZV3A 4WH0A 2OAQ1 2ZREA 2ZRPA 2B8NA 4NZMA 3NRBA 1OI4A 2I2WA 1V43A 4ID9A 2UYHA 1ZEMA 2RONA 3BFVA 1O4WA 4HWPA 2YXLA 1Z88A 3DVAB 1SU8A 1SC3A 3A6FA 4O4JF 3ZWWA 4AJLA 3AV0B 3DZIA 2YHAA 3MHPA 5B1IA 1X3SA 1T1GA 3R0IA 3BXXA 1KVUA 3QE4A 5DF1A 2PMEA 1UOPA 4D9JA 2FGKA 2NZWA 1G8AA 3QJGA 5E2AA 5EIXA 4FRYA 1Q1ZA 3GFRA 3R0XA 4BB0A 4B47A 5LLSA 1OTYA 4KL8S 2GX6A 1DAOA 2OYSA 4JI5B 1WULS 4GI5A 1CUSA 5ITZA 4LJKA 3OZTA 2RC5A 2BR4A 3HDVA 3MJCA 3T9FA 3S8MA 2OV6A 4KIFA 2F48A 2NNWB 3I53A 4JR2A 1YU9A 4ROSA 4R7TA 5AM5A 5FDFA 1XZDA 4H1TA 3NHKA 1A9XA 4MYDA 1QE5A 2P9FA 5BORA 3KYJB 1SBTA 1E2KA 4PIMA 3V00A 2GHTA 1KMQA 5IU6A 3CJRA 4O4JA 2WT4A 3SU8A 4N5LA 1HE5A 1M1NB 4JYPA 4FN5A 1Y7PA 1QO9A 1XKXA 2OGSA 1VJDA 4GXRA 3FNEA 1RI2A 4MP3A 2FXIA 3UUGA 4G37A 4ZU1X 5IJ9B 3O38A 2GERA 3L01A 4JASB 3L06A 2K7ZA 3H9UA 3GA5A 1H6CA 3DBHA 3QYPA 5KQSA 4FC7A 4DB4A 1LC3A 3I2FA 3BWBA 3PUXA 4IJKA 4OVKA 4PAGA 5BO5A 5LUBA 4BJHB 4DUPA 3JQAB 2SICE 3PE6A 1IZ9A 2CD9A 4U7PB 3EHEA 2XGGA 1JHQA 2B9EA 2HU5A 1KC1A 4QJBA 3KB6A 4TL8A 4MIOA 4Y2YA 5F5NA 3H83A 1CXZA 3TEFA 1IQPA 3GK3A 4BQNA 5IHPA 3VC2A 5F7ZA 1KFJB 2BN4A 4YRJA 1L9KA 4JUDX 3DTVA 5JD6A 4JQZA 2ZDGA 1H8ED 2J87A 3E70C 3L77A 1ULSA 5ALIA 2BOVA 3WY9A 4DMKA 4RYLA 4GBED 4F96A 3WV4A 1LRLA 2IZ6A 3QPVA 3W3AH 4JBNA 1G5PA 2FRDC 1ZK2A 1VLZA 2HQRA 3BE8A 4HYTA 5E6SB 5BQXA 1BFUA 5CW1A 1BS1A 3HP4A 5BSEA 3E1SA 3OQMA 4QOSA 1P9WA 1DRVA 3H5LA 4D81A 1YS9A 1E9RA 3BIOA 2QK4A 1GDTA 4GKJB 4IDOA 2DQSA 2OHIA 4PC7A 5ALZA 1Z18A 3FKSD 3GEHA 2IVZA 3MERA 3ELBA 4E09A 2UV5A 3N0TA 2HXSA 4BO1A 4KPYA 2O14A 3O1IC 4KMRA 4LCBA 1REQA 2OD9A 5TPZD 4BFUA 4ZI3A 4B84A 4XFDA 3UMCA 5FUYA 4ZEWA 4BJ3A 2Q9UA 1PJ2A 3KEFA 1NF2A 2HQOA 1BHJA 3H9EO 3KLNA 4R51A 3OKCA 4MVJD 3W6ZA 1Z8FA 1CG6A 2QN3A 4P8RA 3KETA 2VCYA 1BHSA 