3PC4A

Full length structure of cystathionine beta-synthase from drosophila in complex with serine
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
504
structure length
504
Chain Sequence
b'YERPADFIDPGKPSKCKWHLGTAEKSPHIHRGIAHRQQITPNILEVIGCTPLVKLNNIPASDGIECEMYAKCEFLNPGGSVKDRIGYRMVQDAEEQGLLKPGYTIIEPTSGNTGIGLAMACAVKGYKCIIVMPEKMSNEKVSALRTLGAKIIRTPTEAAYDSPEGLIYVAQQLQRETPNSIVLDQYRNAGNPLAHYDGTAAEILWQLDNKVDMIVVSAGTAGTISGIGRKIKEQVPSCQIVGVDPYGSILARPAELNKTDVQFYEVEGIGYDFPPTVFDDTVVDVWTKIGDSDCFPMSRRLNAEEGLLCGGSSGGAMHAALEHARKLKKGQRCVVILPDGIRNYMTKFVSDNWMEARNFKEPVNEHGHWWWSLAIAELELPAPPVILKSDATVGEAIALMKKHRVDQLPVVDQDDGSVLGVVGQETLITQIVSMNRQQSDPAIKALNKRVIRLNESEILGKLARVLEVDPSVLILGKNPAGKVELKALATKLDVTTFIAAGKQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CG1753, isoform A
molecule tags Lyase
source organism Drosophila melanogaster
publication title Structural basis for substrate activation and regulation by cystathionine beta-synthase (CBS) domains in cystathionine {beta}-synthase.
pubmed doi rcsb
total genus 183
structure length 504
sequence length 504
ec nomenclature ec 4.2.1.22: Cystathionine beta-synthase.
pdb deposition date 2010-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 3pc4A03
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pc4A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pc4A02
4F4FA 2YZIA 1PVMA 2CLLB 1TZKA 3L6CA 3KXRA 3X43A 1F2DA 2P9MA 3KPCA 1X1QA 2TSYB 3X44A 3L31A 3K2VA 2OOXE 1K3UB 3I8NA 4IYSA 3FGPA 4D9NA 1WBJB 4H27A 1VE5A 3LQNA 4NOCA 1WKVA 4HO1X 4NEGA 1VB3A 4HT3B 2QRCE 1TDJA 2J9XB 4D9IA 1VE1A 2EMQA 1KFBB 2OOYE 1V7CA 2ECOA 2ECQA 3SPXA 4ESYA 2CLOB 2GN0A 2J9ZB 2YVZA 4NU8X 2EGUA 2WSYB 3VBEA 5DW0A 1P5JA 1J0BA 1Y7LA 1J0DA 1O58A 2QREE 2CLIB 4JBLA 3SS9X 2UV6A 1FCJA 4P1OA 1TTQB 3LHHA 2D1FA 5D84A 4D9FA 3VSCA 4AECA 5B1HA 4ZU6X 5K22B 4D97A 3FNAA 1Y5HA 3ORGA 4HG0A 3DDJA 5KS7A 1Z7WA 5IW8A 3AEYA 1TJPB 3OCOA 2UV4A 4D9MA 3KPDA 3L6BA 3PR2B 2RIHA 2QH1A 3IQGX 4XUGB 4Y6GB 5D85A 1D6SA 3SL7A 3RR2A 1UINA 5CGQB 4AIRA 5I6DA 4D96A 1K7XB 4I1YA 5EY5B 5K24C 1PBJA 1J0EA 5DBHX 5B3AA 5I7OA 5B1IA 4GQVA 2CLHB 1OASA 1J0AA 1WDWB 4WX2B 4L27A 4HPJB 3R0ZA 1QOQB 2RC3A 5C3UA 3PC2A 4LMBA 4GQYA 1PWEA 4ESYB 2YVXA 2NYCA 3LV9A 1RQXA 4OFXA 5LXQA 2RKBA 2C2GA 5BW6B 4O9KA 4COOA 4KKXB 3OCMA 1E5XA 2NYEA 4ZQCB 2RHGB 2EFYA 2C2BA 2EF7A 3TE5C 4HN4B 1A5AB 2Q3DA 5JISA 1TTPB 2JC3A 3FHMA 3HF7A 2O2JA 4D92A 1QOPB 4D9GA 4L3VA 1K7FB 2D4ZA 5T6MA 2O16A 2V03A 2ZY9A 1KFCB 2J9YB 3L2BA 5IWCA 2GN1A 2ZPUA 4UUUA 3ZEIA 5IXJA 1M54A 3HMKA 3IQIX 5D86A 3LFZA 1KFEB 3V7NA 3PC3A 5IIPA 1PWHA 2QRDE 2YVYA 3FWRA 3TBHA 1K7EB 2ZR8A 5I7RA 2UV5A 3VSDA 1A5SB 1KFKB 4D9CA 2ISQA 3CEPB 1KFJB 1UIMA 3FV6A 4LI3X 4D8UA 5J5VA 1J0CA 5K25C 4D8WA 4D9BA 3K6EA 1UBSB 4L28A 2CLKB 2DH5A 4PCUA 2GN2A 4P1GA 5J43A 5B53A 4D99A 4D8TA 4IY3A 1C9DB 4OREX 3DWIA 2BHSA 2RIFA 4L0DA 1TZJA 2TYSB 2UV7A 5K23C 2CLFB 2ZSJA 4QYSA 5JJCA 2QR1E 1A50B 3R0XA 3VC3A 1CX9B 4D9EA 5HBGA 1C8VB 4D9KA 2YZQA 2BHTA 2O2EA 5B55A 3PC4A 4LMAA 3KH5A 2QLVC 3OI8A 1O50A 2OUXA 2PFIA 2CLEB 5CVCA 2CLMB 4JBNA 5E0KB 1C29B 3IAUA 4IL5A 3SS7X 5I7HA 1XKFA 4FRYA 3T4NC 3KPBA 1K8XB 5MMZA 1K8ZB 1TZMA 2Q3BA 3BM5A 3GBYA 1TYZA 1FUYB 3IQHX 5DVZA 2PQMA 4ZU1X 3T4PA 5KZMB 4IY4A 1JBQA 1V71A 5DBEX 1WTCA 1V8ZA 5I7AA 4GQWA 4IY0A 4IY2A 1CW2B 3FCAA 3AEXA 4FXSA 1KL7A 3TDHC 5B36A 4DQWA 3VSAA 1BKSB 5KINB 1A5BB 2TRSB 1K8YB 1BEUB 3DWGA 3FWSA 1YAVA 2DH6A 2RH9B 3L6RA 1Z7YA 4HPXB 5DW3A 5D87A 2Q3CA 1TZ2A 5I7WA 3DKIA
chains in the Genus database with same CATH superfamily
5B6JA 3ZKWB 1T2AA 5LLDA 1L3BA 2IA5A 1F2DA 1MAHA 2D5AA 4TV8A 4XDZA 1NFRA 4WVFA 4ZQFA 3RUEA 3VOTA 1O9HA 1DAPA 1QDLB 4RV4A 3VR2A 1FP6A 3N59A 1SM4A 3I8NA 1T3TA 4K1XA 4TTSA 5IP5A 1AZTA 2PBRA 2HLDA 3P27A 1IM2A 1OFIA 1VE9A 1XTUA 3K2QA 3DBHA 4R1LA 5AVYA 1O0CA 1VGVA 3JYLA 3NANA 4EEXA 3PR3A 4TYMA 3SOZA 3JQCA 5JS6A 4YJ3B 4UAGA 4Z9FA 3T95A 4Q4AB 4UNSA 4FFVA 5JW6A 2VJDA 4B9EA 2C92A 4OOEA 9ABPA 5COAA 3SP1A 4MS3B 3KQLA 5IKMA 1AZWA 1UBLS 1GAQA 4E15A 3DEAA 3B3FA 3SC3A 3SZLA 4EDHA 2UZAA 2CKDA 1DEAA 2PQ6A 4IXTA 2B9EA 5KSPA 1K8QA 1ORRA 5KWJA 1QIFA 2J3MA 2WD8A 1P2UA 3P9ZA 3WS7A 2NZJA 3SR4A 3LUPA 5IFLA 1HRDA 2P5YA 3PR2B 3Q12A 4NSNA 2AGVA 1MPTA 3MLEA 1W0JD 1X74A 2ZUUA 2VEDA 3CU5A 4RZIA 4AS3A 3K96A 4D96A 4F60A 3BFXA 2OSVA 2HK6A 1DXHA 1Y9AA 2I4LA 3IE2A 2F9FA 1NBIA 3FN4A 4J1TC 4KIWA 4MS3A 4WH0A 3SD7A 1HQKA 4RMJA 3LX6A 4AG3A 1MO4A 4XVUA 5L6LB 3QBTA 3EQ2A 2EOAA 1F7VA 1TU3A 3OCJA 1Z0UA 3FTQA 4JSYA 2WZQA 3VH1A 3TM5A 3F3MA 4MB0A 1P1IA 4RQUA 4TLCA 1AURA 2W6ZA 1IJEA 3GR6A 3HVIA 5FF9A 4I36A 1ZGAA 3E3OA 4G0MA 1XQYA 3UJ8A 1PNVA 2QIOA 4G37A 1BC5A 4C43A 5JWHA 5TNXA 1D6JA 4MRMA 3LDGA 2PU7A 1U7PA 2FKAA 2OGTA 3BCRA 1ZMTA 2QROA 4K8OA 1RWVA 4PU0A 3OPYA 4B34A 3A32A 2NZ2A 1R8JA 1YJ5A 3HLTA 1F4PA 1U7WA 1TLLA 1Z68A 2JEZA 1H1DA 4C05A 4JIMA 1UWVA 1GIAA 3WBKA 1N9KA 2NU7A 1OPXA 4BMNA 4MCIA 1FFYA 2RHMA 1ZM2A 1XK7A 3KHUA 3HKEB 4K26A 1Q17A 2ERCA 1KQ3A 5C51B 1J5EB 1L7QA 1DBWA 4KJZA 4X7PA 5CFPA 1DAGA 3RG8A 5H68A 3RAGA 3MXOA 3KYDA 3PNBA 3AB8A 1Z4LA 2HMVA 5EE5B 1KY4A 4V38A 2H1VA 1MX5A 2PNFA 1LSSA 1QE5A 4BNZA 3TN7A 5FI0B 1GFSA 3A6FA 2YQ5A 