3PC4A

Full length structure of cystathionine beta-synthase from drosophila in complex with serine
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
504
structure length
504
Chain Sequence
YERPADFIDPGKPSKCKWHLGTAEKSPHIHRGIAHRQQITPNILEVIGCTPLVKLNNIPASDGIECEMYAKCEFLNPGGSVKDRIGYRMVQDAEEQGLLKPGYTIIEPTSGNTGIGLAMACAVKGYKCIIVMPEKMSNEKVSALRTLGAKIIRTPTEAAYDSPEGLIYVAQQLQRETPNSIVLDQYRNAGNPLAHYDGTAAEILWQLDNKVDMIVVSAGTAGTISGIGRKIKEQVPSCQIVGVDPYGSILARPAELNKTDVQFYEVEGIGYDFPPTVFDDTVVDVWTKIGDSDCFPMSRRLNAEEGLLCGGSSGGAMHAALEHARKLKKGQRCVVILPDGIRNYMTKFVSDNWMEARNFKEPVNEHGHWWWSLAIAELELPAPPVILKSDATVGEAIALMKKHRVDQLPVVDQDDGSVLGVVGQETLITQIVSMNRQQSDPAIKALNKRVIRLNESEILGKLARVLEVDPSVLILGKNPAGKVELKALATKLDVTTFIAAGKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords CG1753, isoform A
publication title Structural basis for substrate activation and regulation by cystathionine beta-synthase (CBS) domains in cystathionine {beta}-synthase.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 183
structure length 504
sequence length 504
ec nomenclature ec 4.2.1.22: Cystathionine beta-synthase.
pdb deposition date 2010-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 3pc4A03
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pc4A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pc4A02
4LMAA 2CLKB 5B55A 2EFYA 5EY5B 3KH5A 4D9GA 1Y5HA 3DKIA 5IXJA 3RR2A 2ZY9A 1KFEB 3SPXA 5KZMB 3PC2A 1P5JA 1TZJA 4LMBA 2J9YB 3SS9X 4IYSA 4QYSA 3L6BA 4D8UA 1PVMA 5LXQA 4NU8X 5D85A 3LFZA 2UV4A 1K7EB 1F2DA 4ZU6X 1KFBB 4D9CA 2O2EA 5KINB 2JC3A 4I1YA 5IWCA 2CLEB 1WKVA 4HG0A 2OOXE 4L0DA 2CLOB 3L2BA 2O16A 1VB3A 1M54A 3FWRA 5K24C 2GN2A 3HF7A 1V7CA 2QR1E 4H27A 4O9KA 5DW3A 4AIRA 3CEPB 2RHGB 2ZPUA 4JBLA 1YAVA 3L6RA 2O2JA 3DWIA 4GQWA 5CVCA 3FV6A 4FXSA 2OUXA 3FHMA 1TDJA 1UINA 3AEXA 5I6DA 1WBJB 1TJPB 5E0KB 4HO1X 2Q3CA 2D4ZA 1C9DB 5D87A 4D92A 3KPDA 3IQHX 1WDWB 2BHSA 2CLFB 1RQXA 4HPJB 3KXRA 1C29B 2ECQA 3FCAA 5IIPA 3GBYA 2BHTA 2EGUA 5I7RA 4XUGB 4HPXB 5IW8A 5D84A 2YVZA 5HBGA 2TSYB 1TTQB 1K8XB 1Y7LA 4Y6GB 4D9NA 3LHHA 5CGQB 2J9ZB 3ZEIA 1JBQA 3FNAA 2C2GA 3IQIX 1O50A 3OI8A 3FGPA 3VSDA 4HN4B 5DBEX 3L31A 1OASA 2TYSB 4D9KA 1VE5A 4D9MA 5T6MA 3VC3A 2GN0A 3VBEA 2ZSJA 1J0BA 4LI3X 2UV5A 4L3VA 4OFXA 1TYZA 4D8WA 4D97A 1A5BB 5B1IA 2RIHA 2UV7A 4NEGA 2QRDE 2C2BA 3OCMA 2QREE 4D8TA 4F4FA 2CLIB 2ZR8A 3T4PA 1TTPB 4D99A 4GQVA 1C8VB 5JJCA 2WSYB 4P1OA 1J0EA 4GQYA 3PR2B 1KFKB 3OCOA 4AECA 3SS7X 1VE1A 1KFJB 4DQWA 1K7XB 1K8YB 4D9FA 2RH9B 2GN1A 5B36A 2CLLB 5MMZA 3ORGA 3T4NC 1KL7A 5B1HA 3BM5A 4IY3A 5I7AA 3KPCA 4JBNA 5DBHX 1A50B 3L6CA 1QOQB 5JISA 2EMQA 1PWEA 3K2VA 3DWGA 5DW0A 1FUYB 2TRSB 4IY0A 3K6EA 2YZQA 4D9EA 5I7WA 1X1QA 3TE5C 1J0DA 2YVXA 4P1GA 3R0XA 5C3UA 2J9XB 1TZ2A 4IY4A 5K22B 2RKBA 2D1FA 4NOCA 3VSCA 4D9IA 3HMKA 3IQGX 3LV9A 1J0CA 2V03A 5K23C 3TDHC 1K8ZB 4FRYA 5J43A 3PC4A 2UV6A 2YZIA 2NYCA 3R0ZA 2EF7A 2RC3A 2DH5A 5BW6B 1PBJA 2OOYE 1CX9B 1K3UB 2PFIA 2ECOA 4D96A 5J5VA 5DVZA 1Z7WA 4ESYB 4D9BA 5K25C 1WTCA 3PC3A 4COOA 1K7FB 1PWHA 3I8NA 1FCJA 3X44A 1KFCB 3DDJA 1V8ZA 2NYEA 3SL7A 3KPBA 3FWSA 4ZQCB 4WX2B 4IL5A 2CLHB 1A5AB 3V7NA 5D86A 1CW2B 2CLMB 1Z7YA 2YVYA 1UBSB 4PCUA 2DH6A 5I7OA 1V71A 2PQMA 2P9MA 1XKFA 4KKXB 3TBHA 3X43A 2RIFA 2Q3DA 2Q3BA 1BEUB 2QLVC 5B53A 4L28A 1A5SB 4IY2A 2ISQA 4HT3B 4UUUA 2QH1A 5KS7A 1TZMA 1E5XA 3VSAA 4L27A 4ESYA 1D6SA 1UIMA 4OREX 5I7HA 2QRCE 5B3AA 1TZKA 3IAUA 3AEYA 4ZU1X 1J0AA 3LQNA 1QOPB 1BKSB 1O58A
chains in the Genus database with same CATH superfamily
2IXTA 4OLFA 3R8XA 3U4IA 4J0KA 3P4XA 5BSFA 4YJFB 1W2GA 2PLWA 5T57A 1QGYA 4WLFA 2VDMB 1Y7IA 2MHCA 2R6CA 3IAXA 3GCDA 3EXG2 4Z9XA 3U6BA 2AN9A 1TYDE 3AKEA 3BWYA 1ZZGA 4OJYA 3W5UA 3ECAA 2Y4OA 3I5YA 2CK3D 2I2BA 4WNYA 3RVDA 3VOBA 3WLOA 3N6RA 2J4CA 1CY0A 2YZGA 3D6FA 3JZFA 3KB2A 3RKSA 2PZLA 4CMJA 4ETMA 1R8XA 4JJEA 3ROQA 4URYR 4Y0AA 2JLQA 5MGBA 5HRUA 4BNJA 1B43A 1CUIA 2VQDA 2GT1A 2XEXA 3ENVA 3L49A 4YRCA 4CMBA 1D1TA 4M9RA 2GBPA 3T9CA 4EHAA 3G3EA 4TQGA 1AKYA 4X41A 1SXQA 2JEYA 1RNLA 3QUQA 1N6RA 4UARA 3FTEA 1V26A 1BE8A 4B0PA 3ABRB 2HMUA 4WCDA 1S7CA 1FP1D 4TSRA 3TZ6A 4DRXA 4HHEA 5CCBA 2JHCA 4ARBA 3RVRA 5EUBA 3BEOA 3O84A 4OGWA 2QTWB 5E8RA 1LEHA 3AOEC 1KQOA 3VKGA 2C9YA 3KUDA 4EG4A 4Q4AA 2V74B 1JFSA 3J7TA 4MV3A 2UXDB 2ZRFA 5CG1A 2GJKA 5CFMA 1GG5A 5IK2D 5L40A 2WUDA 1FMJA 1T43A 2DJ5A 4AMYA 3AKYA 4W63A 5E3IA 1HDXA 4LCBA 1GNRA 2Z58A 2ZB7A 2O0JA 3IUMA 1Y5LA 4LOHA 1JKIA 1J2TA 1I5RA 1AQNA 1IBSA 1QV9A 5JU6A 4PSVA 3STXA 2E5LB 1NUUA 2BUBA 1PLKA 3PGKA 3PRKE 1NIPA 1BYUA 2PR7A 2OXFA 4QLAA 4RELA 5F21A 1JLSA 1PS8A 1RQGA 3K6KA 3QEOA 4F8JA 5LQAA 1PJCA 2CCJA 3WWCA 3CLUC 4UTRA 5LQUA 4BNUA 3PLRA 3HWSA 4RZSA 2FF5A 3ETDA 2I7VA 3M1LA 3T52A 4R2WA 3QX7A 5JALA 3BK1A 3QEJA 1XTBA 2J3JA 3EXEA 1O94A 3DBHA 2NN3C 4PYLA 1YAVA 3REQB 5F7ZA 1M2KA 3TNJA 3A28A 3GDFA 3JQGA 3BGWA 1QIEA 1SCAA 1TB4A 1YB1A 3KB8A 3LZ6A 5EKUA 2JZNA 3RW9A 4JB0A 5HJ2A 4FFBA 4L08A 4XD7D 3FH0A 4EMSA 3PHBE 1CR4A 4F0JA 5FLKA 5DMHA 4NV3A 1XDUA 2D8MA 1R5OA 3LZCA 1AMNA 1YRLA 4TYWA 3EGIA 1KVTA 3T0GA 3FHMA 5JAMA 4RTOA 1I7QB 4DGQA 2JH3A 2BMAA 5I45A 3ZCSA 2BH2A 1OTHA 1M6WA 1UDCA 3FPJA 3KHTA 3DVAB 1AJEA 1UINA 3WL8A 4OM8A 3B6KA 4LJ8A 3SNKA 