3GGDA 2F8MA 4BQRA 2G36A 2OPBA 5BN5B 2P6PA 2W00A 4A6PA 3N9IA 1GQOA 2XYPA 2HEGA 3OC6A 4S1PA 1G3MA 1LVGA 3OPYB 2E4VA 3NUGA 2IDZA 2HDHA 4JCCA 4HJXA 4G07A 4GC5A 3I9NA 3LM8A 2VK8A 4P1GA 5DHPA 1G59A 3O3CA 5EHNA 1NMEA 5B12A 1P75A 1BDMA 5CVVA 5IKMA 5LDDC 3O3NB 1YB5A 2XWQA 5JJBA 1MX3A 1ZMRA 4V2IA 4CKEB 2XVZA 1H42A 3JQFC 4GZLA 4OSOA 5ELLA 3PJRA 1HX7A 1C30A 4OHVA 5LBTA 3RIHA 1Y4UA 1NW8A 2H0RA 2MCFA 2J08A 2Y1FA 4ZYZA 1AKUA 2WMDA 5JXIA 2ONKA 2GAAA 4AUMA 1Y5NA 3P9KA 5ECWA 1N5JA 3LL4A 5BSUA 1CQZA 4NBNA 5DK4A 2ZANA 2MR5A 3EVTA 4DTIA 2ZRNA 1R8XA 3RLFA 2B36A 3SZLA 5ICGA 4HYQA 2OKGA 1RD4A 5B4VA 3CRZA 1RAGA 2GLUA 5AI6A 5IDYA 1MEOA 4AROA 2QUAA 2RG7A 2VHYA 3BMCA 3VAZA 5J43A 4CEJB 2A0KA 1F6DA 5F12A 5FUVA 5BRAA 4C0XA 4ZVKA 4L8FA 1UBOS 4HFJA 3TUZC 2IFTA 3W9UA 4MEJA 4R71A 4YV2A 1DX6A 3N76A 4YK7A 2AS0A 4YUZA 2M1ZA 5MN4A 3R5JA 5C81A 2A0XA 2WVGA 4KUHA 4E88A 5EIBD 4LMBA 3UMGA 4PRLA 1IY8A 1QKKA 3ZU2A 3AV3A 5EIAA 1R3DA 4OLFA 2ACKA 1KR2A 1LX7A 3LKZA 4AULA 4E07A 2CLFB 4NPCA 2JHCA 2PSHA 3T34A 1TJYA 1QVWA 5SYNA 4KXVA 1CUYA 1R5JA 3IAS6 1DAGA 4IVQA 2FRXA 3EEBA 1KJZA 4QM7A 5ITWA 3WSVA 4FQ8A 4L4SA 3RT7A 5A1TA 2H7VA 3LY8A 4WAUA 4X3OA 5F78A 3NGXA 1PFQA 2FLKA 3MXTA 4NY1A 1I2DA 3AUFA 5AOAA 4NBSA 1UDCA 4MVJM 4AZVA 4BGUA 4TN5A 1Z0JA 2BGUA 4LI3X 2L0XA 1U7WA 2HF8A 1E5XA 2R6HA 5IKXA 1H0HA 1WB9A 3IA2A 1IN6A 4RFSB 4GKKB 4Q3KA 1FOEB 1USWA 4Z9BA 4GH5A 1GU7A 1KWGA 4AL4A 3LMKA 1XLTA 2CNWA 3COPA 3G6KA 1XLVA 3DT8A 1P9RA 1SBIA 2IIVA 3HEBA 3LVBA 1DQRA 1Z5VA 3EH2A 4UDNA 3KL4A 1YH3A 2FWPA 3DOJA 1SC1A 3NAGA 4EQ6A 3FY4A 3EZ6A 1FNNA 2NT4A 3Q1LA 3IUMA 1SZCA 2BRUC 3W3AD 1WCIA 2CEAA 1AJEA 2PS9A 1Y1KE 1XVVA 3GNTA 4ISCA 4QAJA 3PQEA 2P5UA 4D9MA 4FYYA 4QXPA 3CUYA 1ECFA 4JKYA 5DVZA 4BMNA 4ER6A 4BN4A 3FMGA 4FBMA 5FWXB 