5JCJD 2AB0A 4D2IA 4YCSA 2QUZA 3IBSA 1NYQA 2PFKA 4YV0A 2EG5A 1TJYA 2F1OA 3A3OA 4KB5A 5F5NA 4CN8A 1JKJB 1JBKA 1S2IA 2JJ2D 3TVDA 1JU3A 4R71A 2HOQA 4ZZ0A 3V33A 4QDZA 1ZD9A 2BZ1A 1M73E 1YMUA 2EGGA 2GD0A 3LQ2A 3Q0IA 4NYMR 4FXSA 3DL0A 4KYUA 2HY7A 4BE9A 1VL5A 4FFBA 1ZMXA 4TXNA 3B5EA 5CDHA 5ADHA 2WJYA 5L8VA 1KEEB 3LQKA 1GPMA 1F6BA 1OXKB 3TZEA 1N25A 3SM3A 1XZIA 4GRAA 3ZEAA 4CLOB 3EPLA 4A0HA 1CY4A 3WMGA 1A95A 2YWGA 1SNYA 1CXZA 2BDUA 4GXQA 5U4QA 1J99A 2REQA 1QRDA 4BUZA 4RMNA 1P6QA 2H16A 2VT7A 4ESHA 1UC5B 2D1TA 4E5NA 2QLTA 4RMIA 2FSSA 5AI5A 3EXHA 1KFBB 1V7CA 1X0VA 5FH9A 2OFOA 3TEJA 4BMPB 3TOCA 2H4YA 4KVGA 4AJOA 2Y2VA 3CXUA 4GUDA 1QWOA 3WY9A 3KU4A 4LK2A 3RASA 4AF7A 4IKOA 4BP8A 1LDEA 3KYJB 1W581 4UZFA 4EFDA 2HUPA 2QM0A 3BTVA 1OX4B 4A4DA 2XRZA 2KLHA 3BICA 5B1HA 5A4FS 4PZDA 2W2OA 1VJ5A 3CVXA 5KTNA 1C9YA 1DDGA 1DRJA 1H42A 2ZIZA 4ZI7B 3UAXA 1Z8DA 4OBEA 3LUFA 4FWTA 3WBFA 4JR1A 4JR2A 3JPWA 1FU8A 2QDKA 5DCYA 2RMKA 3PD1A 1PSZA 4WMLA 3LPAA 1U2ZA 1A9SA 2Q0QA 5EKSA 4DSUA 1N0VC 4KXQA 5B64A 2Q1TA 3FCEA 2J08A 3JD3A 3QJ5A 1TJ5A 1ZNZA 3FPKA 3MMXA 5HKOA 3MRVA 5DX0A 3RWBA 5ERXA 3WAKA 1I2CA 1K1EA 2NUBA 3IJEB 5AXDA 2N46A 3L07A 4R7GA 3WK8A 2VWHA 5B3LA 1ZRNA 3CRNA 1WZIA 4FEEA 4ICIA 4L5JA 4PZ9A 2J32A 2EZ9A 5DSTA 2PMBA 1GYQA 3QXHA 4TS3A 3DDUA 3X1YA 4F3RA 1USVA 3BTOA 1YTUA 5CK4A 4F93B 2QL9A 1R0RE 1VL1A 2MMGA 3P9KA 1U2GA 4YV1A 2ZUBA 3OJCA 4URUR 4Z2YA 2GF9A 3Q1LA 4ZVPA 4TL8A 3IB6A 3VR1A 5WRFA 2I7VA 3HWRA 2YWXA 2VH1A 2XDQB 4RK6A 3A36A 2BJVA 3QKRB 5AKYA 3QXGA 2ZWPA 1J0CA 1IPFA 1NBME 3NATA 4FZ5A 4MI1A 1GNSA 5ERGB 3V7FA 5ADWA 2X9QA 4AJEA 5BN4A 3LFTA 1NXSA 3L4BA 1S01A 2HWKA 5DOVA 3SC4A 3KB1A 4RLQA 1PL7A 2B4QA 4WZBE 3W9UA 4L0DA 1AU9A 2PT9A 3RADC 4GSLA 4LY3A 3FCUB 2Q29A 1XJ0A 3G02A 4TKMA 3RYIA 1M2NA 4HATA 5CCDA 5J5CA 3FTEA 3BK1A 3F6EX 2ZSKA 5LWQA 1RZRD 4U7PB 1D0SA 2CMFA 4UDYX 1DRKA 1F17A 1C0IA 5H3LA 1KVQA 4DIEA 2CDBA 2IW1A 3FDFA 1IN7A 4OMFG 2ZSBA 5F7OA 3T4PA 3SSNA 2FMFA 4NU5A 2FR8C 1GA1A 4EHKA 3MUNA 1ZVVA 3V34A 5LZ8A 4LRXA 3GQVA 3S29A 1NGSA 3GGOA 3OF3A 4PG4A 4WERA 3UHFA 3FNHA 3N2EA 4O0LA 4OLAA 1LC3A 5KMGB 4B7XA 4OKNA 2OHIA 2I22A 2CVPA 3F3KA 4BLQA 5KNLA 4LJ9A 3GDWA 2I4NA 3T3PB 4OJNA 2NSLA 4XDGA 3AC0A 1E6UA 3KPCA 3N8HA 4ZZ2A 5JEDA 1UBOS 2F17A 3NBYC 3CPJB 4L4SA 4NV1A 4BMSA 4DFDA 1SRQA 4HVCA 1REQB 2XMZA 5IYZB 2G9QA 2BFCA 3CZAA 4IS2A 4AURA 3GN1A 3OJLA 1ZNXA 3HEBA 3FH0A 4LBYA 4P1ZA 2OXFA 1EE9A 1B0ZA 2WPDD 2XCUA 5D7NA 3FOZA 1J9GA 3ZWPA 3OHMA 1OZFA 3LXUX 4LXXA 1GTG1 2HHJA 1SC1A 3KQPA 1KC3A 2JLWA 1DC6A 3FKJA 1UPBA 4GDMA 2WY2D 4DCVA 1VLLA 4TS9A 1XN4A 2BI8A 1TA9A 2MYNA 3HH8A 1FFCA 1ZVQA 4Y6SA 2WTAA 1YMQA 1Y8CA 5CG1A 3W5BA 5IKOA 2W43A 3LAWA 5DMXA 2HJGA 5AP9A 1GCAA 4QYXA 4C0JA 1HTBA 1MG5A 1ADYA 1TUBA 1SUBA 1V47A 1XXHE 1YMVA 3MBKA 3KPDA 5DB4A 1G66A 1VC2A 3E61A 5KEIA 4OO3A 5JNWA 2JD1A 2WTBA 1P0QA 5BSWA 2P3OA 3LJKA 1E89A 1DKOA 3UMCA 6ADHA 1K7SN 1IXZA 3WJ1A 2Y8EA 4MS4B 3FKSD 4JT9A 4TYPA 4GI5A 3TKAA 3Q7IA 3RBVA 1RWXA 2KX7A 5JXHA 5LDDC 3LP5A 5GVSA 1SVUA 3A2NA 3DAFA 4P3PA 5LMCA 2NZVG 3L0CA 2QMEA 1BTOA 1N7IA 4Z7QB 2A58A 1KPGA 3RUDA 3HL4A 1HT0A 2ZJ8A 3GMTA 4DY6A 4CQMB 4GPD1 2P1ZA 1C50A 1WUKS 4A5OA 2GHIA 1V0JA 5HRUA 4EMUA 1R4MB 2X0EA 4D98A 3NIFB 5JJLA 4B40A 1PR2A 1W0KA 5T6MA 3ND6A 1B6SA 3KJQA 4N4AA 5DV9A 4RO0A 5BVHA 5KKCA 3HCNA 2CXPA 4Y2GA 5F23A 2ZIFA 3KHSA 4F3TA 1AK2A 4KXWA 4KHZA 1OIWA 1E9CA 1JNYA 1E9FA 1DC7A 3LXMA 3LTEA 3LX4A 1UKBA 4JP8A 4YYZA 2P11A 3A6EA 4IXNA 3LXRA 4R8SA 4YDQA 4DQDA 4B2PA 2F3TA 3CT4A 1ONBA 5HILA 4EHIA 4D8TA 1L1QA 1PKEA 4FFBB 3D6VA 4NOKA 4EFKA 2BKVA 4EHDA 5JJCA 5LJIA 1D2AA 1DPFA 2GSDA 2BFFA 1W4LA 2BKLA 2C0PA 2J85A 2GMWA 3AR7A 4TZKA 1NRIA 3P0EA 2WU4A 2ZI3A 3FSGA 4KK4A 3VR0A 4CYMA 1QM5A 1R4MA 4G41A 1JAIA 1YE3A 3VX3A 2FRDA 2VF8A 2WU1A 1O50A 5BO5A 1P1JA 4BBPA 3AEUB 3SKVA 5LFAA 5BRJA 4OL9A 2X23A 3HZRA 4HRVA 4RIHA 1JHPA 1EGVB 1QGED 4CUZA 5D1NA 1J2EA 3K6SB 4XUCA 1MZPA 4B84A 3V4FA 2PUGA 1JXQA 1XPRA 1F2VA 2IU3A 4QPDA 3HXQA 3LCVB 4EG7A 4EO4A 4MV6A 1S8NA 1EFRA 1CR4A 3E3AA 4B46A 4YPFA 1IHYA 4O4LB 3FJOA 1BHSA 4R9VA 1LDGA 7ADHA 1EDOA 4PC1A 1YI8A 1JWAB 2DXIA 5FOWA 3ZWCA 1E61A 4MZDA 3SN6A 3BK7A 1YZHA 4PBTA 1F3OA 3QKWA 4IIVA 5C34B 3JVEA 3JQ9A 3F8WA 5CDGA 3TLMA 2QA5A 3GVPA 4QTUB 4E7PA 1S96A 3I52A 3GFPA 3LCJA 1AN0A 4XQCA 1OZ0A 3T7TA 1G4AE 2C88A 1KXZA 1NWCA 3CZQA 2B9VA 1LBTA 1R4NA 3CKLA 1WF6A 1UPXA 1N5LA 3E0XA 3I8OA 4DQKA 3LQ1A 3GG2A 2P65A 2Y3IA 2C2MA 4FBGA 4CF6A 3EGDB 3D5QA 4JR0A 3ONWA 4ODIA 5DHTA 2VUSA 2ZB8A 3OQ6A 2PXCA 2GN0A 1GAXA 1NASA 4BFLA 2E4YA 3EDRA 4R0MA 1N2CB 3U3XA 5BSRA 5BVGA 4DDWA 3UB4A 4QLOA 4NJMB 2D2IA 4FZVA 3A1VA 4JP3A 1OZAA 1SU8A 1MB4A 1XRMA 2VHVA 1RMTA 2YNMD 1G7TA 2GCPA 3OLZA 4WOCA 3CB4A 2AC4A 2DKFA 3VGPA 1CJVC 2B0JA 2XHEA 3SHOA 1MABB 1JKJA 4C0LA 5ALNA 4D9JA 5JCJA 4O3MA 1GD1O 1CIJA 1GJRA 1ZRHA 3VAYA 4D9MA 2KSQA 4JMPA 3EW7A 1T8YA 5F7JA 2HF2A 3HB9A 1TEXA 4ZCSA 1V3UA 1SHTX 3NYIA 4XVRA 2RGRA 5AW2A 1E94E 3K9HA 1UWCA 3GUUA 4Q1EA 3R77A 3GLQA 1LUAA 5CJ2A 5AVXA 2OOKA 3PGKA 5JSHA 2V7QA 3RROA 1YS7A 1G98A 1N2ZA 3HE3A 5HTKA 2Y1DA 3A6KA 3I58A 3V4SA 1BOFA 1JR2A 4DGSA 4ZI2A 2WTUA 1RLIA 3PJFA 2BFAA 4BEVA 1EDZA 4HUTA 1ECFA 3DB2A 3DBOB 4RVNA 4JOSA 1V5FA 3DF9A 3SJCA 