2R86A 4EO4A 5F5NA 3SHTA 1I5OA 2ZK7A 3B1WA 1C7QA 3C3JA 2Q9AA 3NT5A 4I1OA 5JSQA 1S01A 3RJMA 3PNOA 4MP3A 3AYZB 4NPAA 1CUVA 1Q6YA 1W5TA 1DKPA 1NJSA 2Q0HA 3N8GA 1ODIA 4OQZA 4IHAA 5E7QA 5ADHA 1QCCA 3DVRX 2FW9A 3IV9A 4K9NA 4CU5A 1ZXLA 3SJAA 3EXIA 4IGAA 5K3AA 4CEIB 1O6BA 3ANLA 2C2KA 2DP4E 4QDZA 1YVDA 4RA6A 3M6LA 4OHCA 4PX9A 4RHFA 2VH2A 3MGBA 3ZK8A 3DF9A 3KXPA 1UPTA 3H13A 1OHHA 3UGKA 4DR2B 1RFGE 2E1PA 2UUOA 1C29B 3KM0A 2G1PA 3AY3A 10MHA 4FJ0A 3AR4A 1W30A 2I4TA 2Q07A 2VCHA 4XD7A 1JQAA 3ZY4A 5KJFA 5IIPA 1XRQA 3M81A 4G0MA 5FTMA 4MUFA 3KK0A 3FZEA 3ZU6A 5FAXA 1RFLA 1TL7C 5ITWA 3DPUA 3EUEA 5L9AA 4ZQGA 1KVQA 2CNWA 1XN4A 1M1UA 1OZAA 1CDZA 1MEEA 1J2EA 3HY4A 2W6ID 5TS3A 4PRKA 4FQ8A 3IJEB 4EIWA 3QP9A 4QASA 5AO9A 3RNOA 3TBKA 2ZU6A 5HVNA 3EMBA 1DC5A 2C8LA 3H5TA 4QQRA 2XSZA 3CUWA 3HKBA 5C0OE 2G71A 5CA0B 1T4CA 3MMXA 3BPSA 3NS7A 4N49A 4A91A 2QXYA 4AO8A 4I7EA 1DB3A 2GBIA 5JDIC 1BEZA 4QE3A 1KSJA 1R3DA 1QH8B 1F0KA 1ZGAA 3I2KA 3NM5A 4TYMA 4PPNA 1SIWA 3G6WA 4RBNA 4C4PA 3CF0A 4JI3B 4DDTA 1QAOA 1W47A 2EJVA 1HNWB 2G0NA 5BT9A 1RI1A 4Q1CA 3GD5A 1AO0A 3PPWA 4GKVA 4IMIB 3FOEC 4WMLA 1B3RA 4TV8B 1BNCA 3CX6A 1XZ8A 3DULA 4NMLA 4Y1RA 4CL3A 2ZOSA 5KHOC 2NACA 4A8JB 1NKVA 4GR9A 1T5IA 2OK7A 4M0DA 4PQRA 4WK0B 4QM6A 3R20A 3VC7A 2XVAA 1UANA 2DR2A 1U0EA 4WA7A 3IPYA 1KI6A 3GK3A 2ZWIA 3Q88A 3DD5A 1P5FA 1UT8A 4RUKA 4CLRB 3PEFA 2MSKA 2TYSB 4F3NA 4GYWA 1D8AA 2OZVA 1O4WA 1L5QA 2FQWA 2QUKA 3R9KA 1R6XA 4NV1A 5HE9A 5DTEA 4XTCS 1XMQB 2GSWA 2YCBA 4HVTA 4JX8A 4JQOA 2ZI5A 2DHDA 3VC3A 5IHXA 2IS2A 2HPVA 2QTVA 4IS2A 2GN0A 1ZCBA 2L69A 3LPDA 1MX9A 1HDGO 1KNXA 4BGEA 4YQZA 1BVHA 1PVDA 5FNZA 4HNUA 5MN5A 1MP0A 4OFXA 2PMDA 1P7YA 3A31A 2B9EA 3FW1A 2M6LA 4QXRA 4O33A 1AA6A 4B84A 3I9OA 1JA9A 2HRDA 2OZLB 1AO3A 4Z4CA 2WUFA 5IBRA 4TLDA 1VYUA 1J6UA 1M2JA 4MJ7A 1NG1A 5LQSA 3J81k 4JJ7A 3V6MA 4D45A 4DCPA 4AKHA 4EY3A 3PKIA 4YRBA 1CULC 5KNBH 3GBPA 5HKKA 1N2CA 2O8EB 1PRYA 1TM3E 3MZ0A 9ABPA 2CGEA 3K32A 3NX4A 3UOGA 3JVEA 2CFOA 3K16A 1VI6A 4CMAA 2GWRA 3S8MA 5LOVB 5JRDS 1ONNA 3V7UA 3ZCQA 1FDUA 2GMWA 3B5EA 2CYAA 3BK7A 1IFXA 1RTKA 2ZUFA 4M21A 1BVRA 1J99A 1BA2A 2B2XA 2P9GA 3AB8A 4RWZA 3DE1X 3Q98A 4MROA 2EKZA 5LA6F 3SYLA 2GOYA 2GKOA 3S5JA 1G20B 4KXWA 2Q5JA 1UC5B 4XUEA 5IKOA 4L5CA 1MT3A 3VVLA 3TB6A 5HFNA 4EPVA 2PMBA 3SXJA 5K8UA 2OP1A 4H0FA 3ZDBA 2PJDA 3PFCA 3S44A 4F04A 1NV9A 3VU3A 3DAPA 3GLRA 2OECA 1E60A 1DAKA 3X1DA 3S28A 3DL4A 1KJIA 3A26A 4YJHB 2A9JA 2AZXA 2PAFA 1VRVA 1X8XA 1TVKB 2J6HA 1Q3TA 2B83A 2V9PA 3CF4A 1VSUA 2RC5A 1V3VA 1VCHA 2X2PA 2BFEA 3R24A 4LK2A 3T5GA 4F6LA 3BRCA 2PS3A 1DJNA 2R66A 5FL3A 3H1GA 4US1R 5CVTA 3N6VA 4BATA 4J1SA 3KLPX 2PRSA 3GT7A 2NPIA 4YAJA 3DEFA 4HB2A 3UA4A 5IJZA 4Q4CA 2ZAGA 2E1RA 1T4BA 2VKTA 1PFUA 4TKZA 3LYAA 1ARZA 1SD1A 3GZJA 5ECWA 1H1LA 4COKA 4GHWA 1D9ZA 3EVTA 3FJYA 4RYDA 4CM4B 4EJSB 1RIFA 1Z25A 3RAFC 1KJJA 3MWEB 4UUAA 3N0WA 1EYZA 1ZH8A 5FRDA 2D06A 3E22B 3K2VA 1S02A 4L8WB 5ALKA 1KMQA 4NULA 4Y0VA 5CIQA 3Q0IA 5ILOA 1H66A 2F1KA 1A4IA 2XADA 3DM9B 3DQPA 3LPAA 4G25A 4RF5A 4XAQA 4LG1A 2QTLA 4AQDA 4U7GA 2G1JA 4DQXA 3IR7A 1O57A 2AF4C 3B7GA 4ENWA 3OZTA 1PFQA 1V5EA 2LCQA 3ZDXB 2RGAA 1U4NA 2O3JA 4I66A 2QTZA 2ZRCA 3ASUA 3BE5A 2I4IA 4DG9A 4RD2A 5C7IO 1P4HA 4NE7A 3K0SA 1OI7A 2AK2A 2DKFA 1YD7A 2YTZA 1A9XA 3SIRA 4MYDA 1PWXA 3AJRA 3PICA 3D6VA 2VBCA 1X19A 4EDHA 1S9DA 2J45A 1CBUA 4GPZA 4P7GA 1VMIA 3KQOA 3JU3A 2ECKA 4FX2A 1M76A 1Y1RA 2GJAA 1KZ4A 1WL8A 2OLEA 2QTMA 4U2BA 4ZJUA 4OLBA 5AW8A 1CEYA 1KZ6A 4PHTA 2D4AA 3KJFA 4LV6A 5LFAA 2SECE 3EG9B 4KHPB 3U1VA 4HWGA 2BFCA 4DLNA 4UNQA 2VTDA 2RKBA 2D1FA 3B7WA 3I83A 2OAQ1 3EJ6A 3VSCA 2GN8A 1S6YA 4Z0PA 5LQKA 1JE1A 2Z4RA 3B5JA 4D9IA 2YXBA 1PT8A 1ZRMA 4EB3A 1ZMRA 5AVXA 5JEDA 1BCSB 1U0OC 3TW8B 1GCUA 3G2MA 2JFFA 3OEWA 4GMXA 3TQFA 5AKLA 4Y2JA 4RD3A 3SZRA 5KVQA 1VSVA 3AJEA 1PZGA 2XYHA 3DE4X 4B85A 3NBZC 4Z3OA 1L5WA 1F8GA 4E32A 1T1RA 3VA7A 2W2KB 4MJLA 1VQ1A 4BP3A 4ENPA 1VG8A 2J08A 5JASA 1YDMA 1DCTA 3TAXA 3LQQA 3PNVA 1QK3A 2PT9A 1FUEA 1RKBA 2TMGA 2I22A 3B9BA 4ZWNA 1HLDA 4MP8A 4Y1GA 1D2RA 1QHNA 3YASA 1XZJA 1FVXA 1KEZA 1V6AA 4BU1A 1XV5A 3UJDA 5KAPA 2HJSA 1DXHA 1E2HA 4N82A 3HYSA 4AF7A 5C1DA 3ZUPA 1EI9A 3H11A 3TS1A 2B3DA 3Q3HA 3VNRA 3EZ6A 3NCTA 4B6QA 2HR1A 1K66A 4QOSA 3ZGLA 1TU3A 2WU3A 4OSPA 3P20A 4MV4A 4D3SA 4IIHA 3IT2A 4EEXA 2PFIA 1AX9A 1OXUA 3OM8A 4JT4A 3NJ8A 1OT3A 1GUDA 5SYMA 3W5SA 4GBGA 3W6PA 4UTNA 2FY8A 2O8VA 3NXKA 3RD5A 4BRZA 1ZONA 2A92A 4MKIA 1GJRA 1VGQA 4JLVA 1XNQB 5DNDA 1N1DA 4KQ2A 1XGKA 4LVCA 2FMTA 4D02A 3INYA 4UTXA 5DM1A 3TLCA 1CR6A 2P8JA 4CLDA 1QQAA 2ZRDA 3DBRB 4C0WA 4QOGA 5LR6A 4MPJA 3AHEA 2WSBA 2XNSA 3KJIA 3KZKA 3LNTA 4BLTA 1ID1A 3OFNA 1ZISA 2GAIA 4F4DA 3TLZA 1F8YA 1GR1A 5DNUA 1RP1A 4ZYVA 4H60A 5DTRA 1NQWA 4X93A 1XO1A 3OOEA 3OCVA 2VP2A 1MQ9A 2PCJA 2YWFA 4EFDA 2O0MA 3GFQA 4XW2A 1J8FA 2JFNA 3TIGA 3QBJA 3GLGB 4NPCA 4DA8A 3GDHA 3UKDA 1LSSA 1Z06A 2GFHA 3A58B 4P3NA 1V96A 1CE8B 1YR2A 1QZ3A 1WY5A 3DW3X 5D86A 1NN0A 5MFZA 3F97A 2VEDA 4IH9A 4R1PA 3K4HA 1DQYA 4Z99A 3ZWXA 4O1IA 3CNNA 1FYWA 1VL6A 1QNLA 1WDKA 4YEDA 1ZVVA 5K5EA 2LBPA 4RO0A 3TKYA 1AKMA 2PR2A 4IDOA 4BV9A 1B16A 5BR8B 1HDRA 1Z26A 2WWTA 4CV3A 2FN7A 4AKTA 2DLDA 1RQ2A 2PKQP 1V7ZA 2B98A 3KE8A 4QHTA 2QI9C 4MO2A 3DCIA 2EZ8A 4DYVA 