3U5TA 2YZGA 3AM5A 3GG9A 5CMLA 4PX5A 1Z7BA 3MGBA 1S8NA 1CUBA 5IIPA 1HSOA 1TRHA 4MWGA 5REQA 4ZZIA 2HCBA 3ZLUA 4JP3A 2QMYA 5BYJA 4JLOA 2QJTA 1G8YA 2FWAA 2J3JA 2C1ZA 3MRSA 4G5YA 5HFNA 1E2UA 2FZCA 1NSYA 4V0RA 1ZI6A 4CMEA 4DMFA 2O5CA 1M6NA 3CU5A 4ISBA 2EL9A 2B4TO 2A9KA 1U8UA 4O4IB 1C7JA 3R76A 1ZH4A 2O2JA 4Z1OA 1W7AA 3FH0A 1N92A 1NUAA 1ORHA 3PJEA 3OU6A 3FOEC 2ZWVA 1GNQA 1PQ4A 1TKCA 4IDFA 3AZPA 1QB7A 1KH3A 5B6PA 3AB8A 3IC5A 1ATIA 1F8UA 2BR5A 1XZCA 2WYIA 5FBKA 2ZBQA 3GWGA 4MVJG 1U8YA 4QU0A 3RAJA 2HLDD 5DNWA 1SHTX 3FA2A 3V34A 3IEXA 1BTOA 4PTLA 1P9NA 3R3WA 3WKAA 4AG3A 4BFWA 5HVNA 1ZBQA 3CF4G 1SBQA 2OBNA 2I3ZA 3OA0A 1Z6TA 1Z5ZA 3A6ZA 3EXFB 3W5DA 3QKRA 5B7PA 4OL0A 3LV9A 4QQ8A 4ZTUB 1LQ2A 4ABYA 3VYSB 1XAIA 4WZBB 2ZAIA 3DMDA 1H4TA 3W1WA 1SZJG 4L50A 3IAAA 4R1OA 4NOJA 4WKCA 3F7OA 1FFWA 2FOXA 2ZB8A 3G3EA 3WXMA 1EVZA 1MR3F 1X1TA 1MRSA 3PX7A 3FTDA 1GPH1 1R74A 1QR6A 3BD9A 2OLJA 3HN7A 4WHMA 4Q7EA 3K6SB 3Q8MA 3BKWA 1HDRA 4UEKA 4W6ZA 3DLTA 3NG1A 2CT8A 2WWVD 2E5WA 2WFLA 1XTRA 3ID6C 2B98A 4BAGA 1DUSA 2JF0A 1NA5A 2NV6A 3PPYA 1H4VB 3AVUA 3Q7IA 3BRWD 4XD7D 4PAQA 2O8EB 4C6SA 1JEEA 2IY7A 1S4MA 3ZQ6A 1IN4A 2GTHA 4EI8A 2CFIA 2ZQ5A 1SIWA 4DA4A 1DAMA 1GPBA 3CURA 2QORA 3OBIA 1OXBB 2BEWB 4HG2A 1E58A 2O0HA 3UMYA 4WASA 4G4IA 3RPEA 3KPYA 1O3YA 1B3RA 4BLPA 1RHMA 2C58A 2P9YA 1ZITA 2B61A 2K87A 2PT9A 3OCZA 4CF5A 3C3CA 2O2EA 1XFAA 3K31A 1H66A 2NOAA 1ZRMA 4IM7A 4H1HA 4DV4B 1RPZA 3LQFA 4IGIA 2C3PA 3EISA 3GWZA 3QH4A 4HWGA 4BVAA 1Z0DA 3BJMA 4UM9D 5IF9A 1PBNA 2XH8A 2VDMB 2KHZA 2WKSA 1NP6A 5HOEA 2J9LA 2C7GA 3GT7A 4FZ5A 3TNFA 3P9QA 3SF8B 3SY8A 3S2GA 2ZXUA 1ZRSA 1DWOA 2ZCUA 4FEAA 3VRHA 5GM2A 4ARSA 5BMVF 3DDHA 4OJQA 1DUVG 1FFAA 3F67A 4NAVA 3RNOA 4D3FA 2O7VA 2ZYHA 3I2YX 4CODB 4G1MB 4E3ZA 1EK6A 3HRKA 5KYWB 