4HWTA 4OQYA 4ER3A 1LA2A 2DPMA 4J0IA 4KYIB 5DI9A 3T3EA 4YA6A 4CTJA 1IBLB 2WWHA 1L7OA 2A3RA 1JJIA 3HVUA 3IBTA 4NEHB 3D0RA 5K5EA 1P17A 3KKLA 2H5LA 3PGVA 2PCJA 5CXSA 2P62A 3T7AA 4KSYA 2BBSA 1DIBA 3SYRA 3HGMA 4Z3DA 1YQUA 2BMDA 1ODIA 2GYVA 3EYAA 1ZICA 5FWDA 1S8FA 4OLFA 2VPXA 3OECA 4KP7A 4QQRA 4FGSA 4F04A 3TECE 4EMBA 4X1YA 1EWYA 1T2EA 1WMEA 5BUSA 5FP0A 4A2QA 4GMFA 3ROZA 4F4HA 5JZMA 5LN1A 2V6GA 3SXUB 1MV8A 1G1AA 2JJ1D 2IU4A 3S4YA 1CY0A 1PS9A 1ZS9A 4TWJA 4BQEA 5FWXA 1EFPA 2YMPA 3CW8X 4PBSA 5CEFA 3DONA 1M72A 2EX0A 2AJ8A 2VQ3A 5ALXA 3FB4A 1JQBA 4ZDIA 1YZLA 3QU9A 3RFVA 5JDCA 4LW8A 1F2UB 5C7LO 2C9DA 4R01A 4TMTA 1Z17A 3RVBA 1XRPA 2WHPB 3DE3X 5JARA 2FY8A 2ZM5A 3E05A 4KO2S 1U04A 2O5RA 4U63A 3ZV6A 5EWLB 3BEDA 2YV4A 3DLPX 4WY8A 2O1EA 1FQOA 3GFFA 4FFMA 1RRCA 5CH3A 2W6IA 1QF7A 4OI4A 1C5KA 2IUFA 2VPIA 2YXDA 3QX9A 5AUQA 5LR6A 5I4BA 2APJA 4NS4A 4TMWA 4PQGA 3ETHA 1N0WA 3JWHA 4J3FA 2FZGA 4KRYA 3CO5A 2XVYA 4BX3A 2H3EA 1XV5A 3VVMA 5A2QA 4QHTA 5HIKA 4R0VA 3N7AA 4NU0A 4HVLA 3RTGA 4EPXA 1TZKA 4LE0A 2OAQ1 3OZBA 1DKLA 1Z33A 1X77A 4I14A 4G5RA 2Z3ZA 3X44A 4LHVA 4KR9A 2FMTA 2VSXA 4WKGA 5CA0A 1T26A 4A23A 3VO8A 2FN8A 2ZULA 2GYWA 1V5WA 2ODBA 4PTZA 4R9SA 4ALNA 1MT3A 2HWYA 2WLTA 5FT9A 5ITZA 3M6LA 1IUKA 1ZVJA 3DAGA 4KMRA 4PQEA 3PNSA 1O2DA 3VU9B 4G67A 4BNDB 3LGAA 3GW8A 2UXDB 2Z95A 2H0AA 2EW2A 1RBZA 1TAUA 2J9FA 2GFQA 1EXVA 1K66A 2ODWA 4KGVA 5H80A 4D9FA 3HCWA 3NP7A 1V35A 2GBGA 3K5WA 4HRYA 1I2ZA 1VSTA 4EKNB 4MPDA 1U5AA 3ZY4A 4Q4CA 1OWNA 4GDFA 4KR6A 2EZTA 5AI4A 1I94B 3AEZA 1A98A 1HTWA 1NVFA 3AIIA 4J7UA 4OSEA 1GFZA 4WN9B 3AJRA 3RABA 3QUQA 2QGFA 2RGUA 3K2IA 3P2OA 1PBTA 1STOA 2XUDA 2FPXA 2QD5A 2WWFA 4DR2B 2V58A 3CYFA 4MX8A 3WWEA 1DJMA 5JROA 1U8FO 3RUFA 5CIQA 2J33A 3QUAA 1V9CA 2AL7A 2ZIWB 1KBOA 4NBRA 5DBOA 1ISMA 4KKXB 4MKZA 2IV2X 1RXWA 3B20A 1K6IA 4L5BA 1LZKA 3KDAA 2B5WA 3TMAA 1YZFA 3EXEB 1A77A 3I4CA 4QFBA 3H99A 4DMKA 1B16A 5DTMA 4C6RA 3U7FB 2QSJA 3LL7A 4RDHA 4KH1A 3FHMA 3FFTA 1DO8A 1L4UA 4NK4A 4Q3AA 3TAHA 4OXXA 4DILA 3U4MA 3GZNA 2R8BA 1XVIA 4KQMA 3AKCA 3E22A 4U6NA 2J9YB 4ML3A 5EAIA 3S68A 3SX4A 3TJRA 3O8CA 5DM0A 4LGVA 1UP6A 4BQIA 4FU0A 3TIIA 1W5EA 1P9NA 2CMDA 4UMFA 4XFJA 3U3RA 1YDGA 4DB4A 2VPPA 1YS9A 3KPUA 4NJEB 1YNSA 1AV6A 2Z9BA 2XA9A 4FX5A 1CRLA 2P6UA 4GVPA 3MS7A 2QQFA 4UU1A 3TO5A 3T5GA 3SJAA 3AUTA 1L5RA 4Z1MD 3WIUA 2C4HA 3FDJA 3MHPA 1RRFA 3WDKA 5FBQB 4N0EA 4D99A 2IHUA 2UUOA 5K0LA 2BR5A 3E5RA 1G21E 3W6UA 3UWOA 5BW8A 1C0KA 3O8OA 3B52X 1VCHA 1XK6A 1GEEA 1L4HA 4YAKA 1AK9A 5LQUA 3NVKI 4MW7A 3A4MA 4I1IA 3QUCA 5LMNB 2RARA 3PLAE 4BFXA 2FB9A 1E2KA 4JC5A 4LMAA 4HS4A 1ENZA 5BN5A 3HBNA 1YZVA 3PENA 5I8ZA 3S2EA 1EK2A 4LXUA 4MYRA 2JGNA 2RBEA 1NBMA 1VTKA 3NDRA 1JJAA 1PFVA 5ULLA 2W2LD 1VKOA 3OZEA 4LFBB 4BNYA 5C5DA 5AK4A 1P7CA 3NDPA 4BN0A 2QTWB 1E3WA 2X1VA 1R5NA 1V8ZA 3CV3A 3F5QA 3KZKA 4XWKA 2WVHA 4HWOA 4PINA 1SVNA 1M74A 2P2GA 2DUWA 5JFOA 3OOEA 1G9SA 1A97A 1DDOA 1Y0BA 2BKEA 2EP8A 1YUBA 3NBAA 3GUCA 4HNRA 2GA8A 1KR2A 2HLDD 4DCTA 1PVMA 2D5CA 1P2FA 1OXMA 2E37A 4JQYA 4MR7B 2DFLA 2WWYA 4G5YA 5JBNA 1W6RA 5NLLA 4MA4A 2PS3A 5LXTB 3BRQA 3USCS 3N8DA 4TZTA 1U0GA 1TLTA 4W9NC 4MAFA 2J87A 4DIBA 3VDXA 3RT7A 3K71B 5FA8A 4RIEA 3K5HA 2J6CA 3E15A 2O0KA 2C9MA 1FNDA 1UWLA 1UBNA 2H92A 4WSOA 1PGPA 3AKEA 3N2KA 2YY6A 1RU3A 5E9WA 1WDLA 3R5JA 4IJMA 3E9CA 1YCDA 1CFJA 1ETHA 1GFIA 1OILA 1RQ7A 2ZROA 3AJ9A 3AP1A 3DVRX 1BXGB 2KB0A 4KG7A 4RZ2A 4WK0B 4YUVA 1PJTA 4QXOA 3NOXA 4EB8A 4JQZA 3N8GA 3Q0TA 4J1QA 4KQXA 3T8YA 3O4RA 2J67A 5HZGA 4U39A 1LU9A 1B15A 5GOTA 3TK1A 1NUPA 2C2KA 2AR9A 2I4IA 1YR8A 4RZUA 3QF4A 4DMRA 1KEEA 3DO8A 4XVQA 4GYKA 2BY4A 3ZXSA 2NQ2C 1MAWA 2PGAA 3MUOA 1I1QB 3NP9A 3IOMA 3TTVA 3V8NA 4J0JA 2W22A 2EYUA 3UG7A 4C2BA 3JALB 4S1TA 2ID9A 2M2IA 1L1FA 1QU3A 1HZJA 4V1CB 2O9JA 4MPTA 2O7QA 1N7JA 1YIAA 4ISBA 4DMUB 1K68A 3COYA 2WTXA 2EBUA 4N82A 1PBNA 2ZRLA 1X9IA 3GV0A 3ZHRA 4JQCA 1Z22A 2G9NA 1EP2B 1SBCA 2HXSA 5B3JC 2K4MA 5EVJA 2YX1A 1JEOA 3ZE2B 3DPSA 2QD3A 3JVIA 5KTKA 1W1IA 1IQ0A 5LA6F 3EWSA 4LWOA 5D5HA 2PUTA 3KYIB 4AJPA 4CTKA 2PUVA 3N28A 4ZCIA 3OIYA 3N2IA 1FOEB 4G26A 3KXDA 3DLTA 4UEJA 2Y0BA 4GPEA 1C3OA 1R4AA 1LDMA 2X5OA 4GWKA 4RK4A 5K99A 3I1IA 3HEMA 3WWDA 2WWIA 2ZCJA 1G63A 1X1BA 3O47A 4BX9A 3RBZA 2ZATA 4GC9A 1WB6A 1RWKA 3NV7A 1MVNA 1YASA 2EW8A 3LT2A 1SGWA 5B4VA 5JH7F 2PX2A 1WUTA 1TZJA 4FYIA 1VBFA 3EXFB 5FQOA 5JNLA 3AJDA 5C5CA 3A11A 4AZ0A 2BAGA 4BVAA 3CLRD 1QVWA 1V45E 3B6MA 1BGWA 1WMSA 5EJ7A 2BPOA 3KWFA 2MCFA 5CVCA 1KJNA 3PDHA 5IJWA 5DGHA 4IRXA 1K4KA 4Q34A 4QVGA 3GLFE 3O90A 4XM0A 2RB4A 3IPRA 5CAEB 1WQ1R 3IT0A 1DVRA 5DTQA 5CB4B 1HYGA 3IQHX 1O97C 3SDSA 5JRJA 1N7HA 1IZ7A 1TT5A 3L43A 1MHTA 3KOWA 1QHYA 1N9ZA 13PKA 2HIMA 3H4IA 5FUYA 2DQZA 3WB9A 1NBWB 4Z8XA 2ZR7A 1TCAA 1IC6A 2J9FB 3F5FA 4HNVA 5HZHA 3L1HA 1G42A 1ZJ6A 1M6EX 3RODA 2H29A 1BS9A 3EVFA 4R81A 5LKAA 1MFZA 4H0CA 1J8FA 4O4IB 2OHXA 3U31A 3C7AA 5FBHA 5T6BA 3R76A 3VNBA 4P9NA 3X43A 4Z2AA 4BU0A 4E1BA 4WZBB 1NVDA 4GR9A 4XVCA 3W9SA 2LPMA 4G5OA 1FLVA 3HKBA 1VG8A 3TRKA 2RG1A 2Z2XA 1OOEA 3P71T 1U7ZA 1YUNA 1VGRA 3NGMA 4H1TA 4LKOA 4LSWA 3REOA 1C9EA 1A76A 3ABQB 3BL6A 3BGIA 3EXIB 3F1KA 4DLRA 5IWAB 1KBQA 5D6OA 1W5TA 4JU8A 5A4DA 3QLVC 3N6VA 1WU8A 3FNIA 