4ZAZA 4H6WA 5KVAA 2O8BA 3W6ZA 3OP4A 4C22A 2BSQA 3ZIDA 2H9YA 1CY7A 3T6KA 4GX1A 1U3TA 4GG1A 3ZV5A 3GDOA 4GGOA 4N5HX 4RV9A 4WKGA 4WXYB 5D51S 4ARUA 2FW6A 3ZWQA 5JZBA 1XFDA 4OAPA 3K0FB 4R6WA 3PQ7A 2I66A 3EF1A 3O4IA 3U2QA 4DLXA 5AW3A 2ZVJA 2X8WA 3CJTA 3RABA 2GRAA 3AFIA 4ZI7A 3I8SA 2WWYA 3BFPA 2YFYA 4Q48A 421PA 1CR0A 4RESA 2ONJA 3Q85A 3BFXA 5D7BA 4RQTA 3JVIA 3D7NA 2O0KA 3GCZA 4DLUA 5EWLB 3EQZA 2PX2A 2ZB8A 1UIMA 4LDNA 1G3RA 3H5WA 2QRCE 1K86A 3GLHB 3JPYA 4KGDA 2ONYA 3IDSA 2J3HA 3L4EA 4KAXA 3T7EA 1FLAA 1L7RA 1Z38A 4LDPA 2IXAA 1S96A 3ZGXA 5B6IA 4BN5A 3ZIAA 2IIVA 4WFIA 4GR4A 2NSLA 1BTOA 2PXAA 3AC0A 1F2UB 1KMNA 4CM7A 5JBIA 2DLCX 4H7IA 4MMXB 3K70B 4P2GA 2JHAA 4ZK6A 4HYEA 1YL7A 4X62B 3KS9A 2H5EA 3I52A 1QOPB 3EDQA 5HIIA 4GOLD 4EG5A 3HSKA 1X42A 1BN7A 1ODTC 2JGRA 5CDSA 1FRNA 1LSUA 4OB8A 4RIGA 3JQAB 4BFXA 3I8OA 4OQPA 4P81A 2FN4A 5GAJA 2GXAA 2BGIA 2XJ4A 2AXNA 5ELMA 2JLCA 1Y1KE 2E0IA 2VSXA 3R9XA 2PNFA 4HSEA 1EX7A 4L5AA 4M0FA 1RM4A 1Z3CA 3TTWA 1YT5A 1EGMB 2J7PD 4IYSA 2J3KA 3HBFA 4WOCA 2FK8A 5K6RA 1P7VA 5AJWA 1RI2A 3J7AC 2GD2A 1KORA 3DZKA 5EUMA 4KRFA 1Z5NA 3MILA 3PEEA 2VSNA 2UYQA 4NU8X 3PT5A 3PNSA 1I80A 3VU0A 1CUFA 5CDYA 2B3TA 1DJLA 2FR0A 1L8QA 3HLKA 5JXJA 1YS9A 1WG8A 1XLUA 3EC1A 4DF3A 1OW3B 2P9YA 2UZ0A 1O87A 1J2RA 2OHXA 2ATEA 3INNA 4GLLA 1SNYA 2C4WA 3WDKA 4I2VA 1E18A 1NYQA 1X0XA 1YK1A 4B4KA 4ESVA 1POWA 5CNJA 5EXTA 4S1NA 1SUAA 3RANA 2X9QA 1ODLA 5AK5A 1SVWA 1FNDA 2HV8A 3FYUB 4RVGA 2YBEA 3V4PB 4FZ3A 1YUNA 4C6HA 5EG5A 2F1OA 4YQEA 2W6IA 1DQPA 1TO2E 2QAGC 4RCYA 3UB4A 3V8VA 4AG5A 4UNPA 3ZW9A 4BZPA 5LYJF 1H2YA 2NXNA 1D8TA 1H22A 2IBSA 2AGVA 4BGIA 5CEJA 3FWRA 4KITB 4XR4A 5M29A 1ZI8A 2PN1A 5LZ7A 4R3NA 3CCFA 4KN5A 2G07A 1SIBE 3NWPA 3NIGB 4C14A 2VT3A 5F1PA 2DRIA 2A78A 5JNLA 3C8UA 2BL4A 4ZGWA 4YQYA 1SBTA 2WIFA 3K9WA 1YOVB 4PPGA 3LQ1A 4OAOA 1K6JA 3MMZA 3NDRA 3PKJA 4GP9A 4RZQA 3TE7A 2RGRA 2ZRLA 1KBQA 3DKPA 3U3ZA 2WMNB 4J94A 1IJEA 5E9QA 4ZAGA 1NR1A 3MMSA 4CF5A 1GCGA 1L7DA 2A9RA 3RBAA 1FB5A 2NZYA 4XGNA 2C2MA 1YZFA 2V1XA 2H1CA 1MEJA 3BTOA 3IQWA 4D0GA 4Y8VA 1FTGA 1MAWA 2O14A 3NVAA 5IYZF 2A59A 1NAIA 1T0HB 4HDRB 2H85A 4UZFA 4IR7A 2W98A 4MICA 5FFFA 2C57A 3TZHA 5GONB 4GRDA 5DNVA 1L7OA 1N5MA 4RIIA 5CVCA 1AM4D 3Q10A 1LDYA 1PL7A 3GAMA 4P4LA 3V2GA 2OO5A 3LTEA 2PKYX 1H0HA 1SBZA 3KQVA 1QIFA 4L50A 1Z16A 2VSYA 4U9IS 5G1OA 5E9WA 1FC0A 1JFRA 2OM6A 6REQA 1WX1A 1CVLA 1J2UA 1PDOA 2VP5A 4LYHA 4QQKA 4CL2A 1SZDA 2AB0A 2CE2X 1U0FA 3QWIA 2ODNA 4Z9FA 3V4OA 4LJSA 1IXZA 1AQIA 2QPOA 2RG1A 2JJ8A 1CERA 1WBJB 3UAYA 5M2QA 2G9NA 4QECA 1N5JA 2K87A 4QWWA 4X0EA 3WO0A 1VB5A 1A8QA 1IC6A 3UAGA 3HFSA 1T0BA 4YJ3F 3MNFA 1WQ1R 3SR0A 1EP2B 5AW2A 5JBQA 3CR3C 2BI7A 4QSHA 4OU5A 1DX9A 1GA4A 1NIJA 4UQOA 2O3UA 5KCZA 2GPNA 1NX9A 2HN9A 3BCHA 1CIJA 4BNMA 5T3UA 1CD5A 3TG8A 2SBTA 3PE4A 2RGCA 4MRPA 5CNMA 2HQSA 3HPQA 4DSUA 3KR9A 2YASA 4G81A 2CBGA 3OBIA 5AMXA 1KIMA 3RAEC 5JQGF 1HQDA 2GI4A 3UWMA 2AKYA 1DT5A 4DCVA 2HF7A 5HILA 3GBYA 1J9GA 1E1CB 1QG0A 1H6CA 4B3IA 1WV1A 2YC4C 2YYSA 4TTQA 2H2IA 2SCUB 4CBVA 4ZFNA 1MKYA 4XUGB 2WD9A 2P9CA 1OXXK 3IULA 2ADMA 2C4NA 4LJ9A 2HAEA 3I9LA 4B76A 1LF5A 1HGXA 4LE1A 3WAGA 4F4UA 3FROA 4HAYA 4J16A 4DB4A 1OX5A 3SQOA 3F2IA 1JN0A 2FSHA 2NVUB 4BV3A 3WYNA 1RC1A 1CZLA 3CZ9A 4MQMA 1NXPA 1JL3A 3CPSA 4EJ0A 3DBLB 5KQGA 3QU4A 2BFFB 5CGQB 4EL0A 3E7XA 2PU7A 3LHDA 3T9EA 1U8EA 1M2VA 1QYRA 4U7PB 4YLGA 2OG1A 1RYMA 2PMCA 3N70A 4O4HF 3THOA 4Q1VA 3E18A 4ERXA 3GJ4A 4NEHB 4PIPA 5H02A 3RAGA 1TA9A 2I0FA 4ZT6A 2IYAA 5BNTA 1IM8A 4R40A 2JGKA 4EPRA 1W96A 3OETA 4LRYA 1FFGA 3FGPA 3HPRA 3W79A 1U0SY 5E2AA 4HGQA 1XCJA 1YKGA 1YQWA 1CY8A 4BCCA 2A4KA 1J20A 2DFNA 1ULBA 1E6MA 1EJ2A 4PNEA 1RJ9B 3I30X 2DLNA 3FYDA 1Z0SA 1IBLB 1WXEA 3DWFA 5EWMA 3WLQA 4DRYA 3V55A 5EE0A 3EX7C 2EQBA 4RPIA 2E4XA 4G0OA 4LQCA 5BQXA 1E92A 1F0PA 2BFMA 1OLXB 4I4TF 4JU8A 4UAUA 2O9JA 4KX3A 4BV8A 2Z2XA 4LMRA 4UU1A 4X1YA 2J67A 3OPQA 4I14A 5BPFA 2XB6A 3A0UA 3HKCB 1AUOA 4DLBA 5I4BA 1IUOA 1T9GR 2PL3A 1N9KA 3OTIA 1SBCA 1FPQA 2DBQA 5BN5B 3TLEA 3VZPA 2JLSA 1QO7A 1ZNQO 1G8KA 3MWKA 3BE8A 5ALRA 1V8OA 1AHIA 1OC2A 1A9PA 2DFDA 4C76A 2GCNA 4DLVA 1HDEA 2JKVA 2WWFA 1E9VA 3OQIB 4JNCA 4GNKA 3HU1A 4XWOA 3B9PA 3GZNA 3UKJA 3WK8A 4AXXA 2VTBA 3OE1A 2QE6A 1YRAA 3Q12A 4J91A 4NVRA 3U7JA 2C4VA 3DL0A 3IMGA 5REQB 4MR8B 3TPZA 4F4CA 1FYVA 3PNMA 3GR6A 4P4GA 1DAGA 1O2DA 2GJSA 4QU0A 4DNXA 3N8IA 3NEPX 3PPVA 5LQMA 3TG2A 3KQHA 2OT3B 3JQBA 1OWOA 2HSJA 2XMQA 5F1OA 4N5LA 3DH0A 3E48A 3HC7A 3PTLA 1V41E 3I6YA 4OHOA 1DWUA 1SRQA 1T4MA 2I2DA 3SU8A 2PUGA 3V4LA 4HNRA 1AS2A 2RKWA 3L40A 4X8OA 1ANKA 5DV9A 3R0VA 3Q3VA 2JIBA 3EIHA 1GGHA 2R11A 4KE6A 5T64A 3ON5A 5JJCA 1V3QE 1W85A 1U1IA 2RKOA 1EFLA 5F1KA 1HLPA 1JQBA 4U2DA 3EDRA 4H7KA 1O95D 2QMZA 3HO1A 2DPXA 2IKQA 1HG1A 2YN2A 5CLFA 2WT9A 3PR2B 4E4RA 4M83A 2OCAA 2C3PA 1JA1A 1N32B 2V3WA 1GPLA 4GX0A 4YH1A 3W05A 3O5AA 2QU8A 3PFHA 1T36A 3DB2A 4K40A 3I0MA 1M2WA 1WUYA 5KNCH 2WFAA 1JEDA 4P8RA 1HRDA 4FS3A 4Q18A 3R7SA 3LX8A 3OX3A 1CZNA 2PYIA 1NQOA 1G21B 2XX3A 2GN1A 1TLLA 3OF5A 3PQ5A 4MV0A 4OHXA 3QVGA 4IV5A 4DFDA 3KEQA 3U13A 2E2WA 3CE9A 1OAKA 4C3UA 2ISSD 1PEAA 3AXSA 3GROA 3ZHYA 5FTKA 5K7SA 4QZVA 4IY3A 1KEVA 2RGGA 4KLZA 3EVAA 3FWYA 4WZ6A 4ZC1A 3ROZA 4B5KA 4EI2A 4XPIA 4ZHSA 4UUPA 