3IXMA 1MORA 3B6MA 4HNGA 1XPUA 3U56A 2QNBA 3VHXB 4LDRA 1SB8A 2EGHA 1KJ8A 1NJ6A 3OPXA 4HI0E 2BTQB 4ENPA 2C82A 4WCDA 3NIWA 3GCGA 1TI7A 4Q4JB 5G02A 4LYDA 4QBTA 3F96A 1MCZA 3H2GA 4KODA 1EUZA 2XUQA 1RBYA 4I4LA 1EDOA 1A3CA 1KYIA 1O6GA 3H0KA 4LXHA 4DRXB 2OE2A 3LO5A 2AFHE 2BFPA 3QOYA 2JFNA 3FWYA 3RFFA 5AVUA 4RESA 2ZT6A 3DWFA 4JKOA 4O2BF 1G2IA 1N9GA 4ZYTA 3PUJA 4WCFC 3GX1A 5BMVA 1C1XB 3X1DA 1VL5A 4HAIA 1UDAA 2D1QA 4PN7A 2ZS8A 2A6PA 3BEDA 3PNBA 4DY4A 1XALA 4X24A 5E4FA 3QLEA 3GAAA 3BULA 4BNYA 4R1SA 2UZIR 2YOGA 4GSKA 2J3HA 4FW9A 4Y7DA 3P9XA 5J47A 4Y2UA 2GF0A 2J30A 4RAOA 1YJAA 3TM4A 4IY2A 4UVIA 5LP1A 4ROTA 3G2MA 4EL5A 2J6CA 4MUHA 1D1TA 4JCOA 2HZ7A 1E1KA 1N2EA 1OJ7A 3K2BA 5J1TB 4DLKA 4O3FA 3E1KA 1O94C 3V7WA 4B6QA 3RVDA 1Z0KA 2C2HA 3VSBA 4KQHA 4DMUB 3FXAA 3U4IA 4O2BA 1XDBA 3OP4A 1GTSA 2B20A 2AFVA 2PEYA 2OV2A 2PKWA 3ULKA 4IFIA 3DKRA 2I0FA 4JI0B 1Q5PA 3FMPB 4KYUA 4FKMA 2ONJA 3KCQA 3GJRA 1F20A 1PG2A 2VAVA 1K2VN 2X76A 4R2KA 4NI5A 3IESA 1RWBA 3EZ9A 4RA6A 4UJ5A 5IN5A 4N41A 3WIBA 1NZFA 4DABA 2H2HA 5EGNA 2VNSA 4WNAA 5C1OA 1E8MA 4D43A 4P4UA 1UINA 2EFGA 2HJ9A 3EDOA 2FZLA 3EQ7A 4B33A 3HVKA 4DLPA 1KTVA 2YX1A 4HGNA 3C1TA 4AY6A 1BGWA 1PNRA 1VYHA 1L5ZA 3K8YA 1V39A 5HFAA 3RRZA 1U2GC 4CHTA 2FUCA 1VE1A 3B1XA 3HEAA 4AO7A 3BHIA 2B94A 1KKUA 2YNMA 5J5CA 1W85B 3SQDA 1FRVA 5IEJA 4PWZA 3EIXA 1QQBA 3IPCA 5IZ4A 3LBYA 4FW8A 4MV6A 5FULA 1Y3FE 4TWBA 4XVRA 2ZIUB 4ECEA 3RJZA 2VRNA 1FLAA 3H4MA 1R8SA 3IH5A 3MGAA 3L7MA 3RABA 3L18A 4UBOA 3SL7A 4RF2A 4EMUA 1A7AA 2JGFA 3C6BA 1KFCB 4PC6A 1FFBA 4MMZB 4X94A 3RC9A 2WZBA 2G9QA 2DH6A 3MJEA 1FDVA 3E18A 3SR0A 1NBAA 3SEAA 1C7IA 4R6WA 4ESHA 1CUDA 1KPHA 2LPMA 1XQ1A 3PXEA 3LT1A 2QRQA 4OQMA 4G6ZA 5IMSA 2EYUA 4FLEA 3R44A 5EJAA 2AN1A 4J0CA 3SX4A 1VSQA 4N54A 1OXXK 