5ELLA 3UK2A 4GMKA 4RBNA 4ZDKA 3QLTA 4EGFA 4QZVA 3A4TA 1DWPA 4DV5B 3L6OO 3AY7A 5K03A 3LY7A 1KOFA 2QUJA 4GWGA 1IMJA 4PVCA 1RVV1 1WBDA 4GI3A 1MA3A 2G25A 1WEKA 2C1EA 2IZ7A 2WZCA 4FD3A 2VAXA 4LNAA 4WOBA 5E7QA 1SZDA 1Z15A 2WBLC 3EJWA 4RXMA 5CYPA 4IV8A 3BAFA 5JT1A 4JQOA 1ZH8A 4GKJB 2ZSFA 3WGHA 4PNEA 1OC4A 4PC2A 2AWOA 2WJGA 2Q9AA 3UJDA 2BONA 4WRRA 4YDRA 3P94A 3BCSA 5GY7A 4AF8A 5C3MA 2FW0A 2ZR9A 1PFQA 3KZ1E 1JG4A 4BU1A 4S3MA 1ANKA 2W6QA 1UJ2A 3I9JA 4E5UA 3FIUA 2HF8A 3H1GA 1C4WA 3GJ4A 5E4JA 3PNQA 5LQNA 2XZTA 3NC1C 3D3WA 1AO3A 3ZY5A 4BMDA 5KYYA 2Z57A 3IIIA 1KIFA 3MJCA 4M9CA 5DZSA 2WTMA 1THTA 4D0GA 1OF1A 1JFTA 5AKZA 2XA2A 1G6Q1 4GFDA 2ZFUA 2XMSA 3FHTA 4Z4QA 3IPLA 2ZB7A 1QGUB 2QNRA 2YFQA 2ATVA 2CXQA 3CNLA 4H6VA 1V11B 2B99A 3GUYA 1ZP6A 4V0NA 2XMCA 4Q9KA 1P80A 4N0QA 1QTIA 3KZXA 2FSFA 1O96B 4JA0A 4BZPA 5F3RA 4BWGA 1X1CA 3CZ4A 4YGXB 2EZUA 4B3SB 3CIOA 1SCUA 1BOOA 3DC7A 3KCNA 3ORRA 4GZMA 4N3BA 2ID7A 1CZOA 2C31A 3T0IA 2NPOA 4H1WA 3ILHA 3OO1A 1L8LA 1KOJA 3SBEA 5EUCA 5EJ6A 1Y3CE 5FI3A 3WLJA 4PLZA 4CNBA 1US8B 1XRNA 1C1DB 3GPBA 5DHQA 1U81A 2PH5A 3NWOA 5JCOA 3ETLA 2YV3A 2IBSA 1LBIA 3NPMA 3D6TB 1ETUA 5DT2A 2CFIA 3JQ6A 5K4AA 2ZI7A 1EVJA 4P22A 4Q0MA 3B7PA 5ES4B 1C0PA 3E7PA 3UAYA 3G0GA 2PWAA 1GGKA 3ROEA 4AJNA 3M4JA 1I3LA 4H31A 3I5AA 2BUBA 1N5DA 2A0KA 4OQEA 2YWRA 4S1WA 4ZDJA 1NV9A 3JASB 3H2YA 2AG6A 3QVWA 2NZXA 4L2IB 3NCHA 5AKHA 4KWHA 3HJHA 3PSHA 5H3CA 3WGIA 3GT7A 1VIMA 3UO8B 5TPWB 5AHWA 3VSAA 2ZAOA 2GM4A 4R2KA 1LRJA 3MMNA 3C3YA 2H4ZA 2DH6A 2G9RA 4Y9RA 4WASA 4AULA 4ZTZB 3S1LA 4EG5A 1ZM9A 1H1LB 5IBRA 2J9GA 2IBMA 4XWGA 5K8TA 3OSZA 1QH9A 3H1AA 3KG2A 4I08A 4PC6A 4WXRA 4OF4A 2A9PA 1JFLA 2XRMA 4R3NA 2QUHA 5HF9A 1G20A 5C8YB 1HSZA 4UUAA 1THGA 2ESRA 3ML1A 3PEFA 3STYA 4F9FA 4EA8A 5KVCA 2KHZA 5L51A 2VFAA 4UOZA 4QYIA 2JIZA 2IYUA 4Y2TA 3TCNA 2IHNA 2WG0A 2NAPA 3NHRA 1DEXA 3BIXA 4FMBB 4AZVA 2BGLA 2ZUVA 2BEJA 3NGXA 1WO8A 5LD2B 1Y3FE 2JIRA 2C4NA 2CXTA 2FWNA 4PXSA 3N9IA 3B1YA 4N12A 1VI2A 4OUDA 3SYKA 4INZA 2E87A 2ODPA 4NHOA 4AZSA 4MVJP 5KS7A 2CF5A 4L4UA 3EC7A 5EIHA 2H85A 4BLOA 4TMVA 4DLLA 3WMXA 2VBGA 3LS2A 4YJ2F 4UFPA 2O8FB 3OFND 1M34A 4FFDA 4JLJA 3CF6R 1TGVA 7YASA 1F0PA 1QHHA 1YJCA 4CUKA 3OTGA 1QJCA 4YP1A 1BQ3A 4FCVA 2C8JA 3ZTYA 4FDVA 4JJEA 4NWIA 2PZFA 1JQ3A 1RLUA 2YIDA 1UPTA 4M22A 4UTZA 3V8QA 2OORA 3II6X 1EEHA 2GARA 3Q6NA 4IHJB 4YJKA 3SBDA 4I1OA 4CHGA 4URWR 1W0KD 4N7JA 3U16A 1TCUA 2H5EA 3BE5A 4TTAA 4MARA 4ZARA 4FOOA 5F21A 2Q4RA 3CPEA 2AXPA 4EGCB 4EYQA 3CCFA 4IDAA 2Q1UA 2GQ0A 1W36C 2BE9A 2HBZA 4XI9A 3GHHA 1UDRA 3FUWA 5G1OA 2AJDA 3ZV3A 4PYQA 3WGUA 4LHSA 4DIOA 2E55A 3INRA 5J2TF 1BN6A 1NULA 3WYNA 4AMVA 5LQAA 5JH7B 4DM3A 2HK7A 5LOVB 4TTTS 4TS1A 2GFHA 4TMXA 4GXRA 4N8EA 2OV4A 1FNCA 5EIEA 2XUFA 4IV5A 4L8GA 2FSHA 5FR1A 2EIXA 1MMFB 2SKEA 2BEKA 3BSSA 1JX6A 1P5HA 3R5KA 4EABA 1N92A 1UXJA 2AV6A 2QAGC 2RHBA 2RIFA 3NG1A 5JAIA 1XDGA 1GSAA 1L5YA 1P5ZB 2IXDA 2I03A 4X1KB 1NJ6A 1Y1TA 1YS4A 4GGOA 4EJSB 2ZSAA 1Y8QB 1KAOA 3T5DA 3RC3A 4MK4A 3QX8A 3T9EA 2BFNA 1E0AA 5KSYA 1WXDA 3AVTA 2YMQA 1USWA 2BEUB 2FRXA 5L7TA 2VSYA 3C1AA 5LZ2A 3FVTA 4NCJA 1JSRA 1XZDA 2JGIA 4Q12A 5DVZA 3GUZA 3EVGA 3A9RA 4BGEA 5EZSA 1R8XA 4YJFA 3SU8A 4KQFA 8OHMA 4WE3A 5JC1A 3HGQA 1T3ZA 5DXAA 5K6AC 1EJ2A 2FP4B 2OY0A 2WF8A 1UC8A 3HRHA 1ZJWA 1BKSB 1QPGA 2O8EB 3EHEA 1Y3HA 4MHOA 1Y6FA 3IOCA 521PA 4EQZA 4GI7A 4PHTA 4HCJA 4V03A 4ARVA 2QVZX 1R0LA 2AG5A 1WOYA 4GD3Q 4PLPA 3C85A 3EF3A 2E49A 3NNDA 2PFSA 3STXA 3M5CA 5A9SB 2J3KA 1YZNA 4P4GA 1FFXA 1UF9A 3C16C 3V2HA 1POXA 3W8NA 3PV0A 5JDIC 3LUDA 4UUBA 3OQMA 1B8VA 1VHWA 2XVMA 4L8LA 4NJOA 4YRBA 2R8EA 1ICEA 4N3AA 3EA5A 1CHNA 3EIQA 3R7SA 3R7NA 3GRYA 2JIOA 2UZIR 2JLSA 3BXGA 3QPVA 5FLKA 2JZCA 2IUSA 4X9XA 4RYLA 2AF4C 4EG1A 4O4HB 3JCZA 4ZANA 3SFZA 1ESZA 3A26A 1Z0AA 2Z4RA 1B3RA 3AW8A 2R6ZA 1C4OA 4DV4B 3RREA 4I6EA 3ZI0A 1HI9A 3AP2A 1MF7A 5JVDB 4GBMA 3W3AA 4J6EA 3AONB 1CTQA 4RPLA 3GRPA 1TYDE 1WHSB 4KQJA 4W5RA 1GL6A 3GDFA 4OM7A 1NUUA 5A0FA 4JEMA 3UKOA 1G3UA 1RP7A 4GSYA 4BVEA 4B4VA 1RAAA 1P8JA 5BN3B 3KZOA 1T15A 2JD2A 3Q2OA 4ONEA 3WZ2A 4L9WA 1XO1A 2J09A 3MTDA 4RK0A 5EJEA 1E77A 2PNJA 5FTJA 3W7AA 3H2GA 1R8QA 4RDIA 4D43A 2AZMA 4OJQA 3KOOA 3KHTA 4O4JA 5E95A 4TMYA 1SWWA 1SXQA 1CUBA 3K3PA 5LP6B 3CMCO 2VXYA 2R6R1 1K2VN 4EYOA 4F21A 5TDHA 3MCVA 1NV8A 4OQZA 2OXIA 3I6QA 2P77A 4TYWA 3RS0A 3JWIA 2RGNC 1D1QA 1JQDA 4GAEA 4N5MA 1IDOA 1XQWA 1K3FA 1PDWA 1BQ4A 5SY9A 1E1RD 2MYUA 1IWBB 3OM8A 1JZQA 3R74A 3ZHCA 1GXSB 1H2BA 1SXJD 3CZRA 3I0MA 5FWXB 3TWOA 4C29A 3FXAA 1TTTA 3DBRB 3GJ7A 1ZHFA 4KPUB 2AOUB 4ALIA 3ERCA 2VOEA 2TMDA 1JYFA 2D5LA 3NQ41 4CEHB 4HJXA 5K0CA 5KC8A 1Z5PA 4ETIA 5HOQA 2A5JA 2WYOA 4DBLE 1DIAA 5K25C 4P2GA 5EPOA 2QW8A 1JS1X 2OYCA 3VZQA 1FYWA 3P32A 2H2WA 1H6CA 1R2QA 3L9XA 5DNDA 5ICFA 1TLFA 2Q62A 3W6NA 3GL9A 2Q4BA 1I5OA 1R6XA 2ZSEA 5JCZA 3DYVA 3UHPA 1PLKA 3ETDA 3QXJA 5L3ZA 5BWMA 2ERXA 4BJ3A 1I0ZA 1EM8A 3JZIA 1F4VA 5A7GA 5ARBA 2L2QA 2ZTUA 4OEHA 4NBUA 2LCQA 3RFUA 3RR2A 2GB4A 1PTJC 3ACCA 3DDWA 2DCUA 3TZHA 2CDRA 4EX7A 1GNTA 3NHLA 3WICA 2DPGA 1WRBA 3E7DA 4I9HA 4OHBA 5PNTA 1M1XB 3TDMA 3V8EA 5F3WB 1E2PA 4PRKA 5B4TA 1EGQA 2NPIA 4IWXA 5IDYA 3HV2A 4FVTA 2RHCA 5JC8A 4OQPA 1Z8FA 4ZIRB 2NP6A 1DBRA 3OETA 