1QHXA 2ZYUX 4ZMRA 2XGJA 3H9JA 4C0QC 5LNK6 4EKGA 1W29A 3CH4B 4INOA 4Y9RA 4BQSA 3CVJA 4WZAA 1Z45A 2X22A 1LLUA 3IVGA 4GQAA 5JISA 1VCMA 2EQ5A 2RHMA 2A94A 2JHPA 3KYBA 4YRDA 4G65A 1A97A 1JR6A 5EKDA 3VSBA 1P1KA 1L7MA 1Z5OA 1UDRA 3DTTA 5KOHB 4QXMA 4DSZA 4X7RA 3F6PA 5GINE 2XVMA 3B3QA 1DLJA 1AUQA 1RBMA 5CX4A 5HDQA 2AJTA 3G82C 2XOKA 4IKEA 4R1UA 4ZVLA 3MS7A 3LUFA 4I8IA 2A6PA 2FSUA 1XDDA 2JGAA 2C4MA 3C2QA 3ONEA 4M9XA 4DBVO 4YR7A 4NESA 5KO2A 3QF4A 4RKWA 3TTXA 3IAM1 5DX1A 3ZVLA 1N1EA 5JJBA 3WK9A 4NI5A 3EMDA 2GTPA 4RA9B 3BD6A 3TRKA 3PEUA 4PC1A 3QA9A 2BDUA 3CF2A 3UT5A 3ZKAA 2HMWA 2WWRA 4FYKA 4KQ6A 2NVWA 3WGOA 4GUAA 2WD7A 4QDUA 2QN2A 3EA4A 3D7MA 4LY9A 5J59A 4D41A 7YASA 1RQRA 1TGYA 1E1DA 3OQMA 1YFLA 1SO8A 1RBYA 2FMKA 2V7UA 2P9JA 4RIHA 5FLXA 3ND9A 4FBMA 4ZVSA 3AHHA 4REQA 7GPBA 1L3BA 4BMXA 3FLAA 1XEXB 3HVJA 1NLFA 3DYBA 1X7XB 2OBFA 3U56A 1I2CA 2HZ7A 1ND5A 2G7ZA 4DUYB 4C21A 1GGVA 2QDKA 3WLRA 1D1SA 5I7SA 2PZJA 4UULA 2FPGA 2FVYA 1TMKA 5HP4A 3TL6A 1DTWB 2UZIR 3SG0A 4OVKA 5IWCA 2ZYIA 1MVNA 5FR1A 4B8WA 5JVDF 2OP0A 3GHYA 4N5IX 3EOZA 2O1XA 3K2QA 4MQFA 5FBZA 2I34A 2EKLA 4O4LA 4UJ5A 4WGGA 5TQ0A 1IBMB 1ZGBA 5HZMA 1EE9A 1G60A 3WKAA 1D3AA 4ZTBA 3ZH9B 4B3DA 5ITZA 3E9ZA 3WHIA 3OICA 4WUVA 7REQB 3M3DA 4KSCA 4WL0A 4TLAA 4FR5A 2YH2A 2RI6A 4LJ7A 4XIJA 3UQZA 4K6CA 4MQ6A 3RFTA 3ZJ5A 5DHPA 5A62A 5HSGA 3SE0A 5F23A 1SHUX 3R7NA 3AU9A 1CHDA 4OMUA 2VL7A 1L1FA 5JBNA 4ARIA 2FPIB 4V2UA 5AJVB 4F86A 1AB5A 1CX9B 4E2XA 4QL3A 1VL1A 1YBMA 4BZXA 4DS3A 1O0CA 1DJQA 1NFQA 1YL5A 3I04M 4MWEA 3H1TA 2VP0A 1F6BA 3PGLA 4JLMA 3PL5A 1FRFS 3MWYW 2WICA 2VHVA 3VC2A 4O2BA 1YJXA 4UDYX 2VH5R 3Q3EA 1BC5A 1XTVA 1EM6A 1NJFA 4NG4A 3A4MA 1ISIA 2H1LA 4KH0A 2BGNA 2GD0A 3MJVA 5C5CA 1X8LA 3G2HA 4WZZA 4RFLA 3NTRA 1IONA 3NOQA 2F3PA 3PGJA 4DWOA 4W6ZA 1E7YA 3LBAA 1NJ1A 1QF9A 3IYLW 3KE9A 2HJWA 3OJ0A 5AJUA 1FFDA 2VQ6A 2F55A 4Q7EA 4DM4A 1V1RB 2P65A 3KV1A 3Q6IA 1PT5A 2IPOA 5I8ZA 4EPXA 1ECPA 2BEWA 1GTJ1 3I0ZA 1TPYA 3NM4A 3NORA 1DJMA 2I62A 4BNLA 2J7PA 1QAMA 3ED1A 2X0IA 2J1LA 5FNVB 4K9LA 3USES 1MD9A 2O1EA 2UYGA 4NIMA 5FWAA 3H9CA 3QVLA 4ROTA 2R7NA 3OD5A 3R7LA 1RMYA 3L0YA 4AROA 1FSGA 1WB6A 1NY5A 3PRHA 4ALMA 3MELA 1NU8A 4TTPA 2AJBA 4JDUA 2C0PA 3G0BA 3N8KA 3WL7A 1KY2A 4RCVA 4ACBA 2IS6A 5KNDA 1L6RA 3VPGA 3CNLA 2ZRBA 3TCKA 1B8VA 2Z57A 1NW7A 4LZJA 1XKFA 4G36A 4PLWA 5D7NA 2P9HA 3N5KA 4JKIA 3ETLA 4UHFA 1PDVA 2VQSA 3RVBA 2QP9X 4E94A 3AUYA 2GEJA 3BZWA 2G17A 2CXSA 4CJXA 5H59A 3DO8A 3FPFA 2VYVD 3QRWA 4MJXA 1MA0A 5K6AA 5KTMA 1WF6A 2Y93A 2R47A 2VSOA 3LFUA 3UNXA 2YWGA 4MQLA 2P79A 4S1OA 5DYGA 3SFZA 2JEZA 4UHJA 2FX3A 1CF9A 1OA1A 1QRAA 3CN7A 3T5MA 3B36A 3HACA 3U4MA 2XIQA 4YP5A 4OI4A 1V6SA 1XZMA 3ZVNA 4PZYA 4KGVA 4ND4A 4CUKA 1YQ9A 7ADHA 3FPCA 1XZKA 3G2JA 1JDSA 2CHFA 2J3LA 4CKXA 1QPGA 3WIUA 2CZQA 4UAGA 1O03A 3ZHCA 1NV8A 2VRBA 3RIXA 3UMYA 3C3CA 1FP7A 1H93A 3DUFB 4Q7KA 2BKUA 4MLDA 4PXSA 3GUUA 1GZSA 3IXMA 2Q28A 4MYUA 2NYRA 4PN3A 3E1KA 2IT1A 1S2IA 1B74A 3GQBA 1TT5A 1U02A 2IDJA 3ZY6A 4ZXFA 2JANA 2HWWA 5AUOB 1Y98A 1JI3A 4QU9A 4NH0A 2GPBA 2MSDB 3QJGA 5KTSA 1F3OA 3DE2X 1SCNE 2NXCA 3EK2A 4QYXA 4CCYB 2O8DB 4K87A 5EL0A 5D6OA 1WWKA 3G9XA 5IKXA 4N65A 4NMMA 3HCNA 3U9LA 2E5FA 2ACKA 4QBTA 3EFOB 5B1DA 4MI1A 1C30A 2IWRA 2Q4RA 2BM0A 2ZUEA 3AW9A 1R8QA 3CVOA 2VZLA 3ESAA 3H6HA 1GVHA 1U1EA 3K0AB 1E1MA 2Q6TA 2YFKA 4DMMA 5EY5B 5SY4A 1JFVA 2DF8A 3HABA 2P2ZA 2X40A 2HCFA 1LRLA 2R7AA 3U4HA 1T6YA 5B1EA 2KE5A 3O26A 3AYXB 1OPXA 5CA1A 5I9NA 3E3NA 5BN4B 3OZDA 2EJUA 4FHZA 5LU9A 3MJ4A 3L5OA 3T5CA 1ZCZA 4WXHA 5TT1A 4NBLA 1GG2A 4LVOA 4QGBA 2TMKA 4L6AA 4L5BA 5AK6A 4KLNA 3HUUA 1GXSA 5GJBA 2IYOA 4Q3AA 3QSGA 3EEFA 1U80A 1K3FA 1FX1A 2QTGA 4LF7B 2OLKA 1IHOA 1ZP6A 4X44A 2B8TA 4ER3A 1YZYA 5H80A 3KAQA 2HA2A 4M9CA 5I9MA 1BJKA 3WZMA 5EMHA 1PVOA 1F2DA 1UPCA 2GQ0A 3EGXA 1OR8A 4PPQA 1G8YA 3B60A 3NEJA 3I9KA 1JIUA 1F8UA 4PYKA 1QC5A 2YXNA 4UPDA 1W5EA 4TYYA 4MRVA 2NUPA 2HL6A 3PUJA 3ZBQA 3ZW7A 4KFRA 1Z2AA 2N42A 2EU8A 2UVPB 4P33A 1BJRE 5JD3A 2A7QA 5DB4A 4M22A 2PUEA 1AXRA 1KQPA 3F4LA 3KZVA 3MQ2A 2OOXE 1X6VA 3A6EA 5ERGB 3UHFA 3ZNOA 4GF5A 2WWWA 3EVFA 1MV5A 5EQJB 3GZ4A 2ZIXA 3OMXA 1LJLA 3BDAA 2RAPA 4NYIQ 3O94A 4CIDA 4YMSA 5HNKA 2FFBA 5FWYA 1ZH4A 1PT9A 1XTIA 2CY0A 2CYBA 2RI1A 2VFAA 4OGFA 3HB7A 3K3PA 2TMYA 4TWIA 1WB9A 2EW2A 3OPYA 2G08A 2GN2A 4FNOA 1Z07A 5FLEX 4DDKA 2IOFA 5GVSA 3A25A 1G0NA 3PJRA 1CEXA 1UBKS 3VOAA 4NZ9A 1FDOA 1I7LA 3FM9A 4RLSA 1E89A 1GA6A 4WN9A 2WY2D 3PGMA 3EVDA 3LC2O 2D3TA 3JRNA 1HSZA 2FE1A 3C70A 2F2TA 1XKXA 4AMUA 2A5LA 2RAUA 1O97D 1DOHA 3R6LA 5GZ3A 1QHHB 1SXJD 2FQYA 3ZHZA 2UZ4A 2J9LA 4MPRA 1Y63A 4MW5A 4YUXA 1MG0A 1L3CA 3DVLA 2HA4A 5EIWA 3BWVA 4Z4QA 5J63A 2VP9A 4A3SA 3UXHA 2OVFA 3CW8X 4Q4HA 3CLSC 3VC1A 4D9HA 4K86A 4DCMA 2QDXA 2ID4A 5K0CA 2XKBA 5E7IA 5FX2A 2GF0A 3LCJA 5COQA 1M0WA 2O3TA 5A4JA 5JZOA 2PMWB 2OO3A 2XUFA 1QB8A 2H5JA 3K9FC 4Q93A 2PD4A 3GLTA 5MF6A 1P2BA 3OIUA 4D5EA 3Q7RA 4BIIA 4F5YA 5FV4A 2CHVA 3OC6A 4WWHA 3C98A 1FLNA 3H2YA 3KSDO 5EZYB 1R5JA 2I3DA 2V3VA 5F3DA 3VKUA 1V7QA 5HKAA 4X1KA 1Z0JA 2XGSA 3HQ4O 3HYTA 1R4NB 1UKEA 3P9ZA 5IRCD 1X3LA 1YK0A 3BWMA 4Z4IA 4AB1A 1HFWA 5FPHA 4BVLA 3E84A 2D2IA 2YYAA 3EC7A 2YINC 1G1MA 2ZB3A 3I01A 1ZD2P 2YICA 2HCBA 1UKBA 4M0MA 4KAJA 1RVDA 1UFKA 2BEUA 