3O2SB 4S3MA 1HE3A 1BCSA 5T3YA 1TZJA 4EY5A 2YZ2A 1DQNA 1RRVA 3O8LA 3KXPA 4MQEA 1QGAA 4N12A 1CJSA 3HDHA 4BZXA 3OFJA 4UM9B 2XYGA 3L0ZA 2C2MA 2FOLA 4ZDJA 1WW8A 2ZBFA 3ECAA 4TTIA 2HK9A 1AA9A 4G4SP 1CS0A 1VLVA 5B57C 4J7XA 1K0UA 2QMUA 4MHOA 5IBCA 1P4GA 3NYWA 1JQKA 3H8JA 4GI2A 3DMFA 4ENTA 2XKJE 2VFAA 5IAEA 5JC1A 3UAZA 1JR3A 1XP8A 2NX2A 1B7GO 2WC1A 2XOEA 4QICA 4MWEA 3V2UA 5G0VA 4ZWNA 2FMFA 2C3UA 3N75A 1QPZA 2AUNA 2V97A 4FOLA 2QLLA 1U2DA 3LUFA 4K03A 2OFOA 3WKEA 1TM4E 1XYVA 1Y4ZA 4PFQA 3ZHOA 3AKYA 4OHMA 1Y8ZA 3O4GA 1ZIXA 1GFWA 2XR1A 5FAXA 6AT1A 3B1JA 4ESYB 1N2HA 5BSMA 3PK0A 1DJOA 3R9WA 3DJFA 1Q0LA 4D9HA 1AS0A 3A6KA 1UXGA 1QDEA 2IKSA 4GPEA 4LHVA 5H16A 2FP4B 3L4EA 1WMFA 2BHLA 2VQ6A 4CVNA 1CNFA 2NV0A 4MI6A 5A7HA 4Z3OA 1FXWF 1DKOA 3LHIA 4UHDA 1J0BA 1VLQA 3M6MD 4PFKA 1AF4A 4R9NA 3VZRA 1E79D 3ESXA 1DELA 3ECCA 3LF2A 3SS8A 1UJ2A 1EK5A 1N78A 2Q99A 1YQEA 2H5IA 1XMJA 3PD0A 4D9NA 4ESVA 4O5OA 2HSDA 2RAPA 4MSUA 4BEJA 2IBMA 2XSZA 1AKTA 3GFGA 2Q29A 2ENWA 4L8VA 1ZXLA 5AJVB 4LSWA 3B3GA 4EB0A 3ZY3A 1QG0A 4JVNA 2IIQA 4MUGA 4ZQFA 2K6GA 2UZ4A 1YZUA 2AE2A 1EXWA 3PLRA 2Y1GA 4RK6A 3SFTA 1O4VA 3MT8A 1PKXA 2VSNA 1QIJA 2WIFA 1FXWA 1XVTA 3QP9A 3OMLA 1IHOA 1CIJA 4LZLA 1GZDA 1N32B 2G9VA 3NGLA 4R2XA 1TIBA 1N8SA 4RKEA 2DKOA 1JV2B 3GJ4A 3IP1A 4WECA 5ALFA 3V3TA 4JC5A 1MOPA 5AVRA 2MINA 4KQCA 5C8DA 2P62A 1CW2B 4JWTA 5TQ2A 3TWOA 1OU4A 3DCIA 1RRPA 1CIVA 2AXEA 1J21A 2OC9A 1W1UA 1THMA 4KRFA 4TOIA 5EQDA 5FLXA 1E9BA 2QTGA 4NENA 3HHEA 3GDGA 2ZITA 5C1PA 2WNIA 2AN4A 3IVXA 1MZPA 1ORIA 1KSGA 4FPXA 3NBZC 4IV5A 3REQB 3LK7A 1VE6A 4A9AA 3K70D 3JARA 1BXRA 4YP6A 3EZFA 4DIFA 1E2BA 4HTFB 5CLHA 4AWXA 1EJ2A 3CRMA 2H4HA 1XD2A 4K9DA 4U00A 1IJKA 4DA7A 4D4JA 1TVKA 4Q18A 1ODLA 3K9BA 5FYQA 4RK5A 4TTTS 4KNYA 4Q24A 3X1KA 2XYRA 