4IJWA 4ZCPA 3ZBTA 1NW4A 1M8GA 1UXGA 5AMXA 4EK9A 1MDBA 3D6AA 3VAAA 1FYVA 4YT8A 4DB2A 4O2BF 2DBRA 4J75A 4AECA 5A06A 4FXPA 3ONVA 1XE3A 2XZDA 3RB8A 1RYHA 2HGSA 2XUHA 3WIBA 2A59A 4NMLA 4YTEA 5AXAA 1H3EA 3L0IB 2OE2A 3COSA 3BJMA 3CF0A 2AG0A 2RGXA 1ZOOA 4JX9A 1MP0A 1NRJB 2NSJA 4Z7NB 1AS2A 2VLBA 3C1TA 5L95A 3W1VA 3LPDA 5AHKA 2QYOA 4RJTA 3P9SA 5IASA 4NXNB 2PEZA 3DLIA 3P7MA 1V7PC 5DU2A 1O58A 2ACKA 2JLRA 2DWCA 1TVKA 4G23A 5A4IS 4EA9A 4RTKA 1KZ7B 2A33A 4MUNA 3V1UA 4ARAA 2DFVA 2WHPA 4F86A 1QO7A 5IANA 5AIBA 2YJ6A 5JNVA 2Z8XA 3CRRA 2FDRA 4DS3A 4MKXA 3OD5A 1AKQA 4Y98A 3WK7A 4UOQA 1UINA 3SQNA 1NUHA 2WE8A 2WV7A 3Q5DA 3RSLA 2B30A 1XDUA 1X1EA 4Q00A 1V41E 1J33A 1RZVA 2JFGA 4JNKA 1NI4B 2PU5A 5C5IA 1S3GA 4BMZA 4UASA 4AY4A 2GPYA 3L0DA 3QSGA 1X7ZB 4I3FA 4JEIA 4YP7A 5E9JA 2NT3A 4FDAA 5D1HA 1YRWA 3DMNA 1UAAA 1YULA 2J45A 2YN0A 3ND9A 4JLMA 4BQFA 1QZXA 3PUIA 3LLVA 3BERA 3ESDA 1YSCA 4HLUC 4TS4A 4WAUA 3ILXA 2C00A 4NOLA 4WGFA 3DYBA 4RKQA 3HHEA 5FTLA 3S6JA 1W7AA 5C35A 2E9SA 1P0CA 1Z6PA 4MLDA 3GT3A 3RV4A 4CDNA 1A4XA 4JHLA 2G83A 1XPJA 4X1IA 2EG9A 4AN1A 1EBUA 1ZNQO 1HFKA 2D1RA 2N42A 4FBMA 2Y1WA 5CLQA 3ZE7A 1S9HA 1U2QA 4RVGA 1OZGA 3GEIA 3LMKA 3WQHA 5DFAA 3GCZA 4O1IA 4AO7A 4KQHA 1GU7A 1LV7A 1VYTA 3DEKA 3ZDEA 5AVOA 5L3QB 3I73A 4PY2A 5J43A 2ZUCA 4JUBA 3QTBA 5HJEA 1SCNE 1ZI6A 2A5LA 3QBJA 3P9PA 5ALWA 1S4MA 2JK1A 3PJEA 3EE6A 4HNUA 2BHSA 2G72A 1YONA 3LT4A 3VSBA 1MT0A 1WOMA 4X71A 1Z56C 1X6VA 1YB1A 3M4ZA 2ZJ6A 1YQTA 1XL0A 3QMWA 3BH6A 1UBEA 5CBPB 3JRNA 1MB3A 3DMDA 4CODB 3OI8A 1CUVA 1YS2X 1KJQA 2IP2A 1I6KA 4HQKA 1BE8A 3WGJA 1M2OA 5MHTA 4FOTA 5E0OA 5C53B 3AETA 4JITA 4YRRA 1KYIA 3A9SA 2C9YA 4L07A 1KI8A 1H0SA 1HA3A 2CB0A 2PRYA 4EMTA 2ZBRA 1Z7EA 3TTUA 5K8JB 4PIMA 1SIBE 1BVRA 4A36A 3MNFA 3U49A 1PR6A 1HDZA 5HWSA 4D44A 5IARA 1RYBA 3AJ8A 5FPHA 3AU8A 4GL2A 1FFEA 4MW5A 2A9RA 2IYNA 1UAGA 2H07A 3N5CA 3O0TA 3IDZA 4JFRA 2EJUA 3I5MA 4KWTA 4DRXB 4DDVA 3GLHE 4EHLA 2AE2A 2GCOA 4LN1A 3FB1A 5GJVC 4ZXFA 3K0SA 1C3OB 2P5TB 3JYHA 5HIAA 4X3CA 3W34A 4C7BA 2HH9A 1N2XA 5EXPA 4BNDA 3M9WA 1LI4A 4KGXA 1WBJB 3KE8A 3M5PA 2Q4EA 3ZN2A 3ICPA 4R0NA 3O82A 3FOBA 1CY6A 4WDRA 5J2UA 2PMEA 1NQVA 1PYOA 3R7FA 4REMA 4C2TA 3QEKA 1QYDA 2ZRHA 2HHHB 1F06A 3LZ6A 2J0UB 3HI6A 2VXOA 4OXKA 2JFQA 2CJYA 3EZLA 5LMZA 3QVUA 2HCTA 1DXQA 1J0DA 1NZJA 2AOVA 1ZXXA 1N2SA 4RC9A 5AM1A 4HGPA 3TMKA 3ZJVA 1U8UA 4XARA 2FN4A 2GKGA 2QRQA 4HH4A 4UNIA 1U6IA 1E96A 3U9TA 1FYDA 4D97A 5C18A 1Y3AA 3IP3A 1AHNA 1P9WA 1TM1E 4UFNA 4OI0A 4L78A 2GWRA 5SZJA 2UV4A 1GLVA 1LF0A 2BHNA 2XIQA 3B38A 2AN9A 2OUIA 3UTDA 2WJVA 1XRQA 3U3ZA 3OJXA 3D7LA 2R6AA 3TZ6A 1IY0A 4JZYA 3BMOA 1QK4A 3KUKA 4WEQA 2QX8A 4IJKA 3USZA 1WXWA 1ADJA 4PG5A 3KJIA 4RPHA 3ZZUA 2IE8A 4D4HA 5FD8A 2ZETA 2EFJA 1O8CA 1E6KA 4CF3A 4DR5B 2B0CA 2A6PA 2NV0A 1MC5A 4F4UA 1WCXA 2FMIA 1IEWA 4B7AA 4HDKA 4UHKA 2CFSA 3W8EA 5BWOA 1ST3A 4ZA2A 1AMOA 3JWJA 3SZRA 1X19A 1JJBA 1YDFA 3OZCA 5BW5A 2ZE7A 8AT1A 1GARA 1KYYA 4JUFA 5KVVA 1CJCA 3LX5A 4DIUA 3RS9A 4FS8A 1IBSA 2I6TA 1YVUA 2XWPA 4ND8B 4DIDA 2O05A 4KBGA 3FPFA 3NFRA 4LHZA 4E03A 3A1UA 4G4IA 4OXRA 4PLYA 4B3IA 5IAKA 2GRJA 4F06A 2NQTA 3VNAA 1P2VA 4ADSG 1M7BA 2UV5A 1L4YA 1NW5A 2OO5C 4KREA 2GEJA 3C48A 3FTDA 3HU2A 4I81A 1D9ZA 1Z6XA 3T5TA 3IUNA 3PT5A 4ZQBA 1TYAE 3NRBA 5IMSA 3AM1A 3HM9A 4ZZIA 5K8CA 4LJRA 3PA8A 2C03A 4NBKA 4ZVTA 3ZDQA 1G20E 1N8SA 2J6BA 3FBTA 3MAAC 2YHUA 1XKTA 1V1JA 2HNAA 2A78A 3Q7RA 1UXOA 1AMUA 3OM1A 4PQYA 1AN9A 4ND7A 4QPCA 1BWRA 4IUYA 3FWYA 4EUHA 2H1SA 3BTUA 5AI6A 4O2AA 2F43A 5KYUA 3WGVA 4D3YA 2XF2A 3C41J 4TXHA 4C4OA 2C9ZA 1HH4A 3KPVA 4LJ4A 5E0KB 3SQXA 2HSDA 4X95A 2L69A 3V32A 1KQOA 1ZOPA 3WJ7A 4OBWA 4H18A 2XV1A 3D43A 1QGOA 4HR7A 2XEXA 2E4WA 4R40A 3G13A 2K7FA 1IN4A 2P9GA 1P29A 1DOHA 2VATA 3BULA 3PFBA 5E7MA 2PD4A 5IUKC 3BFJA 1HQYE 2C07A 3BJZA 5TLSA 1PX0A 4P5PA 4QUIA 5GONA 4IIFA 3WLTA 1BGXT 1JDNA 3W77A 5IEBA 3H17A 4RF2A 5BXQC 1E69A 2XNDD 3BWDD 1PT7A 1W8DA 4PXAA 4R51A 4NBNA 3GLHA 4TM7A 2RAFA 3EN0A 2GPSA 4W1SA 3VRHA 3JR7A 5LUBA 1Y5NA 3NBMA 4HDCA 4O5OA 2RKOA 4PPYA 2QZ4A 4K3VA 4KBFA 4FGZA 3JQBC 3MOSA 3NAQA 5DHSA 2LCFA 4IFIA 5AQ1A 1UKZA 4D8YA 2EL9A 2AC7A 4BO2A 3P20A 1T8UA 2QN6A 2F9MA 1AIPA 1DUSA 1W2GA 1RABA 5COQA 2JHFA 5DYWA 1USGA 1QIEA 2Z83A 3MJVA 3H2HA 5KJ6A 5A04A 3NTVA 5JY1A 1QHGA 5KDDA 1IATA 2FG7C 2D4AA 1SZCA 4G89A 4FGWA 2P67A 1CUYA 1U8ZA 3A70A 1TTQB 3A27A 5H4HA 1VLZA 2NXCA 3BMNA 4FDLA 4ZGBA 2JBWA 3M6MD 3Q7EA 1JH8A 4F91B 1F8YA 3SLGA 3L06A 3GJ6A 3OHPA 4CPDA 2YQZA 5EP2A 3RYFA 2HIAA 1CD5A 3BHJA 1D1PA 2Z08A 4IZIA 4EJ6A 1DLIA 4BV9A 1PSDA 2MOKA 3I2IA 1B2RA 3DZIA 1AKNA 1UH5A 1JU4A 4FC6A 5A4AA 2XTMA 3OBBA 1XGKA 2CNDA 3A2LA 1C1XA 1FUKA 1XVLA 3KJXA 4P98A 3QOYA 2P5SA 3C14C 5B1IA 4TSRA 1QYWA 2P2LA 3EWIA 3G8BA 3AVWA 4FKBA 2IZZA 1T24A 3T5BA 3UVEA 5KJ1A 5KNDA 2PZMA 2ONKA 2IZ1A 3IEVA 4C4RA 3K9QO 3UZUA 3Q3VA 4KNVA 3ES9A 4M1KA 4LG1A 3U7HB 2UUAB 2ZJZA 3H2SA 2Q6KA 3E53A 1YR7A 2ADFA 4MHSA 3DE2X 1K75A 3V42A 3D6FA 1JEAA 1KVTA 4KQIA 4UAUA 4YBZA 4J4BA 2AT1A 3Q72A 2Z2ZA 2BCGY 4LJ5A 4ZRNA 2PVSA 4YAUA 1NJFA 4QOGA 1JTFA 1GCUA 2HT6A 3FDZA 1SG9A 3ZI7A 4GNKA 3H6HA 1QG0A 5BN1A 1AHPA 3GZNB 3PUWA 1PWHA 3C3MA 3GJYA 3GN2A 5LQSA 3ZK8A 1OYOA 2PR2A 2J3QA 3ZIDA 5CG2A 