3DVQX 2ZDGA 3L04A 4FN4A 1OAAA 2HJRA 2W2NA 4DLTA 1PFWA 4ZCQA 5KSYA 4OXYA 3COSA 4YAFA 1GARA 3VDQA 4XARA 3WJ2A 2N3ZA 3QVTA 3EFBA 2HXYA 1DRJA 4PWZA 4DKJA 1H8EA 3RPEA 3HCOA 1PSZA 3U5TA 3PVSA 4UDOA 1MRNA 2XDAA 1UJBA 2B30A 3A27A 3EXFB 1QS0B 4Q1EA 3HHEA 2Y76A 2YXDA 1RKQA 4YDHB 3FUXA 1YFKA 5TPWB 3SJZA 1NXOA 2QI9F 4ND8B 3VPSA 1I4LD 4TT8A 1FDWA 1N0HA 3GMSA 2WV7A 4E03A 1L7PA 2BE7A 3GJQA 3MT0A 4K1LA 3VZBA 1IQRA 2GA8A 2IYFA 2E18A 3IBTA 2NO6A 4YMIA 5B58T 2FPLA 1EJ6A 3UWPA 1P75A 1ZBQA 2C7BA 1OYVA 1ZUNA 2I2XB 3EGWA 1RPAA 4AF8A 3OOWA 3Q6NA 3AX6A 1VPTA 3QLEA 3PLAE 5FWXA 1Y1SA 4EUKA 1BMTA 2FGJA 4S24A 1SC4A 1UXJA 4IDPA 1W1WA 2IZ7A 1C4XA 2ZBGA 1E20A 2CXQA 3A3NA 3BJZA 1QKKA 5EIBC 4G9BA 3W4JA 2LKCA 4R69A 1QGUB 2QYHA 3QXCA 3SBEA 4ESOA 5EMMA 4EEKA 5DRYA 2EKBA 3C4VA 3KG2A 4Q4JB 3RTAA 2Y1GA 4GLBA 3SX4A 2A88A 221PA 4OL0A 2V5AA 3OIDA 1NBHA 1Z9BA 1EUYA 1X7DA 3IQEA 1AF4A 3ZHSA 4BBAA 3G1TA 1M1YE 4DKXA 3TRJA 3BWEA 4LWZA 4R9UC 3BK2A 5JPDA 4HB3A 3M83A 4C2BA 2MT9A 3P9XA 1A27A 1YS2X 2E82A 3O0DA 3NCHA 2AC4A 3DT6A 4IHJA 3WNZA 1V2GA 2Q7OE 4BGDA 4ZHQA 4TL9A 4CEJA 3BXXA 1IMJA 1OBOA 4ONEA 5JOQA 2QLMA 2FEMA 5C4MA 5B4VA 4QSMA 2Z6AA 5JSUA 5AXCA 3H8WA 4HUJA 4FKZA 4OOEA 4RY2A 3LGXA 1VIYA 3R3JA 4V3BA 4ZRNA 5TY0A 1Y33E 4L3VA 1QZZA 3GW8A 5I7UA 1Z39A 1WB5A 1I3MA 4IXNA 5HG0A 1A9YA 8OHMA 2P35A 5CT6A 2R60A 3R8CA 4JIGA 2QX4A 3TQHA 4GKKB 4FTWA 4X97A 3ONNA 4NBVA 5FUQA 3LECA 1Z18A 1KEWA 2CLIB 3JQ9A 4NBSA 4L8FA 5H16A 2FN8A 5H83A 5EXXA 3VYWA 1THGA 3M6FA 4L95C 3PUWA 2VWGA 4ZP1A 1S3IA 3RSSA 1UFQA 3P32A 5EVJA 3THXB 1KDVA 5LXTF 3RUAA 3W7BA 2X7JA 3TTYA 1T25A 3AUXA 4FGLA 4NQZA 4PQYA 1M6VA 4IEEA 3RVLA 3FMFA 1ADFA 1AURA 3AI1A 4OHPA 1GL7A 1HNNA 3FDIA 3M3HA 3RUCA 1MZVA 3H2KA 1CRZA 2HBRA 2I6UA 3VXKA 1QG4A 1JHXA 3WZLA 4D7AA 3U37A 4EVRA 3CZQA 5CB4B 1P9OA 1XE3A 1VMKA 2CVZA 1QZUA 2F3TA 3EIFA 1D0VA 3MPUA 3NBKA 3R6TA 3L8CA 2CCKA 3PNBA 2CL6X 3L46A 4PVCA 2DY0A 4S3MA 2ISCA 2XDQA 3WGUA 1G0OA 3ET4A 4B6SA 3KX2A 1I0ZA 3MS2A 3WL6A 2WYHA 4WXPA 1BWSA 1YMQA 1FUUA 2HCRA 2X23A 5D1NA 3TINA 2VNKA 5J2TA 4YAUA 4P3OA 3WMRA 2BM1A 3V00A 5JAOA 2G6TA 5CCEA 4DCCA 1K92A 3KDPA 4C0AC 4R9VA 2CXOA 2H2DA 3CA8A 1TCVA 3NONA 4J0FA 2RAVA 1P0FA 4RXMA 4EA7A 4Q7QA 3QOYA 3NTVA 5IM4F 1UM8A 3LA8A 2JH8A 2CD7A 1GLNA 1U0GA 5KQRA 3BD8A 3H5OA 1T91A 5D5QA 2DTDA 4AY4A 2AFHE 3FAZA 3QXGA 2HMSA 2RGDA 3T4NC 3G88A 1R5NA 4O5OA 1SZCA 2HH9A 4MVJE 3NNSA 1N36B 3IHWA 1CB0A 2HIMA 2QN1A 4IOLA 4MP6A 3HMQA 4KU4A 1B7GO 1PCXA 5EUCA 2BR4A 4G4IA 3FVVA 3IAM6 4ZQIA 4QUEA 5CT8A 1P61B 3JQ8A 4UM7A 4X20B 1T2FA 4K6OA 4KRGA 3CKMA 4LJKA 2NU6A 4W8HA 4YUZA 3WISA 1O54A 3GJ5A 3BOSA 4JHXA 4MV9A 1JEYB 1K88A 2WR8A 1D2NA 1LPNA 1NRXA 2AUMA 2FTKE 3IP1A 3JYNA 4KYTA 5E1MA 4W7HA 3OWOA 4PYIA 1PFGA 3PQ3A 1NUTA 4QDJA 3NHLA 4BNXA 4WBNF 1TA4A 1RE1A 4INZA 2QLLA 1FTQA 4V3CA 3CRVA 4HVAA 3I6IA 1GCIA 2QEQA 3M70A 4UEQA 1JIKA 4W8GA 1EFHA 3DMHA 1YSCA 3I8XA 5AKEA 1SHZA 1VLMA 5IEBA 3RHSA 2KX7A 1JDBB 3FDJA 3H65A 3VHXA 2AK3A 2BFOA 3ZHOA 2OXIA 4B3GA 3GO4A 4NJEA 4U8GA 2O2GA 3K6EA 2YZQA 2C8VA 4H7FA 3TTSA 4D9EA 4KPFC 3TBFA 4ENQA 2AF3C 2OFPA 1IHXA 1KH3A 2EZ9A 5DXJA 3M2TA 1AT1A 1KP9A 4CM6A 2Y05A 3H2GA 5JCOC 3WADA 3QUTA 5I9IA 3VR5D 1A96A 3EYAA 4N01A 2C7PA 1U6IA 2GBLA 3HNRA 1R27A 1Z2CA 2Z43A 3LW8A 3TQSA 2PKRA 1QMGA 1B93A 4H0NA 1WO8A 2GHIA 1M2OB 2F62A 3ZG6A 5IH7A 2B7LA 2WHPB 4Z54A 3DDWA 3OQ6A 4F96A 3KJQA 4IY4A 2FLKA 4XH9B 2XUQA 2ZYAA 4LYFA 3TRHA 5DOVA 1OKKA 3ZXUB 4KV9A 1K63A 4NNJA 1BWPA 1LI4A 5DCLA 2P8SA 3VPAA 3EA5A 1NXTA 1QCYA 1IZ0A 3QE2A 4TWBA 4EVSA 4F46A 4LRUA 1IN7A 3U19A 4JBHA 1EG2A 2AZ4A 1WULS 1I7PA 1ZSNA 5L45A 3CM0A 4KACA 1ECLA 4KN6A 4I3HA 3SOPA 3UYKA 2HOQA 3MCVA 5DH9A 2IP4A 2WIJA 3BGVA 5IU6A 1H2ZA 2J6BA 3IKLA 1Z0AA 4F38A 1YI0A 3W1VA 2OM2A 2QBYA 2NO4A 2ZULA 2NV2B 4M38A 4ZVPA 1WLSA 3I5XA 3R0ZA 1K4KA 3KVYA 5EHQA 3IEMA 4WXMA 2ALJA 4BQOA 3C6BA 4JZKA 4JAVC 1K1EA 3C48A 1W0KD 3KD3A 3GFVA 2HA0A 4LX0A 2VNJA 3WGGA 1OLUB 4RANA 3L7BA 3QVUA 1KHTA 2C95A 1KKUA 1H6BA 2Z8YA 4X6XA 2OD7A 2QN9A 4EA8A 5IKEA 1Y3CE 3I92A 2YRWA 3P19A 3TR0A 3LC1O 5HF9A 4IIJA 3ZJYA 5JD6A 1SUSA 2JB9A 1EZZA 2YN4A 4QXPA 4HQOA 4OSEA 2BONA 2PGAA 4GVXA 2WFLB 1NI3A 2QYOA 2HXGA 3DMGA 4GSKA 4IUDS 2OHIA 4MWSA 4QTTB 4CZ2A 3RT9A 1R4MA 1HNXB 4G0XA 1CRPA 3RBVA 1Q22A 1E2MA 4ESYB 1M1ZA 2IP1A 2O4UX 4IM7A 1XALA 4PHGA 3EGOA 2BKLA 4OMDA 3SIWA 1GZUA 1P9LA 1F2TB 3I8NA 1PI3A 2G7MC 2X7XA 3L1IA 5CM8B 4GWLA 3UB3A 3X44A 3EZGA 2ASEA 3PBKA 4IZOA 3RASA 3WB9A 4CM5A 1DZ3A 1YS4A 3KOMA 1PGJA 4ON9A 1XDSA 1U90A 4LYYA 3ZD6A 1AQUA 1Y3IA 1D09A 3B6JA 3TZQA 2JIRA 2JFXA 4FYXA 2A0UA 2Y67A 1F4LA 1A5AB 5CU7A 4KWHA 2IZZA 5HMLA 4C0BA 3EPLA 3ROXA 1I14A 1CS0B 3P9KA 2IHJA 2HFKA 4YMWA 2P4UA 2X2OA 2C03A 4PLVA 2PZAA 4NDAA 1NBAA 1Q92A 5SICE 5JMOA 4PIVA 1GPJA 1RC0A 5AVTA 1PLJA 3IAHA 3TFWA 2DH6A 1EBBA 5I5GA 1JSRA 3IODA 3HYCA 3PYXA 3DHEA 3L7AA 1LDEA 2GERA 4R8LA 2EKPA 3CB4A 1I2DA 2JBAB 3MJCA 4IJVA 2FP4B 2HD4A 3A3OA 5BUSA 1XNJA 3HVKA 5E6SA 1XPRA 4WK2B 5DSXA 3D6NB 4IPTA 3FDZA 1NUPA 1F14A 1Z4KA 2FZVA 2YDXA 4M2LA 4O4IF 3NHFA 3A2KA 1DT3A 3OA0A 2Y1KA 2C5HA 1Y9AA 1M67A 2R8EA 1MT0A 2E4AA 2GKSA 3EPRA 5CMLA 4Q3KA 5HUHA 3IP5A 5A3QA 4LZNA 3NGXA 4OJNA 1GAEO 1U8FO 1GQRA 2KJQA 1Y0BA 4URZR 1LKZA 4MDHA 1G63A 2YMPA 