4EJSA 3SR4A 2E2WA 2Y1XA 3EF0A 4Q9HA 3UGQA 5C35A 4CIBA 4L8YA 1UWKA 3R3XA 5KSPA 2D74A 1E77A 3RTCA 4BQOA 4BZPA 3HUTA 5CB4F 1LFDB 2VHZA 3THYA 1DU4A 1EA7A 1WZCA 4KP7A 3AP2A 3ZHCA 1JNXX 1T9KA 3S29A 1YU6A 1JIVA 2V7EA 1GYQA 1QV7A 3HDGA 4BP9A 2F8LA 4M0FA 2QTVA 4MR7A 1M10A 2WWHA 3ZEIA 1M0SA 2V1UA 4IX9A 3GGSA 4QNMA 5JPDA 3MELA 3TIIA 3ZDDA 4BJ5A 3ECSA 3L04A 2WHPB 3DD1A 3RW9A 3JQ6A 4IOJA 3EZLA 4WEQA 4EGFA 3EIWA 3AI7A 1K7YA 4K1XA 1GUFA 3ICOA 3EWSA 4P9NA 2G1KA 4D26A 4ZOAA 3KFXA 4QOIA 5ITSA 1VL0A 2D0OB 4LCJA 5IPFA 2V3CC 5KVQA 3NHJA 4LG1A 3G0CA 1G5IA 4KREA 1SQFA 4ML3A 4HDKA 3ESZA 2XRYA 3E7PA 3UW3A 1XZBA 2NN3C 2W2TA 3NJ8A 2IXBA 4Q03A 5EWMA 4AKSA 3LWDA 4AWAA 4EY8A 5CB4A 1JP7A 3WQQA 3I58A 3EQ8A 2XUOA 1DKRA 4RY0A 3W77A 1YJCA 1IBMB 4WI1A 2C99A 2TS1A 1LPOA 1JHZA 1OVMA 1EDEA 1M2HA 1X1BA 2BM1A 1SCAA 1WXDA 3DZFA 3QHAA 1YNSA 4QT0A 4UXHA 3WHPA 2ZM5A 3ODPA 2AC2A 1Y6GA 5AKZA 5CFQA 1PUXA 3UQYS 2FMKA 3WKDA 4HLUC 2WKPA 2ZB4A 3A4TA 1HL7A 4LZJA 5F5LA 2E85A 4YWHA 5DP1A 1XRLA 1R4MA 1ZW1A 2AJLI 1FU8A 2Z2ZA 2OHFA 3BJEA 5C8YF 1XA3A 2V0GA 1CDEA 1UBMS 1Q19A 4KNWA 5FA8A 1YXMA 3F6BX 1KIAA 1G4AE 4XGIA 1RBMA 1XR3A 1XU4A 5K0LA 4TUYB 4XR9A 3VU1A 1E6EA 1FVXA 1WKCA 1F8YA 2C4KA 2L69A 4CT5A 2CWDA 4KZKA 4QJ4A 1YZYA 3CR3C 1XZEA 3S1AB 2IPXA 4M22A 2ZSJA 3W2IA 2OUKA 4R9RA 3VUFA 2OWDA 1XRQA 1Z2OX 2RDMA 3D5TA 3DOUA 3E9QA 4QWMA 1TMOA 2VYND 2ZIXB 4ZT4A 4Z2AA 5CPFA 1GFZA 3I9OA 1K75A 5KSWB 5BV2P 1RJDA 3AVWA 4WBSA 1FZQA 1PE0A 1RM0A 4BB6A 1K8XB 3INYA 4C78A 1UK7A 3BDIA 4DCGA 1P4HA 4O8ZA 3PR2B 4UQOA 5FWYA 4II2A 1GG5A 2C92A 5AESA 3P9RA 5C8YA 1L4GA 4OUDB 2NYEA 1F2TA 2O7RA 3WP1B 3ZJTA 5CA0B 2EJVA 2VJMB 3A14A 3CGGA 2ZRIA 1FFYA 1E4YA 1VJTA 4DXHA 5KMGA 1VHJA 2NP7A 4LJ4A 1CDDA 5K6RA 1H8HA 1W93A 1Q1GA 1FJXA 2W8ZA 4XRRA 1UK9A 