2GS9A 2I0FA 3CBQA 2QENA 2WMYA 1CS0B 4J6FA 4D7AA 4EHHA 3F6RA 3AHJA 3QLUA 3O4FA 3HUDA 4PYIA 4KJXA 5K20A 1N6IA 3NHSA 1NVUQ 1YGPA 3JATB 2COUA 4BASA 5E6SA 3HY4A 3MERA 4TV9A 3NZEA 3FMIA 1VHTA 2X8JB 3G23A 4P4LA 3T34A 2IU6A 3A8TA 4JVNA 3KKOA 3L6DA 3ESQA 1ZD4A 1HE3A 4LXQA 4ZVLA 1SUCA 1VMDA 3DDOA 4KPGA 3VJRA 4MVJD 3NO4A 4GECA 2HBYA 4RELA 3UK0A 3DBVO 5FUWA 1E3QA 1T8SA 1DINA 5HDQA 1EZ4A 1JSZA 4UVEA 1EMDA 5HDBB 1NAIA 3PDUA 4IOLA 3TW8B 4BAGA 4DMHA 2YJ3A 4AK9A 1ZESA 1PG5A 1DJQA 2QU7A 3DW3X 4L08A 5LIPA 4BRWA 3G2PA 1Q6ZA 2W42A 3HJAA 1YC5A 3NDJA 4N0DA 4QATA 4UUQA 5F51A 5B37A 4LSZA 1YR3A 2RI0A 1WPGA 2QRPA 1SB9A 2X15A 3Q10A 4I5IA 3D4LA 4HKTA 4I4TF 4IFTA 3LKZA 4FNOA 2OORC 2OK7A 5DM2A 1KZ9A 4WESB 3TVTA 5IAAA 2R8PA 3C8DA 2CFRA 3KQYA 2D3TA 4RJJA 4KDRA 4CMEA 3UMMA 3WNVA 2JW5A 5CJJA 3JYNA 5I9MA 2B8TA 3GG9A 3WB0A 5JHHB 5KDLA 3FOEC 1NVVQ 4NQZA 4YAOA 1N2CE 4KQ1A 2FMHA 3DKKA 3W4JA 4DSNA 1XQXA 5I3ZA 1PK8A 4IJ5A 4DUGA 1V26A 2Q5FA 4US2R 3CF2A 3IYLW 2ZBQA 5CYOA 2AD1A 1VPEA 2BD0A 3MTBA 1VOTA 2VF5X 3NTRA 1K6JA 2HJSA 1RPTA 1E64A 3FETA 4U5XA 4W99A 2MIIA 2PVPA 5HQTA 2UUBB 5JAZA 4EARA 3U3OA 1DOZA 2NYVA 2RHWA 3PQ3A 3QWFA 4MGKR 4Y9DA 4O25A 3QMVA 4H08A 4L50A 3OPYB 1E4VA 2O2IA 1GG2A 3EMDA 4AP5A 3LDAA 1MH9A 3OSUA 1PZMA 4IIJA 4HRAA 1TAQA 1MEJA 1FZQA 5BOSA 1C1XB 1QX3A 4X6UA 5BVGB 1Q6YA 2DLCX 4F6CA 4HWPA 3O3CA 4YV2A 1COZA 5HJ5A 2ODEA 2CV2A 2R1ZA 2PZLA 3A4VA 3C4QA 3ICWA 4JI6B 5FPTA 3U7EB 3WHPA 4AICA 1WJGA 3K0EA 5IAGA 4XYLA 1RXYA 5CB6A 4KXLA 4PYRA 4JXXA 1ZRMA 4LCBA 4ZYUA 4B87A 3VPBA 3FGZA 4BV3A 1W6UA 1RWNA 4LF8B 2VBIA 5HOEA 2O5EA 3EFBA 3RTAA 4MV4A 5BV0A 5ADUS 1EAMA 5LYJA 1OASA 3P0FA 3ZIAA 3B5IA 1U31A 1YRQA 1AD2A 3BB1A 4MEBA 3TDNA 4D3DA 3RQSA 4HGRA 1IBKB 1KYQA 3EIUA 3S7ZA 2BGIA 2I8AA 1Q0TA 4TGLA 4C07A 1GKYA 1Z5NA 1ODSA 2DP4E 2JEYA 5EVCA 4ETWA 1J5XA 4CG2A 4H59A 4JBXA 2NZYA 4C0AC 4CI9A 1J1UA 3OTHA 4NENB 5JQWA 2AZXA 1CZKA 2CDCA 1PGQA 3IUEA 1K4MA 4KXVA 2UVDA 4DWVA 4F38A 4Q7LA 4RXUA 1I9GA 4LDNA 3ZJYA 2HHAA 2ZJ5A 2YXEA 5EXXA 4HJRA 4F9EA 1HYHA 2Q0SA 5AQEA 4WFJA 4MWZA 1U3FA 2VDMB 4FI3F 1XWWA 1R9JA 3WRVA 5LNK1 4B6OA 2PD6A 3ELUA 3IUSA 1XELA 3SC2A 2MDTA 4M21A 3X2FA 1O77A 1L5ZA 1G2QA 1ZVMA 3AFOA 4ZYXA 5AVZA 2I9PA 1X3SA 2FJ0A 1UC4B 3PQ8A 2PN1A 2UV7A 4L22A 2HF7A 4RH1A 3RQIA 4TSFD 3M3PA 3R0XA 1TYCA 2JAPA 4MV8A 3TNYA 5LOVF 3GJTA 2PQ0A 1ABBA 4JYAB 1NA5A 4K9MA 1G3RA 3PCRB 5CXUA 4MI3A 3W5IA 1E6MA 1EXMA 2C1XA 4JVOA 3FD8A 2DOKA 3NVMB 5DSZA 1TT5B 1U0LA 3IVGA 2NSDA 3T3OA 2WWXA 1YKSA 3R44A 5DLDA 1JHUA 4ZP1A 5B5SA 1A9PA 4ZI7A 2PG3A 3QA3E 1MRNA 3C5VA 2IH5A 2PHZA 4EHJA 3GCDA 3L6RA 3NH6A 3RU2A 2QZ9A 1LNSA 3TAUA 3H4VA 4Z5XA 4C4AA 4QLBA 2AI3A 1KPHA 1R27A 2IEBA 2H11A 5EKTA 1LFDB 1LQ2A 2Q4OA 2VYFA 3PXGA 3U4QB 3HABA 2QX7A 2B69A 4PEVA 4XFKA 3RRZA 1P9OA 3L8DA 2FVXA 3VJLA 5JH7A 4W5QA 1XTJA 2H08A 1RC0A 2QN3A 2XTJA 3N2YA 1S2LA 2VP2A 3AEQA 1EVKA 2OOYE 2EJWA 3PQFA 1FP1D 1SG0A 4M7OA 4DL9A 2AMYA 4XCVA 1Q95A 5CMLA 1AUPA 4BKMA 2Z43A 1EUDB 3U7IA 5IVHA 3UKDA 4NZ9A 5EWJA 4KKVA 3E1GA 2C7RA 4DLPA 3D4NA 2G5GX 1UXKA 1EB8A 3HP7A 1HBJA 5FR2A 1XLUA 5F12A 4KZKA 2Q99A 2Y4NA 4PYNA 3T0GA 4AW9A 4FYJA 2I6UA 2KQUA 3D2BA 3I2GA 3K0FA 5ALKA 4B74A 3B1JA 4L9AA 1UFVA 3GEEA 2QJRA 3OZSA 3L04A 5C8YF 3RUIA 3CLSC 1RPJA 1TF5A 3CE9A 5HRCA 5J63A 1R0YA 2XUAA 4H3VA 5IJ9A 4KUEA 2LR0A 1Y1KE 4O4HF 4BLRA 1DNPA 3DAHA 4HQ6A 1C7FA 1G17A 1I4LD 2OLKA 4FX2A 1TD1A 1SR8A 3W5JA 2OBNA 4L4YA 5GZ1A 2XOKA 3PE6A 3EJ6A 4IO1A 1MEOA 4IHAA 3TBKA 1BN7A 3WLLA 4FYHA 4WJZA 5JV5A 3R5TA 3M83A 3MTJA 3I01M 1ND5A 2EQAA 1G7SA 4ZRMA 1P4JA 1U7TA 3GLFB 4I1RA 1FP2A 2A9FA 4O2AF 1QZZA 2HJRA 3K6KA 9LDBA 3D02A 4G5QA 1EFVB 4X8MA 3CG0A 4X3PA 4UUUA 1O5TA 4A8JB 1B4DA 1Y9JA 2IQIA 1ENYA 3BB3A 4BWYA 5FUVA 1XVTA 2XQJA 4YMGA 4BJHB 4GVLA 3EDQA 4ZQIA 1OI3A 4S1PA 2JFBA 1T5TA 1W93A 4KV7A 4QDTA 2B8JA 2P6MA 5AOBA 3S1AB 2NO7A 4U8GA 5IBCA 5HCUA 1NYRA 4E22A 4BN4A 1KQNA 1C9DB 1ATZA 3KJEA 1VG9B 2DPHA 1HKUA 3PFIA 4BAUA 4QUAA 1XAIA 1E2NA 4QPNA 1OAAA 3AGQA 1HWYA 3IIJA 5CNKA 4Q3DA 1ZO8A 2IOHA 1J2UA 2GDZA 1AGRA 1GZHB 3UWPA 4EJFA 2VZ0A 1OFHA 3FAZA 4BCDA 5K0TA 2W0MA 4WZ6A 2QV0A 4M6WA 4REQB 5JNTA 3MJ4A 3O84A 5IM5A 5JBIA 3ITNA 2R87A 4M0FA 4UTRA 4PX5A 2JHPA 1WB5A 3TTTA 1IK4A 1XZGA 2IYWA 3LBNA 3FYHA 4ZOBA 3FZYA 1H69A 2Q3JA 2B7LA 1G8HA 2X9GA 3PQ6A 1SK8A 1ECCA 4II7A 4M8LA 2X0DA 4E5PA 2IK8A 2HWXA 3I9NA 4MJ3A 2K5UA 2X19A 3M81A 4W5HA 4YQEA 1S2DA 1ENPA 1N78A 1E3JA 2XMQA 1KZ1A 1Q20A 4HN2A 4L3OA 1ORDA 4RACA 4TRRA 2AFRA 4HDMA 1V1RB 1R6BX 3T99A 4WXYB 3TTYA 4YRGA 4B3BA 2I67A 4CFYA 1HTTA 5GWXA 4MB2A 1CR1A 3MCZA 3DV0B 4N48A 4XR9A 5L3QA 4EW2A 3OT1A 1FXSA 5TVKA 5C9ZA 1JYEA 1PR5A 1QQAA 4YRLA 2NV6A 2HNBA 3W79A 4GWLA 1QNLA 1V39A 1ZH4A 4W5WA 3QW2A 3PUJA 2XMPA 2DQSA 4UAVA 3AWIA 2CNWD 1A96A 2OHJA 3CF4A 1EESA 4L8FA 3FUVA 4Z0NA 3TW6A 4G24A 1AY0A 3VR4D 1O95C 1CIVA 1XNHA 4L5IA 1RHUA 4HG0A 2NUPB 2YS7A 1CEEA 2Z1NA 5T8KC 3AY6A 1U2PA 1BDIA 3ANSA 1F2UA 1SOMA 3WLRA 2CVHA 3D8RA 2F1KA 2R8RA 3AK4A 2DBVO 3Q41A 2JJ2A 2LIVA 4EGJA 4HG2A 4Z53A 1G3IA 1RPNA 5D85A 3VNVA 1QB7A 1OFTA 2QN8A 1PG2A 3L02A 3GLGE 2EKQA 4AJ1A 3WA6A 1X3LA 2ZIXA 5D5PA 4KEAA 1KKMA 2SECE 4Z9YA 5A7FA 1CP2A 3NHFA 1B00A 4EQ6B 1IHXA 1X1SA 4YMUA 3BFPA 2VNKA 4LMBA 