5JIBA 4GP7A 3WK5A 1V8DA 1HF3A 3WNBA 5JC8A 1LPOA 3WK6A 1BGXT 1EEXB 2Q45A 3BGIA 5CPBA 2J6IA 1QNFA 3T3PB 1XPUA 3IUPA 4R98A 4TV9F 2VJYA 4DDUA 2QJOA 3I5MA 3I01M 1C7JA 1FFXB 2MINB 3BMOA 3CRZA 3ESRA 3HJRA 4EM6A 1RXWA 4HK4A 1C1XA 3MFYA 2BZ0A 1IN6A 1SXJA 1T3LA 1WJGA 3C1TA 3OX4A 1XLVA 3QVJA 3AVPA 4FXOA 1LVHA 1NXQA 1FP4A 2C7QA 5ESXA 2PUFA 3FRHA 4B47A 1WCWA 4EB0A 3TLMA 4CDMA 1QZXA 3O8QA 4DA4A 4KR6A 3LQNA 3DFFA 3R5HA 2B35A 2QIOA 4D0SA 2GETA 3BIOA 4DM3A 5LQJA 4QUJA 4XB1A 4XYBA 5K0ZA 4WKCA 5UKDA 4FD2A 4LMAA 1VLVA 2QLJA 4OJKA 3U44A 3EXG1 2AEEA 3KH5A 1K6MA 2QG6A 3HFRA 5BN3A 1R0XA 2QUHA 3U7QA 2E49A 3B1VA 2FN3A 3UW1A 3BB1A 3EWIA 4LZLA 1BMQA 2JZOA 2H9IA 3IBGA 4P7FA 1Z7EA 1JLLA 4GZ6A 4PSKA 4NNPA 1FU8A 1X8JA 3HV0A 4AKSA 1CJUC 1JHYA 3SS9X 2HY7A 1N2EA 4IHQA 1AUPA 3RI3A 4BNVA 1BROA 2G5GX 1RC8A 3MUEA 2F90A 1VJRA 2EEPA 1ISSA 4CKBB 3EZ7A 3KEOA 1YR7A 2J3MA 1ENZA 4P53A 1ID8A 4LBZA 1NN5A 3RARA 3TF5A 4QGSA 2UV4A 1N2ZA 4Y2UA 2YQ4A 2DSNA 4B83A 2AS0A 4I81A 1I3NA 5HGJA 4D9CA 1XJCA 1HG0A 3A9UA 3KT3A 2JFHA 2CFRA 3NMUF 1VKJA 1JT9A 2OG2A 1FK8A 3I3OA 2JIZD 4JMLA 3W5JA 1FP6A 4I1YA 3CKLA 4QRHA 3ENQA 4HNTA 5JAUA 3OIFA 2CVPA 3P26A 4M98A 4EOGA 3O7MA 4L4YA 1J8QA 3KQTA 2XV1A 3QTTA 3KFLA 1BDHA 2E4WA 1YQEA 5JSFA 2W70A 1MOPA 3L0ZA 4WUTA 3EOBI 1P7CA 1XFAA 1XHFA 3RYFB 1UK7A 5FD8A 2RGBA 3VZDA 4D4JA 3Q3IA 4IMPA 1IZ7A 4U4AA 1KS9A 1J33A 1FVOA 5KI6A 4YO8A 2WAXA 4XZ3A 1J70A 2QM3A 3TNLA 5K24C 4II7A 1JIIA 4HTFA 3UHAA 4D4MA 2WRZA 4DL9A 4EGAA 5GMOA 2GCOB 4XTRA 2HA7A 3IMEA 4WZBA 5IJ9A 2GX6A 1PK7A 3WBBA 2FUG1 4UJ3A 5K0SA 1RJWA 1QU2A 3AM1A 1VE9A 3CEPB 2P91A 1WA5A 2GZDA 4O2LA 5ALEA 5BR7A 4ETIA 2IWHA 1WU8A 2GRUA 3EWAA 5JS2A 4YASA 1UM9A 3KKPA 3RYHA 5KOJA 3MCUA 5EHXA 4XOUA 3DQQA 5ULLA 4FK8A 1Y5NA 2JATA 2W8ZA 3IAEA 4HDSA 4HY3A 1QBKC 3I9NA 4ZZIA 2O2JA 2AIRA 4BQEA 3GD7A 4OKIA 3IOEA 3MT9A 4BYGA 4ZEMA 3HI4A 5U1PA 2FAXA 1CY4A 5AXBA 1YQTA 4LHYA 4D43A 4GQWA 1XI2A 1IE3A 1KR2A 3HZZA 4FXSA 1ESNA 1LCIA 2W8BB 3C3PA 2QL5A 2RBEA 3A7EA 2ODPA 1U2DA 2IELA 2LWIA 2D8AA 5DIZA 3PUKA 5J4YA 5KTRA 3VR5H 3GFBA 3T4EA 4BO1A 1JU9A 1JILA 1JG2A 5HE8A 4ZEXA 4Y9SA 5E6UB 1F60A 1S3SA 1YDEA 1VHWA 3BSYA 4FFPA 1CR1A 4JP8A 4LXQA 1MH1A 3AEXA 2QS9A 2GHRA 3Q72A 2O5RA 3S0JA 4C4XA 2O59A 5DLYA 4JQCA 3F7MA 1EE2A 3L1HA 1MNAA 2GCPA 3Q3CA 3UK2A 3NHPA 4LS3A 5DYIA 3DAHA 2DHCA 3FCOA 2YY7A 4MTCA 4EYSA 4Z4FA 2X3UA 4JUCA 5A4KA 4FGJA 4AWXA 4Y6RA 4OOFA 4G09A 1P5HA 3O8OB 1BKDR 4WEOA 2ESRA 2KLBA 1L5OA 1IIRA 1MEOA 1IY1A 1EH5A 2NO0A 1KO4A 2NT3A 3EVNA 2IY8A 3IQHX 3L6OO 3OOJA 1AGXA 4DN6A 1XZLA 4CIAA 1NVXQ 4UTVA 3IKMB 4PR3A 5ER9A 5JMWA 1Y6RA 1Y9ZA 4PBRA 4E4TA 2WIKA 2Z3WA 4P2BA 2ZYSA 5ERXA 1O6ZA 1EVEA 3AR6A 4R1QA 1B26A 4IZ6A 4GMHA 3RAJA 4YRFA 4B6GA 2VQEB 1TM7E 4J43A 5CTJA 3RSFA 3F6SA 3BL8A 4U3JB 4ENTA 2IUYA 3KWFA 4MQEA 3AGQA 4XLLA 4RPCA 4AY5A 1XAGA 3TX2A 1T9ZA 3JWEA 4AJ2A 4BEJA 4YHHB 3F2VA 3ZV7A 4C3VA 1EM8B 2HPHA 4XR9A 1LLDA 1Y37A 2G82A 1FSZA 1NA5A 2X7HA 3ICCA 1TU0A 1BN6A 3KWJA 5ESWA 3UIEA 4LHXA 1UIRA 3ZWMA 1LJ8A 1EPUA 1H23A 5BOSB 1BO6A 1LW6E 4KPUA 2LNDA 1Z8NA 4DXAA 3J81A 1KY3A 3KB1A 1C8KA 1EZ4A 1EA5A 3IP6A 4O63O 5H70A 1QCZA 3G8AA 3QLVC 2OPHA 3H84A 2HREA 3DEJA 2BBTA 2E55A 1JB9A 4TTIA 5F3WB 4J6EA 4PZ0A 1VL8A 2B0JA 2BY4A 2XCUA 2QT1A 3ZI0A 4Z7QB 3L8EA 1YIAA 2C82A 2P9EA 1GU1A 2OY0A 3M89A 1LBSA 3P9IA 3SC2A 5H4GA 4MGHA 2VYQA 1DG9A 2EFDB 3M5PA 1BU5A 1ACMA 3SYMA 3MB5A 1FU4A 2LCFA 4HN4B 4JC0A 2JGMA 3NIBA 4B43A 3KT6A 5IP5A 4KN8A 3AERB 5JTTA 3DO5A 5D3MB 3SD7A 2QT0A 3E0XA 1RXCA 4JJAA 5TMPA 1WBDA 5BYKA 1N2GA 4RFVA 3D0OA 1LWNA 2X19A 4X3CA 5GY7A 2NOAA 4KV7A 2OO7A 2QTTA 4IRUB 4NMHA 3C43A 2PSDA 4LY0A 5ALUA 4HDNB 3ZHTA 4DMRA 3W2FA 1Q0PA 1ESDA 3BJIC 8ABPA 3T34A 4E4YA 5IXYA 5C53B 1XZEA 3I2JA 4HPWA 1AV7A 3I2IA 2VDQB 2B7CA 3D6JA 2FZEA 3SXUB 2ZSJA 3CZ5A 1ZJ5A 5HCIA 3LX6A 4QUAA 4ERNA 2Y9PB 3GXBA 4G5YA 4MHTA 1PQYA 4PAWA 1FW8A 2WI8A 3KYDB 4JWKA 5IBPA 1TYZA 3TIIA 3U0BA 3ADCA 1GEEA 4ZAXA 1RP7A 4E21A 4BX8A 1A5BB 3PA8A 5B1IA 2IHUA 5AHRA 4HWKA 4YFYA 1KP3A 1OBHA 4TXNA 3L8FA 1QX4A 5GV8A 1FXSA 4UM9B 3C87A 4Q7JB 3GG2A 5K1ZA 4B71A 4X90A 1WE2A 3WWPA 2WBLC 3T95A 2D0IA 2HDWA 4MKXA 2WMYA 5EOVA 1DKUA 1P7PA 2WYUA 3LAWA 4CR6A 1QH1B 3VTAA 2YDYA 1NY6A 1Z0IA 1Y1TA 2DWUA 1VHLA 1Z6AA 1MO4A 2X42A 2JD1A 4N4AA 1JB1A 3WWEA 4WY5A 4DV2B 3MAGA 4BLPA 1HMYA 4OF4A 5AQEA 1ODKA 1SUEA 5GJWC 2LP4Y 3L4BC 5BSTA 5LC1A 4F2PA 2X3YA 4GQVA 1R6DA 3OQPA 4YA6A 4D99A 1GIAA 1Z5ZA 4PAOA 4RPJA 2OV2A 4JLSA 4L9WA 2FFHA 2TS1A 3H9BA 3KUKA 4LSGA 4G1EB 3GNLA 3LRXA 2Q8PA 2HMTA 3JQ7A 4G9GA 4MW4A 2PRZA 4U8HA 1HE5A 5K51A 2PANA 3S40A 4GDFA 2QY6A 1DNPA 3MT7A 3HXKA 1C7FA 1E2KA 2LV8A 2OWEA 3AM3A 1J49A 4R4JA 2O1SA 3EBLA 2QJRA 5G0TA 3JYOA 1LD3A 3BE4A 1KFKB 3GFTA 4K6HA 4RNCA 4JIMA 1Z74A 2VF2A 4EY6A 2B8JA 2BN4A 1HFJA 4GPIB 4DIFA 2PU5A 3H6GA 2HK6A 1LFDB 1K6XA 4DQWA 4X7BA 4XWKA 2VI5A 2JASA 2DVMA 3IBSA 1X8KA 3ZPXA 2V8BA 2CV1A 4LXHA 1ADYA 3GVPA 4R1LA 4S12A 3U62A 4EA6A 4HUTA 1KRWA 5EEHA 3TNYA 1RLIA 3LHFA 1UAAA 1L5YA 2PQ6A 1TIPA 1TFRA 4W7IA 2OBBA 1Y3HA 3D1VA 4XSHA 4NU5A 3G9UA 4RMHA 1W0KA 5FDFA 3M5WA 1OX6A 5B1HA 1YULA 1QVZA 3BM5A 4RJKA 4E33A 2FWJA 5DK6A 1CZKA 3D0RA 4AZ0B 3RU7A 2ZJ3A 1HQKA 2IIBA 1V1MA 4IIVA 3SZLA 3TI9A 2I8AA 2JH9A 3QVOA 4H6PA 4CVNA 5I01A 