1JWAB 2HU7A 2R97A 4QGFA 4OAOA 1K1EA 2ZPTX 3DM5A 2GNPA 4HH3C 5CVCA 4ZVUA 4DG5A 1AT1A 1G5FA 1ML3A 2W98A 3N59A 4BLVA 3K70B 4DR6B 1TA9A 2BEVB 3MOSA 1H1TA 2QX9A 2PFKA 2VBFA 5E4TA 1XO1A 1G16A 4QSMA 3LYUA 4B4OA 2IH5A 1LWOA 1U3DA 1QO0A 2O8FA 3ESCA 3EXHA 3FE2A 3I1IA 5ERYA 1JHOA 2IEGA 4NOMA 3R9IA 1E6LA 3T5GA 1AN9A 2MYNA 5IC4A 4MV8A 4UTRA 4BNUA 2ZJ2A 3FDJA 3WGOA 5TLSA 1V35A 3C14C 1U0LA 1FW8A 4CI9A 4F21A 3KOOA 5FEUA 3DDSA 4LYJA 3WYCA 4ZIRA 4B3RB 2MU1A 2YVYA 1FP4B 2PXAA 4QD3A 2CFTA 1F51E 3PGMA 5DTIA 1T8RA 3OIGA 2EJTA 3KYIB 1KMHA 4KOAA 3TS1A 5EJ9A 1Z07A 4LHZA 3ZWXA 1OFUA 2I29A 4QPDA 4RD2A 5JEDA 4O3MA 3ESAA 3R0JA 4BNWA 1X80A 3QFSA 4QHTA 5IABA 2MDTA 3L9WA 5FPHA 2QP4A 3LBFA 3HABA 2OQ2A 3UKJA 2GCOB 1ZH6A 5D85A 3ZVMA 3OHSX 3CGWA 1GPUA 2RK6A 1U8TA 3LQ4A 4AU1A 5ARDA 2C4TA 1RXCA 2YVZA 2Z4SA 4Q15A 1TM3E 1OV6A 2ISCA 3C3YA 3QRWA 4JBLA 4YBRA 1S96A 2QN2A 1UK6A 2BI7A 2IZ7A 4ONEA 1T3GA 4LV5B 3TG2A 1FLNA 1ZM9A 2PV7A 1MW9X 1TYAE 1T9AA 3B7WA 4PPFA 1T1EA 1RXSA 5DGTA 2HRDA 2QG6A 3ZHSA 5CCEA 2J3EA 5EEGA 4KR6A 2WAXA 4J1TC 1KFBB 2HIAA 1EBBA 3KZCA 3QUTA 3U7EB 1W8DA 1QTQA 2C2WA 3EGDA 3ORYA 1V3TA 3WGMA 4BFVA 3V8QA 1DWPA 3O4FA 2ERXA 4JN6B 3CX3A 3NBUA 1ML4A 3G2LA 5I7WA 1Z74A 3W06A 2X0KA 3ZLJA 4FOOA 1KDOA 5A0FA 2IYLD 1K8RA 1R4ZA 1KAQA 1WCYA 2YOHA 4G0PA 4MEBA 1RQLA 3CX7A 1FFGA 1SHKA 3QM1A 4TSRA 2WAAA 2B2XA 3C15C 3IPYA 4IZHA 5LDHA 2HD4A 5FNVB 5GIOE 1P60A 1OWLA 2G40A 2Q6VA 4NMMA 4ZRNA 2ISQA 1ABFA 3M4JA 3ABRB 1NJ2A 3ET4A 1N2BA 2XQIA 2AIRA 2F3TA 5BQPA 1OASA 4QL3A 4ZCSA 2HBYA 1YGYA 3EXG1 1K88A 2QW8A 3PXUA 3Q7SA 4BMDA 2IX3A 2W6ZA 3EIFA 4IDDA 3X44A 5IUNC 3RS8A 2RIHA 3U80A 2DRIA 1CB0A 2IU3A 1YRQA 2YWJA 1GNSA 1PTKA 3NCHA 5IDXA 4KR9A 3MILA 2ILTA 2Y4OA 1A95A 2HHCA 1KEPA 2DSTA 3TOSA 4Z3DA 4WMLA 3VI4B 