2DBZA 4R8MA 3RTDA 3TUIC 3C39A 4LVOA 2OG1A 1LZLA 4F5WA 1P62B 4U9HS 1V3QE 1SCDA 3AEUA 3DZ8A 5EWJB 4L9RA 1L9KA 2Q3DA 3JVVA 1QFMA 3SZUA 1OI2A 1TM5E 1NFFA 3JVUA 3QYFA 1IAQA 2YYAA 4N0MA 2O2JA 1CQIB 4N40A 4QUGA 2RBGA 3E9NA 2V6FA 5IJAA 2R5WA 3PD0A 4QTTB 1QF6A 3HY6A 1W88A 1MVLA 2YVYA 2IOFA 5H82A 5FUBA 4G8DA 4RQAA 5JU6A 3G1TA 4NABA 2ZXFA 3F6SA 4D9CA 1Z2PX 3VR6H 2XYPA 3H1PA 4P34A 3FF1A 1PR9A 4D3ZA 4JLWA 1M9NA 3F3SA 1FDWA 3GRCA 3FI9A 3G2LA 4C3VA 3A1NA 1VLQA 3PB3A 3TE7A 1BX1A 2EKPA 3LD9A 5A7HA 3AI3A 2V5AA 4PLHA 3DLCA 3QBEA 2WM9B 4WW0A 4AL4A 3GYBA 4FWIB 5J2UF 2HD4A 1MJNA 2YIMA 4XM2A 2BFBA 1OD6A 2ZRMA 2YZQA 2ZI6A 2G4LA 3GEBA 1ZWLA 2AEMA 2ILTA 3W5CA 5CB4A 4JWTA 3DE5X 1FJGB 2J5KA 1T9HA 2CLEB 3OE1A 4BZZA 1OX6A 1NLUA 1IZ0A 2BFMA 2CXUA 2JVIA 2EFGA 2GPBA 2EQBA 2KBFA 3MLBA 1CG6A 4RJ2A 4P4TA 3KQSA 3F4LA 2HRCA 1P1KA 5EIWA 4ER0A 3ETEA 5FWYA 5TS2A 2E5LB 4NV0A 2NZ8A 4RTLA 5B7NA 1U5CA 3V9AA 3TQOA 2OFWA 4DMCA 3A2KA 1KEUA 4C76A 2B4KA 2RIRA 4YREA 1R6AA 4MINA 3MFQA 1N2BA 4P3KA 2C82A 1DFHA 5LLTA 1UT5A 4J91A 4D8XA 3F0TA 4FN4A 5AI8A 2H54A 3BIWA 4MVCA 5CP8A 1Z82A 5T3UA 5I45A 4FS3A 1HFWA 4XLLA 3L7NA 1H8HA 3GPCA 5LU9A 3W90A 4HNQA 3ROMA 2YWHA 4K9SA 3ZLVA 3OT4A 2AEEA 2IYVA 3W5VA 5BNZA 1Q16A 4GC5A 5ALOA 2NU6A 4XRRA 4LCEA 1ORIA 3OZAA 1VHQA 3UT0A 3SWWA 4N39A 1QYIA 1E6LA 3NALA 4MWGA 1OLOA 1L4GA 3I6IA 2XD4A 2NTJA 1L7DA 3K6JA 3HN6A 3LHKA 3N8IA 5D84A 4K9QA 1EJ6A 2ARKA 1GAWA 1FS4A 1E1YA 2B8EA 2V7PA 4JP2A 2JFUA 4P80A 1DXYA 2YTZA 1XP8A 3KKPA 2CVOA 3FNEA 2ZS8A 3GMSA 2FSUA 421PA 5FOQA 2YNMA 2XXBA 4U00A 3UXHA 3K9CA 3PR1A 5JQGB 2X5JO 1NN0A 4P33A 4KPFC 4A5SA 3OX1A 4G4SO 4GOKA 5A4KA 3VNQA 4BFSA 2FN9A 5EWLA 4M1YA 3ZW9A 1FVHA 3U44A 3BZBA 4YJGA 3RTBA 5IMBA 4LV8B 2V0NA 4GQYA 2YJ5A 5BRNA 3DXFA 4QU5A 3IQZA 2B1GA 2Q4TA 4CMEC 4K5QA 4QD3A 3JQRA 1JXOA 1XVVA 4Y6PA 3ER6A 1R16A 1Z73A 5I5EA 3RHSA 4J0DA 2JC3A 3S2GA 3WZMA 2YHBA 4BAZA 3KLBA 5A9SA 1FS6A 4OSOA 1W4ZA 1JYSA 3SZOA 2ZJYA 1NJSA 1PCXA 2IJGX 4FXOA 1A4RA 1UFRA 2C58A 4XCQA 3DULA 2BCJQ 1QGUA 3TTWA 3VI4B 4BCCA 4D4IA 1YQGA 2D7DA 3E3MA 3PRKE 3N3BC 4ZTUB 1NOIA 2YCLA 3VNSA 3CRQA 4Z1OA 3WL4A 1E5DA 3PA6A 1LY1A 3AG5A 1HX7A 2JGLA 3ABIA 1VQ1A 3EXAA 2Z2YA 3SR3A 4UNRA 5JZVA 2NACA 3V8RA 3O0DA 4D41A 4Z7JA 4ZI7F 1BCRA 3KD3A 4EM6A 5CB0A 3AJEA 1KHTA 3ZWBA 3GJ0A 4GQBA 3R0QA 2MSNA 2X0JA 4GF5A 2PX3A 2IVFA 4FYVA 4O33A 3WLHA 2CNNA 1VIAA 4CMAA 1GPYA 3GRKA 4YCAA 2C7VA 4DJDC 3TB4A 4KACA 1RMYA 5BV1A 2AX4A 3I45A 3HJGA 3WHKA 2NIPA 5A3JA 3KQHA 1XDDA 3NRCA 1OROA 5ED4A 4DUGD 5I7HA 5EJGA 5DBEX 2OP1A 2QMYA 4G1MB 3GBYA 1TYZA 2HLHA 2FG6C 5TF4A 3ZE6A 2PRZA 1MUUA 4WN9A 4L02A 2SNIE 2WIDA 2X7XA 2OV2A 3HDTA 3R1IA 3ZX4A 4Q3BA 2P41A 5JYCA 2JVKA 1IYZA 1YB5A 3D4BA 1NF8A 4JT2A 4UQOA 3BD8A 3C7TA 1XZLA 1YB2A 3PVZA 1RXVA 3NHMA 2OCLA 5C0OE 2I3DA 1JIIA 2D1SA 4JGIA 4US0R 1CEXA 2R7KA 5HIIA 5KNCH 5IKXA 1HR0B 2YZMA 4GZ3A 1PZEA 3D3JA 5E6RA 1I9CA 1O6ZA 3L92A 4KOAA 1DQNA 1DRWA 4HWRA 1X7DA 5IBQA 5K3OA 2FFQA 3Q3CA 1R9GA 3R3JA 1X8JA 1A8QA 2H2FA 1ICIA 1XD2A 1KSFX 4NL4H 1NVEA 2UYGA 1ISRA 4NBWA 5KIAA 2CF6A 5ALIA 5BV8A 1TDJA 3N75A 3KYBA 2Q6VA 3IIKA 4FC7A 4R41A 2WM8A 4N49A 3CR8A 3O92A 3HVKA 4DYHA 5AKEA 3NHPA 4AXBA 2YVZA 1Z37A 3SF0A 2J48A 3C5WP 4B4KA 3KSBC 4OB8A 3X1JA 5HCNA 3EVAA 3FUUA 4OQQA 1Z7BA 5A6SB 4HS9A 4XD2A 2OQVA 5CFNA 3AI1A 1A27A 1NBMD 1SZPA 2QXTA 3PC6A 1Y7IA 3QG1A 2JJ8A 3R5SA 4I4NA 3IPYA 4KDCA 4CV2A 2C97A 2OHHA 3BFKA 1BGVA 1HDCA 2JDID 4MIYA 4CTMA 3TOSA 4ALJA 3NNSA 2WNIA 3ACDA 3KPYA 1VXRA 4X1KA 1M33A 3BMOB 3LHSA 1B41A 2QIPA 3PHHA 4NNOA 3IQGX 3EIHA 1RS0A 1C4KA 1MJ5A 2EDCA 1PTJA 1DMRA 2GPJA 4J7XA 2RGDA 1R37A 3VDMA 1Y8RA 1X80A 3VYVA 1J0EA 1N75A 3CLRC 3SX0A 5KOJB 1PUIA 5TMPA 1BWPA 1EH5A 3CNEA 2FEMA 3GVIA 4XE5A 1VBNA 1Z6AA 2BL4A 2VSQA 2OAGA 4G0YA 1GTSA 3G5MA 1WPQA 4KGZA 3JQ8A 4DV1B 3HP4A 3PS9A 1YAJA 2B61A 2COEA 2XUZA 4I0WB 1H5NA 5EP1A 1DC8A 3GB9A 4LC9A 1TRHA 4XDYA 5AJVB 2PGIA 4ZPJA 3U4DA 5CD1A 2IEDA 2C7GA 5FEMA 4L4ZA 1AGXA 3LHFA 2FJPA 4YR7A 5KJCA 5SZIA 2J0VA 1HE5A 1TO1E 3M9XA 3E2PA 5AVWA 1Y42X 1J56A 2ZGVA 4YFYA 3L2BA 4NNJA 1M5TA 2XB6A 3QHPA 4JXKA 5KAPA 4LZNA 3RSCA 3FPHA 2GTIA 1ZJZA 4BJ6A 1XPUA 1MB0A 2BGUA 1JBEA 3TSAA 3GXBA 1I2AA 2ZDHA 3BOSA 3E9RA 4ZN6A 5JXWA 2X7JA 4CTNA 3U7JA 1KFJB 3UMJA 5EE1A 4X45A 4UC0A 3I09A 2GAAA 2NU9A 3CWCA 1LWOA 1A1VA 1WWKA 2HTFA 2JI6A 1CK4A 4UTPA 3OZWA 2J6HA 1XCGB 2ICAA 3DFMA 3MJEA 4B81A 4UVDA 2QDXA 5FTKA 2BGNA 3MGGA 3WDMA 3L84A 4UBOA 2NXEA 2VTEA 4Q9LA 1YKGA 2HA2A 1TM7E 2ZYHA 4U9IS 3I32A 5CT6A 4GMDA 3JZAA 2IYQA 1E3DA 2XWQA 3KTOA 3AOEC 5IPFA 5JS7A 1VJ0A 3ZH2A 4YQZA 3JPYA 3I2KA 3SVTA 1ZIOA 3HI4A 3QVOA 4BKOA 2NVWA 5NULA 4TOIA 5DCWA 3OVMA 1TKRA 4QXAA 1ZL0A 3BE4A 5ILQA 3C3JA 2HDHA 4KIUA 1F0NA 3UIEA 2BM9A 4GLJA 4B76A 1OW3B 2RG7A 4N18A 1EX7A 1ZUD1 2Q41A 3IXLA 2W58A 3WNDA 3H9JA 4AAYA 3W6OA 2RH9B 4MUYA 2PUCA 4TVSA 2JKZA 3RYHA 3BG5A 2I2DA 4RLSA 5KYWA 1UEJA 4XJXA 4RTRA 1U0SY 4LBWA 2DHEA 3KKNA 3DEIA 5JRDS 3LRXA 1UOQA 3M8KA 3NGLA 5DO9A 1RRMA 2TSYB 1W49A 3MJHA 1P5FA 4YRNA 4G0QA 4GOXA 1IVNA 1IBMB 4J0QA 5H81A 3UUWA 3F90A 1LF5A 2VJAA 3BBLA 5EWMB 2QP3A 3NHBA 3OC0A 4M87A 4LYDA 2QGZA 4Q3NA 1N1GA 4W6ZA 2DY0A 5C8DA 3OU7A 3K09C 3IT2A 1CEQA 3RSQA 3KEOA 4Q1BA 1H0HA 