4Y6QA 1CU1A 3BD7A 2YXPX 2CB0A 5CIYA 3D8UA 1H3NA 3BICA 4LJYA 1QTQA 1IVYA 3C7DB 4OGLA 2L82A 3NPAA 4TVSA 4YRKA 3SFVA 1XMJA 3JALB 5F78A 5B7PA 2ZSBA 2IHZA 4EKIA 4KTVE 1MA3A 1S8NA 3UQYS 4P9NA 2JIMA 3QMWA 4BQFA 4H1WA 2GFQA 2ZRMA 5GM2A 2W11A 1SVNA 3DKKA 4UBJA 4GX5A 3ZE8A 5CPFA 2WJJA 3RKUA 1FLVA 4FSHA 1B0ZA 4BQNA 3TGLA 1W36B 1NUHA 3K70D 4U1RA 3MG9A 3G2NA 3OH8A 1WZIA 1JG1A 2L42A 2OZPA 4G4SO 4RMJA 1B76A 5LP1A 4BO9A 3I4CA 4ZCIA 5G0VA 1NKTA 2JG3A 2QYSA 4POAA 1G38A 1DQRA 4WLEA 1N8KA 3VZQA 9LDBA 3OM9A 1JPJA 5P8WA 2X76A 4Y9UA 5IDQA 5CJ2A 3K53A 2C5BA 3PWSA 4BJ1A 2B37A 1BE6A 3LUGA 1I13A 2FR8C 3GAFA 5EXSA 2R5FA 4CMHA 3I5AA 4DSTA 1Y7PA 3IEUA 3UOAB 4TZ6A 4FHDA 2XUPA 3L01A 4TMWA 1KQNA 4F4JA 1BD4A 5DGIA 1ZL2A 1L5HB 3UAXA 2IPXA 1ORVA 3N05A 1ZA1A 5LZ5A 5I48A 4KWTA 1CJCA 4FB4A 5AK3A 1G19A 3U3OA 4JMPA 2PE5A 2VPYA 1QV6A 3WWDA 1L7VC 4CEIA 3CVWA 1U3WA 3GPLA 2LRHA 4XB6B 1SA0B 3SS8A 4C78A 5LYJB 2A35A 2WKQA 2Q5EA 3NIWA 4XX0A 4V03A 5J43A 2HC9A 5DNYB 4E1VA 1G2OA 5F4ZA 4ZI2A 4ZK2A 1LDBA 3RT1A 2GB4A 3JY6A 2CYCA 3G8YA 1ESMA 4XVQA 3ZE0B 2RE8A 4YUAA 2IL1A 4D4LA 3CH7A 4DLAA 2NM0A 4G0VA 4Q3OA 4A36A 1IRXA 3DFUA 2DZDA 3JD0A 3C6MA 3PK0A 4JLBA 3JARA 3MT8A 4V24A 4WFQA 2EJTA 1GTRA 2JVJA 4ODIA 2PWAA 4R51A 1VHJA 4XVRA 5B37A 3GVXA 2HA5A 3TRFA 2OE2A 3A2NA 2HF2A 4A0RA 3DMFA 3ZWVA 1HPLA 2Q41A 2Y3IA 2G25A 1LU9A 3GIDA 3CN9A 4GGMX 5FYQA 3L4KA 1LXCA 2R4QA 4X9XA 3RODA 5IYZB 1GSIA 4G5QA 1BDIA 4R8KA 5BV8A 1Z4QA 1CDOA 1R0KA 4ZMSA 4AJPA 1SVLA 2VDUE 2CFTA 3C14C 3L41A 2QN7A 4Q16A 1NI4A 1VLJA 4HGYA 1IXKA 4B75A 3N0TA 1OJLA 2HLNA 4FLMA 4CMEC 2VEOA 3W2EA 1RRCA 3RU3A 4EY5A 2R6ZA 3I2GA 4MV7A 4BVKA 5HQ3B 2RGUA 4TV8A 3WJ1A 4KO4S 4QBHA 1EVQA 2WAAA 3B82A 4PHHA 2BELA 1PTJA 1L5ZA 2JLAA 5D6NA 3E8SA 5C34B 3KXDA 4LXYA 4FEYA 5L8VA 5FKJA 5KYXB 2MMGA 1J1ZA 5LQNA 2IHTA 3FOBA 2EG5A 1B8NA 3F3YA 5BNZA 1ZVJA 1SKBA 2IYWA 2R6AA 5CNIA 4BASA 3TIXB 1C4WA 5JAZA 1EX1A 2PNJA 3AB7A 2XVXA 1OX4A 2PMKA 4L4UA 4MV6A 2ZIGA 1OB5A 1EQAA 2V0GA 4KZKA 2I5PO 3NYRA 3G5LA 4RHTA 3R7FA 2FWBA 2PSFA 1G7TA 3H97A 3IBYA 4HS4A 4A16A 2CVQA 1OH5A 4GI2A 1G4AE 3HCPA 3MMPA 3B1JA 1HY3A 1J06A 1QO0D 3HP1A 4K9KA 1GOTA 2CXRA 1SQ5A 5EWJA 2P5SA 2HBQA 3LBIA 2XAUA 2O2DA 4FYHA 4OH7A 4E1AA 5G02A 1CUSA 2DPLA 2PQMA 2V98A 3DW1X 3QPWA 4GZ5A 5D2CA 4CG2A 2MSWA 3KYCB 5D01A 5EIAA 5BP7A 3PYLA 1KEKA 1Z63A 5IJAA 1E8MA 4GRIA 4XM2A 3LCUA 4ILEA 5EGSA 3ROPA 3ZDYB 1FDRA 2C5LA 3IH5A 4P92A 3HXMA 4JI4B 5T7BA 2Q3DA 1WUHS 2BEJA 4LMPA 4G56A 3SQWA 1TPZA 3HJNA 4UBKA 1XDWA 4XYLA 3LMKA 4AP6A 2AOXA 4ITVA 2WU4A 3N9IA 3AL2A 1R0WA 3VKHA 2VRCD 3GUZA 4DUGD 2V7BA 1CNFA 4NV0A 2NTJA 4OAQA 5H8WA 3G5UA 4M6WA 4RD6A 2RHRA 5A3VA 4JBXA 3DMDA 5F9MA 2AX3A 4GD3Q 3WFJA 4BNDA 1DDIA 1RXYA 5LA6A 1JDNA 3REFA 3AWDA 4IIFA 1U28A 3QENA 4GL4A 4JI1B 4EX7A 3RC8A 4OKSA 2D5BA 5KYVA 2Q5FA 1PJ4A 4Z8XA 4CU2A 5IT4A 3A6PC 1YA6A 3OM0A 4BBJA 1T2AA 4GLJA 1CUZA 1GNPA 1LB1B 4AJOA 3RU9A 5ED0A 2PUJA 1Y7HA 1GZ7A 1V4NA 1TIKA 2VWQA 3DDOA 3MUOA 2DUMA 4ZQBA 3RH0A 3WIDA 4BDSA 5BNIA 3AINA 4YY3B 1CK4A 1V48A 1W48A 4NENB 3SDZA 4BNYA 4LXUA 3FPBA 3LQKA 4I4TB 1WOYA 1QF7A 2PGJA 3JYPA 4IXMA 2LCIA 3L82B 4XYMA 3G6KA 1JHMA 1UXKA 3CRRA 3QW2A 4M1OA 1OV4A 4MRSA 3IQXA 2DM6A 1B1CA 3KLNA 1IZ8A 2VBFA 1C1DA 3CSSA 4G5RA 2GNAA 4GOOD 4ZYXA 4UAJA 5I9LA 2JFZA 1E6UA 1SPBS 1C8LA 2FXVA 4AKIA 1DRKA 2OC4A 2ZE8A 1Q7TA 3PUZA 4HDQB 3AESB 3E9MA 2XOXA 3SZMA 3O2NA 2PX0A 4MPTA 3WYFA 3H7IA 3ZI4A 2NGRA 3IOMA 2NSJA 2NU9A 3FTFA 2EATA 3QPUA 4CQMD 2REBA 3OE7A 2FW7A 4M1KA 4KTTE 1KJQA 2PS0A 3URMA 4BAGA 1J5EB 4ZOLA 2VH1A 3KXKA 5HTOA 1HXHA 2XNDD 5E6RA 5L51A 2ECFA 4LOIA 1QO9A 3G9TA 1FXUA 2A5YB 1Q0RA 1GUFA 1N6IA 2NNLD 1ZNWA 2XNKA 3BWXA 3KPYA 2X8AA 2VXYA 5LD2C 5BPHA 1JJAA 3Q7TA 5AJZA 1CYDA 3BBLA 3RO7A 5BMVB 5U4XA 4PLYA 3ULKA 3UXYA 4ZDKA 1NSFA 3B1YA 4U5QA 4CLXA 3RTCA 1MHTA 1J09A 3AEQB 2O16A 5MN6A 3LX5A 3HP7A 3V8EA 1GFZA 3RK4A 1NXVA 1FZTA 1BOFA 2MSEB 1UMCA 2ZWPA 1UKZA 4A8HA 2CJPA 1IU9A 1G3QA 4ID3A 3IPRA 3PHJA 4TMXA 1LS1A 3OFKA 1KSGA 2KM1A 1M54A 1RXSA 4J7AA 5J5AA 2VRNA 3LUBA 2R8BA 5F35A 3STHA 4YPOA 4Q9LA 2VNSA 1BYIA 1E99A 2EX4A 4A6PA 2CHQA 2YYYA 2Z5LA 3MK31 4UHEA 1QFJA 3BFKA 1YE5A 2O8NA 4CQLB 4EFKA 5KWJA 3JW8A 3BMNA 3RHFA 2F3SA 1ZN9A 3ZBTA 2BR5A 5AD1A 2ZPUA 3GU3A 5HWSA 3K7EA 1H1TA 3OZGA 1L5KA 3CBGA 1XXLA 4OFWA 4U2CA 3NGMA 3OJLA 2IEYA 1O95C 1ZG3A 2I99A 1KEPA 3EAQA 2OC9A 1BFUA 1D4AA 1E3WB 3HRKA 3OWXA 1BSVA 1PR5A 4FOLA 5HS6A 3H5LA 5A04A 2WZDA 3UGQA 3E3OA 4HEQA 4CGYA 1X1SA 1LTHR 1ZOSA 2V6IA 3BXOA 4J8PA 1YDWA 3T12A 3UTDA 3P4UA 2FFAA 1AHHA 4ZI7F 3BDIA 2QLNA 2ZVQX 3T7KA 3FX2A 4N40A 3NHBA 3W2HA 3SF8A 2DPGA 2ZI7A 4C7OA 1UBCA 2CJFA 2HJVA 3PRYA 4UREA 2AN3A 4B17A 2HA6A 3GA0A 4CMCA 3M34A 1L7NA 3B70A 1Q16A 2IYTA 4Y2SA 3VU9B 3I39X 3QU9A 1W5AA 3R44A 1PQ4A 3DVSX 1XVLA 3E05A 1JRLA 3NWOA 4MH0R 5HJ7A 1SBQA 5BT8A 1ZS9A 4XI9A 4ZO8A 1Y6QA 5F2KA 5BXYA 4D3DA 1Q3KA 1XA0A 1T6ZA 2FG7C 1KSFX 3BTUA 4HJRA 4UATA 3ZNPA 3N86A 2QMQA 4RQAA 5LKAA 2FVXA 1GAWA 3F46A 1GPH1 1BZYA 2VP4A 5EIHA 5BY2A 5BYJA 3QYAA 1X0VA 4PFSA 3A1EA 1W4RA 2CKDA 1EFDN 1J7KA 2CF5A 2ZTUA 3S1AB 5KWIA 4DV4B 4RTRA 1ZIPA 4D46A 4RE5A 3C0KA 4YAWA 2DECA 2WVAA 2EDAA 2XQVA 3DR3A 4HPJB 4Q9HA 1RRVA 2XMRA 3TRDA 5TIIA 3AL3A 4JI2B 2FJPA 1XRMA 4NFYA 1RM5A 1LLQA 