3D7SA 3BZUA 3A58B 1XQXA 3LWBA 2GO1A 4I8XA 4RFLA 4XXHA 1SZDA 3KS9A 4Y0VA 3RG2A 4MS1B 4EM6A 1N5KA 1ZIOA 1J2YA 4R9VA 4ECAA 1I8TA 2I9KA 3ADDA 1PGOA 2ZTLA 3LBNA 2TECE 1OROA 5HQJA 2IS6A 5A6SB 5KHLB 1JQJC 1EJ0A 1R37A 8MHTA 5IK2D 4KMOA 3K16A 6YASA 1FUUA 1JMVA 3L05A 4LA4A 1XP5A 2WM2A 4JJGA 3BMNB 3F6PA 1KC3A 1R4NB 2DPGA 2NTVA 2BDUA 3A4MA 3GGCA 3WFIA 4B3MB 1FRQA 1UEIA 3O93A 1YFKA 1QKJA 4UHKA 5DP2A 1KDZA 3UF0A 1Z3CA 1ESCA 1XC7A 3AERA 3LUCA 4KYVA 1GPKA 2QQGA 2PG3A 1L5NA 1WD5A 1UKAA 2FUG6 5B1HA 4QPZA 2DETA 5FL3A 3LLVA 3HM2A 1NW3A 2PWYA 4X9XA 5AJZA 5HIKA 2WP0A 2BBOA 2AFHB 4KFUA 4D96A 4EEXA 3SLRA 1AOXA 5BVGB 1KERA 3EEOA 1TAHA 3OIWA 1WXIA 1HOXA 2JZNA 2QD1A 1RCTE 5IAGA 3IYLW 4MUFA 5IT4A 1F9EA 3CEAA 3C3BA 1KGDA 5LB2A 2Y71A 2H52A 3G6WA 3QSGA 3KQOA 3TLGB 5SYAA 3ROGA 2Q7OE 2UUAB 2A4MA 3KEQA 2Q0SA 1OC4A 2QAGB 3QELA 4UHHA 5DTJA 1EDBA 3F3MA 1K08A 4MVXA 2OV3A 4DE5A 1QGUA 4OYHA 3LBHA 1BRMA 4FR5A 4F2HA 1YZTA 2C2BA 2RI1A 4RZ3A 4E5YA 4NX2A 3DMTA 2ZRGA 4UDOA 4EWLA 5KTTA 2PRZA 4X84A 2NW6A 4CMAA 3H16A 2V9CA 1V7PC 4QOHA 4YUXA 2Q3JA 2I4LA 4AJ1A 5AK4A 4DA0A 4DYVA 5JJKA 1NRJB 3ZTTA 4OQZA 1IZYA 4CQNA 3IHKA 3FLMA 2M6LA 1HDIA 1PT8A 1RJ9A 4ABTA 2X3YA 1E59A 4GBGA 2MOKA 4GRIA 4QOFA 5TQJA 5K8CA 4INOA 4RLQA 3EF3A 2G4VA 4I50B 3I34X 2FZ5A 3H1AA 1RWQA 2J9YB 5COBA 1Z5OA 2R7NA 1KVTA 5DSTA 3U4QB 2BFBA 3O1HB 1ZUNA 2GVDC 4AUEA 5CDFE 2PGAA 2W48A 2ZJAA 1NQUA 2XQKA 3CONA 4UAGA 1T9ZA 4R8KA 3QSYA 5D3MA 1YRAA 5MDHA 1Q0QA 4WLFA 4OMUA 1CUHA 1LTHR 4TMWA 2PL9A 4GOLD 3WLEA 2QUIA 3CQ9A 3KKLA 3HFSA 3QVSA 4DLVA 3L7DA 2GCGA 1G2PA 2OC4A 3DLHA 4ARIA 2R79A 3KLPX 1EUDB 1W2WB 3VSEA 2AD5A 3MMXA 2H2FA 3C98A 2JI7A 2ZQZA 1DRKA 3D7RA 1OC2A 2P65A 3NO4A 4LPSA 3ZLBA 3W7AA 3RIEA 1TTPB 1TU0A 1X13A 2EWWA 1VGQA 2HSJA 5KBYA 3G0DA 1M1NA