2QUZA 3MYYA 1QB7A 2BGJA 3E70C 2YJ3A 3I58A 3UV6A 4PIMA 4UCFA 5EZ5A 4F72A 3SXPA 5JSZA 3E8XA 3F71A 5EN4A 5JI3E 1HUQA 1JPVA 1CHNA 3Q2OA 5I7RA 3L2OB 4Y9TA 1J97A 1VLHA 4GMFA 1KEEB 2HQBA 3JQ9C 1L3IA 5D84A 5DP2A 5IW8A 3OJXA 4DR1B 5EYPA 1C0EA 1IVSA 1DO0A 2TSYB 3LD9A 5A5EA 3BE6A 4KMRA 4N3GA 2FQ1A 5DGXA 5F2EA 4QYTA 4F5WA 3V8RA 5C8YB 2KYRA 3JS5A 3PX7A 4I4IA 2QLTA 4OU4A 3SK0A 5JVDB 2BP7B 4MUMA 1JEQB 1ONBA 1V3UA 1ZD4A 5EJEA 1GM5A 3PEYA 4K46A 3Q41A 2J09A 3PJFA 4JQZA 5IH3A 4WE3A 3E27A 4L3OA 2IXFA 4ZDWA 1G2PA 1P62B 2OCYC 4G5FA 1Y1LA 1MFPA 1GZDA 3EXHB 4LRSB 4LTDA 3CR8A 1K08A 1XZBA 5LCXA 5KSPA 1WSDA 1X13A 2QSUA 3RK0A 3TR6A 4AF6A 4BWGA 5KSOA 4FE4A 4KDFA 3VNAA 1ZC4A 4CFYA 4R2KA 3VSDA 1JTFA 3U4QB 4EFMA 1JAYA 2JFWA 1FYDA 3E5NA 5DBEX 2G0TA 3JAWA 1T5SA 2IUUA 2IXBA 4YRRA 4FOOA 4NYJQ 3SC4A 2GHQA 2FFJA 4K2AA 3R7BA 4YJGA 1D4FA 3EMKA 3RT7A 3Q8MA 4RTKA 3S1SA 3NJRA 4IJMA 1P4GA 3Q5DA 4FW8A 3JWJA 4MQBA 4ZICA 4ZVOA 3B20A 1S3GA 4US0R 2W58A 3IDZA 3WGVA 2WEKA 2BTQB 2CDCA 4EO9A 4F9EA 1YIDA 2CDAA 3ZE2B 4C7XA 2PVCA 1IPHA 4IGEA 3ESQA 3LBHA 1RPJA 2QXUA 4JYMA 4Z9AA 2V96A 5BV0A 2FW0A 1ZUHA 2OR3A 1IEXA 1JBKA 2P3LA 4GMGA 4JI6B 1N34B 5GTDA 1CVIA 2OEPA 1XJ5A 4NK5A 3L6DA 1NNLA 1VJ1A 3OCCA 1DV2A 5IDYA 1B6RA 3PZRA 2VP6A 1SOUA 2ZCUA 4TTAA 1K6EA 4XWAA 3V8QA 4ARZA 3Q9SA 4ZOBA 5TQ2B 1U9IA 4HLQB 1NW4A 3CE6A 1HT2E 4WVFA 2VCYA 1NE2A 4RHYA 1SR8A 2GJ4A 2YZKA 2EZUA 2BF4A 2QREE 3K35A 4PO3X 4AY3A 4UMFA 4EJ6A 5IANA 5LB2A 1RT9A 3A9CA 3NDPA 1KHHA 1N6KA 2AQHA 3WL3A 1YB2A 4G84A 4FCTA 4ZD6A 4JUDX 1DS6A 4B6JA 1XR3A 1WCIA 1O4VA 4YXWA 4BLOA 3HCEA 2Q4TA 3ILHA 2XIJA 3BRQA 5KYTA 5DTMA 4F3CA 4LEIA 1SJ9A 3QPCA 3N6XA 5L7YA 1JEJA 2OHHA 5BWLA 3BHMA 1K8RA 1M8JA 2YFHA 3ZE9A 4AP5A 5DBFA 3PUYA 4BE4A 4QGGA 4IGKA 2ZI4A 4MW2A 2DPMA 3JD1A 4BNFA 3ZU5A 2W2TA 1MC5A 3HI6A 5HX7A 4KH1A 2Q1TA 3WK4A 2YWEA 2DT8A 1WDMA 4P1OA 1DBPA 1J0EA 4MYTA 4P3PA 2AZMA 2ZJ7A 1RLMA 5TXGA 1TQDA 4AFNA 3ICEA 4QREA 4ZOQI 2BWJA 1EUCB 1H8HD 4J75A 4F8EA 4JJKA 2PD3A 1XNGA 3P0HA 3SKVA 1EUDB 1M2GA 3OJOA 3RYCA 3K9GA 2F17A 3PG5A 2OUIA 1SVIA 3V1TC 1FMTA 1VE1A 3KPVA 2HJ9A 5IF9A 1GTMA 2JI4A 3AEKB 3U16A 3E1GA 4OGKA 2BFAA 4TRRA 3V1KA 4JA0A 1GQOA 4XIYA 4UCQA 2ZBQA 1N9GA 3LY5A 3L8HA 2JGFA 3ZKWB 3R5FA 3DFMA 2IE0A 3H05A 4MAAA 2FPPA 3FNFA 3SQMA 1CY2A 3CGWA 5DNWA 1T2CA 1MPTA 2IV3A 3C6QA 3K05A 4GKJB 1UADA 3JWPA 2XXAA 3H5VA 1PF7E 4B81A 1TT7A 2IYZA 1I24A 1M1YA 5A71A 1USWA 3HJCA 3VHLB 3FOCA 4TRMA 4G0NA 4BPRA 4ZAFA 5KYUB 1YAHA 2NZ2A 2VHWA 1G8JA 5HKBA 3WKBA 2PKXA 3A1SA 3MTAA 3TDKA 5HRCA 2EJBA 3ESXA 3H3XA 4KBFA 4N0QA 2AE2A 5FI3A 4HEHA 3TLYA 1EK5A 1MAUA 1YASA 3GN1A 1CY6A 3PXDA 4Y2TA 3RVKA 4BJ3A 2PRKA 3TI7A 2I4OA 2ZJAA 1N6NA 2WTUA 1S2GA 3HU3A 3X1YA 1NPDA 2WDPA 1F4PA 4ASUD 3L92A 5JXGA 4DSAA 5LIPA 3G85A 2XTZA 2FG5A 3RWBA 2A1TS 2LIVA 2OHVA 5KC9A 5BSEA 1ILEA 2B6HA 1A88A 1UWVA 3GFSA 2VDNB 1BXGB 1IHYA 1SM4A 1VGRA 4I9UA 4UHCA 1B0PA 1C3VA 4L78A 3VDNB 3U6KA 1VKOA 1TKRA 3M6AA 5JR3A 3CZCA 2VJOA 4JFAA 4C3ZA 2CZCA 4QYIA 5FOUA 5CVUA 4MSUA 4F3YA 4Z1MD 1C0PA 3AZPA 3KT0A 2QRVB 5A1JA 5KB3A 3QV1A 1UXHA 1UOOA 1YZQA 5AFSA 3OQOA 2HWUA 2F7SA 4RH1A 1XWFA 1FW6A 3PKZA 3RGWS 4O25A 5JATA 4ND5A 3QMMA 4YJ3A 4AULA 3SR3A 2UDPA 3K8ZA 3NUZA 3M8KA 1OI4A 4MI3A 3AQ4A 5F73A 4A6EA 1MC8A 1X7YB 3IIKA 1NI5A 2IJGX 4M7RA 4FCCA 5BWNA 1YHZA 4AXBA 3QHPA 4BX3A 1G3IA 1GAQA 1E79A 4UMVA 4BLUA 1O77A 3DYVA 4TTTS 1LTQA 4V1CB 4TYNA 3ANYB 2PBLA 4DREA 1QR2A 5ALZA 3D0KA 4AKEA 1MTOA 1RYNA 3B6ZA 2YNMA 4RD4A 2VHJA 1GN9A 4HB4A 1GGJA 4M54A 4WRRA 4RVDA 3H1PA 4PAGA 1N9ZA 3MGCA 4XJSA 2H18A 4C2TA 3HY6A 2CMDA 1VBKA 2Q3HA 2ZTSA 3SVZA 3T5PA 4BY9E 1SBNE 1DRWA 1UJNA 2ZSHA 3HJUA 4L02A 1ORRA 2AFHA 3P27A 2NYCA 1XKLA 2YY6A 3P2OA 1AG9A 1P33A 2W83A 3D4BA 4HNAA 4MVJA 2VIIA 2A8YA 2PFGA 3LQYA 1D6JA 4MUJA 1KAHA 3IRVA 4JB3A 1RPZA 1SH7A 4K3VA 1K3UB 1KJZA 2F9FA 4O4HA 5JWHA 3IDQA 4LPSA 1GL9B 2ZW9A 4AICA 5D5PA 2VUHB 3R5KA 3RS9A 5FUBA 3MVEA 5TR9A 5K8CA 4RS4A 3TD9A 4YV7A 5ADVA 1NLUA 2KBFA 3ZDDA 1S1MA 1A9OA 4I5FA 5CLQA 2Y0EA 2EXXA 3QFTA 2IH4A 4H4EA 3WLMA 1ZBDA 5G40A 1X1CA 1VLLA 3O4FA 4F60A 4RYLA 1TK2A 3HYNA 4QJIA 1LBEA 1XRJA 2AR0A 3EC2A 3EY9A 3QITA 1Z7WA 1XRNA 5JRJA 3FIJA 3DFKA 2AYZA 1U4SA 4DJTA 1IY2A 1FNMA 2V97A 1T8RA 3KSRA 1M5UA 3HEBA 3L43A 4ML3A 5K0NA 1SXJC 4KIJA 5ALXA 2Q50A 1G8MA 3TYXA 2GPWA 4LPKA 4QOIA 3CWQA 5FULA 2FPXA 4FDLA 3FUCA 2JIOA 3A11A 2HB6A 2R751 4BX2A 3PT9A 5BSKA 3SKYA 3PFFA 3ZTYA 5IAEA 3QIAA 3LY8A 3ZLTA 5I8PA 1PP4A 1ZK0A 2FZLA 5IKMA 4BFUA 1V4BA 5TARA 1UBLS 2PD6A 4QTUB 3PJEA 2FR1A 3VNBA 2J9GA 4RFSB 2FRXA 4XQCA 4CQMA 4EPTA 3AI3A 5KWVA 1L9KA 5FO0A 4JI8B 2B8NA 1Z4MA 1CXZA 1UBSB 4LBWA 1Q20A 3K4PA 5BN5A 1FS5A 5I7OA 3O0TA 4TXHA 4DWJA 1E2DA 1E62A 1RVV1 1G16A 2BMFA 4Z0HO 5LM3A 1SXHA 3LP6A 4AYWA 1H65A 4C7KA 1KQGA 3HKDB 3AVUA 2XWPA 2R5WA 1MH9A 1CQIA 2ZTMA 5JAIA 3SLGA 1H85A 2AH5A 2XE8A 3UJHA 1UBUS 2GASA 2QAIA 4NBTA 2QWXA 2C8KA 1OB2A 1XEAA 1JEOA 4EUHA 5LWHA 2Y71A 2YVAA 1SUPA 3A6LA 4JI7B 2GGSA 2LDBA 4JELA 1B42A 1PQPA 1WY7A 2B8EA 4Y2HA 5CVVA 4EZIA 5JZVA 2OV8A 5L4NA 2QF7A 1DWPA 1XD8A 4P54A 1J07A 4EYGA 2O19A 1TMOA 2L2QA 5ALVA 1Y4SA 1K7YA 1ZVQA 2XUIA 3AOEA 2ZIEA 5FI5A 1G55A 3WV4A 2ZUTA 2O2XA 4GS5A 3AFNA 2JLVA 2D0PB 2D59A 4X84A 4XPZA 4AIIA 2Q7XA 4LZOA 5LJLA