1KJWA 5EYPA 3C5HA 1JALA 3KLOA 3KVOA 5U1PA 3E9QA 3UG6A 2GGSA 4MRNA 2ZKLA 4LE1A 4B4UA 1KMNA 5EIBD 3HLKA 5JSQA 1TU0A 4JGGA 4P0TA 3TQCA 1N5JA 5TR9A 4HPWA 5EOVA 1ZD5A 2Y1KA 5ESXA 3ZV7A 4BEJA 5AVRA 1K97A 1KVSA 5KYXA 3GA0A 4BYGA 4D25A 4UBIA 1LC0A 3PJRA 4PZLA 3V2IA 3LKBA 5ICEA 3LV8A 1GUZA 3IAHA 4G4JA 4KXNA 3GVXA 4BRUA 3IERA 5AW5A 1SVOA 4NU6A 3NWBA 4XSHA 1T2VA 1K7XB 4PYJA 4DPLA 3DQPA 4WXPA 1BVHA 5JLAA 3FROA 2VDQB 1A72A 1OTYA 2DUJA 3KUDA 4FZJA 4IDCA 4AZTA 2P75A 2P79A 4XRGA 5C8XA 1CQJA 2CFTA 3RVDA 2NYCA 3ZD6A 3SGLA 1B76A 2FW9A 1T29A 1TQHA 3MRTA 1JHVA 4C1NA 5I9SA 4MIEA 3QU7A 4PRLA 4IUBS 3TRIA 3G8YA 4D5GA 4BE7B 2OYRA 1YFZA 4XLZA 4X85A 5CIYA 3EZ7A 1DO2A 1ZD3A 4AT1A 1QOPB 4ZVRA 4D9GA 3UV6A 1CUAA 4MRAA 3HN7A 1W0CA 3MRSA 1B0PA 5LP1A 4A0FA 1OYVA 1VJGA 1FYEA 2HCFA 1H4SA 1OH8A 3MELA 2ZWAA 2E4UA 4PG6A 2NG1A 2D0PB 2MWMA 5A6VA 1K7EB 5DX8A 4C5BA 5DNVA 3DKRA 3H13A 4II2A 2P5UA 121PA 4C21A 1JDSA 1ZU5A 1IHDA 1G6OA 1NX9A 2PH1A 3IQEA 4PN3A 2AQIA 5B2FA 4N76A 2JI7A 4UHJA 4GXTA 3CZPA 2FYTA 3EUAA 3OTIA 3U61B 3V00A 1EIZA 1P7YA 2QRVA 3FTCA 4X0EA 3P2KA 3DBIA 3V46A 4BNTA 3UUGA 1RWPA 4ZK6A 2ZJ3A 1WUYA 2QRUA 4M76B 4RK1A 1W5BA 3BT7A 3DUWA 2GZAA 1PKXA 1VJCA 4MQFB 3N0RA 3M4YA 4C03A 1NVWQ 2C8VA 2ODAA 3L0PA 4FCWA 4HNSA 3TLGB 4EGSA 1NL3A 2XE4A 5TEWA 2WI8A 4KI0A 3Q8MA 3LCUA 3NCTA 5CLLA 3C7CB 3GJQA 4DCUA 5KVSA 1TZMA 3DLBA 3BIOA 2G71A 4QGHA 4JELA 4LF6B 3RVKA 1N36B 3OLYA 2I6SA 3FCCA 5AJXA 1CUIA 4IY2A 1EWRA 1T10A 3WNQA 4ZCMA 1T3GA 4RM2A 4B3XA 4BP1A 1NVGA 1QH1B 1M2WA 1D4AA 5LZ5A 2ATEA 4LSGA 3TAXA 4EFLA 2CYCA 3ORHA 4RQBA 2G08A 4C06A 5E8RA 2XYVA 4RLFA 5EE9A 5EUBA 2IHYA 1SHJA 3AP3A 3JYOA 5SICE 3K70B 4ND8A 4OV6B 3H84A 4RY0A 3AR2A 3EVBA 4JLDA 2VTBA 3OC6A 1NYTA 3IAM6 5AUOB 3AY0A 2GNAA 2OILA 3DL7A 3FUCA 4MWDA 5CVEA 3A3NA 3ST7A 4B5LA 4ENTA 4S04A 4KR2A 3M49A 3IAFA 1O6FA 4FCTA 4PNHA 4QTZA 5ALRA 2WZDA 1KJ9A 1P2TA 1RJDA 2ZS7A 4MVJE 1N2GA 1OKKA 2DMRA 3M6WA 2HQBA 4DBVO 4GPZA 1XJCA 3FWNA 3FPSA 3VYWA 1EWTA 2LDXA 1WTAA 5B58T 3W1WA 3IAM1 4RF5A 4I55A 2XQFA 2GHQA 1RBMA 1AGNA 1ZONA 2COKA 2OV8A 1QHXA 2WKRA 3L3BA 1TPZA 2QSYA 3M4NA 4NZNA 4P38A 4QC2A 4YEDA 5DYNA 4ZALA 4W5NA 4GPTA 3BRWA 2R8XA 2WWWA 5JAMA 3O03A 4IIEA 2PSJA 2W6ID 3L8MA 2ADOA 3PNLA 1T3HA 1IN1A 1T1SA 2I4OA 3HUFA 5BT8A 1JR6A 2RIHA 4M9ZA 4BFUA 5IT0A 4MP6A 4CKWA 4PM4A 1OT3A 2QG9A 1HE2A 4H17A 5EZYA 1S3FA 3X0DA 3IEPA 2FPUA 2NU8B 1SVKA 4M1ZA 1KK0A 2CHEA 4GP6A 4XYGA 1DQZA 1QAQA 4E51A 1ESMA 3I9FA 1ZKDA 3TM4A 4FOSA 4YUYA 1EFPB 3OY2A 4PYKA 4MUGA 1N6KA 1VKZA 2W2TA 4B80A 3ZHZA 5BYJA 2HQOA 3OCMA 2R00A 1TL7C 1JA9A 4V0OA 2ID4A 2RJOA 3H2IA 3CT6A 1QQ7A 4KLRA 4DQUA 3LVQE 2JLUA 1D2RA 1ZK1A 3O2JA 4BO7A 2I34A 4EGQA 5FX2A 3JW8A 1CT9A 3MCUA 1BEZA 1KFCB 1BE6A 2WSMA 4Q66C 2REBA 4CETA 2XAUA 1V48A 5JANA 3CY6A 1M1NA 3M2TA 1L4EA 1GPDG 3W7BA 4F72A 1IIRA 3QM1A 4MGZR 5BMVF 6NULA 2FDCA 4PXYA 5G3YA 4P92A 2A4MA 2R1VB 3HG7A 4GPAA 4R31A 3AVQA 4JLVA 3QY0A 1SQSA 4W8GA 5JYDA 4BGUA 4GSKA 2BC9A 3RRFA 2CWWA 4PQFA 4JD5A 3NIBA 2FP3A 1T6BY 1ZUNB 4L6CA 3PGA1 4FWBA 1K5DA 4W8OA 4NESA 1AQJA 5KJFA 3FWZA 5CNMA 4YRDA 5DDIP 1BROA 4CG1A 4GT1A 4ZT6A 3BGWA 3SM9A 3OTWA 2BZGA 2GR9A 3BRCA 3T1OA 1P7VA 1GL9B 1G8SA 2O0LA 2OBFA 3M6XA 1KJYA 4BO0A 2RGBA 2OYSA 5KYTA 2V7BA 5CYFA 1BXGA 5DEIA 4JJGA 4GYWA 1F5SA 1UL1X 3Q9LA 1HEIA 2CXHA 2HWUA 2Q3BA 5JY6A 3CN7A 1ZD2P 2VT3A 5KO2A 2Q5IA 1C3EA 1GTJ1 5JZBA 4H7FA 3TCXB 5F98A 1VIDA 2W4IA 1HNWB 1N4AA 4P7JA 4O5AA 4W63A 5KINB 3PXAA 3HKDA 1C3XA 2VJOA 5AJWA 1TK3A 1CRWG 2OFFA 6ABPA 2YIVX 3VR5D 1B42A 4B8YA 2B82A 5JBQA 5BN4B 2EQ5A 4DUYB 2I2WA 2QUBA 1EUZA 1FL9A 1HZZA 4Y2VA 3AI7A 4J94A 2DETA 3A05A 3MPUA 3TPZA 2GK6A 3W7VA 1TEVA 1IRIA 4CF4A 3GC6A 3GZTB 1FX0A 2JL1A 1KSHA 2RHOA 3OQJA 4BC0A 1KORA 1TIKA 4H27A 4HQ0A 4TX1A 4W6QA 3VO1A 5DK4A 4RULA 2PZJA 3EGXA 2DX7A 1HQCA 2BMFA 1VE1A 1ZZEA 2YASA 4Q9DA 5HFAA 4AMUA 1E3WB 4MVJF 5C31A 1G4UR 2QNIA 4A0GA 5BWNA 2H1OA 2FDXA 1U4OA 2PS1A 2QTNA 1JAHA 2W6PA 3TX2A 1U0EA 2GPAA 3AKDA 5JRZA 1PVDA 1CVIA 4YHHB 2VVTA 4E5KA 4GOMD 3ZGZA 1E2MA 4P32A 2JASA 2V55B 5K3AA 4S05A 3MTQA 4I8DA 3G0OA 5K22B 2QU8A 1Q83A 4PRYA 2RAVA 3W0LB 3SZGA 1WXHA 3FMGA 5ELMA 1ZXLA 3R40A 1OB2A 3ZZNA 2RJNA 4Y30A 4AN4A 1FS5A 3GRFA 3H18A 1IOVA 1ZCFA 5DRTA 3H3FA 4DDMA 4H7HA 1I6LA 4P7BA 2WTEA 1MQ9A 1UBUS 1WDTA 2AW3A 1ADFA 1TYEB 2IL1A 4CM1A 4EJMA 1E0JA 1JNXX 4HPJB 3WJAA 4A1OA 2H1HA 2NO4A 2BUCA 2N47A 3BJEA 3F6BX 3NXKA 4AUEA 1N3LA 1SVSA 2HTEA 4BATA 4HDRB 2IFTA 4BTEA 4TYNA 2OCIA 2ZUFA 4PG7A 2HR1A 4CFZA 3LBYA 2IHZA 3S2ZA 4POOA 3UENA 1AQIA 2ZVPX 4Q1CA 5IM4A 1KKUA 1WW8A 3TSCA 4RGYA 2J5BA 2DLDA 5IYZF 1SBNE 4D0RA 3F7OA 3NORA 1DG1G 1SKAA 2ZJOA 4WIAA 5K8IA 1V6AA 1KS9A 2DU8A 3D64A 3U13A 3VO2A 5JYBA 2ATXA 3GPLA 4B2YA 3WFJA 3C3BA 4EKIA 4P0PB 1OYYA 2VJMA 4BMOB 2P6OA 4AO6A 3U60B 2MSWA 1RKXA 2LP4Y 4YUZA 1DIRA 3H0KA 4JJ7A 4LRWA 5I7RA 5ENDA 4ZEMA 4O2BA 5JJBA 3AIKA 3K9WA 4FYXA 5FNZA 1XTRA 2ASVA 3F6YA 1DRUA 1PW7A 1FMJA 4O4IA 4MUHA 4QJ5A 4BVJA 3V8VA 4UUNA 3C7DB 3H0CA 4IDBA 2JH9A 1FX1A 4MR7A 4P35A 4UBJA 1GA4A 4WNCA 1G60A 1IEVA 2VUIB 5EJIA 2CNKA 3IOBA 3V4PB 5ELXA 1PJ3A 4G25A 2KJQA 1CZLA 3KZVA 2HAEA 4JYPA 3O73A 2ANBA 1RQRA 3WQRA 3GVCA 3UN1A 4IMPA 2YCBA 1VL6A 5DNCA 4M86A 4IV0A 1QJ4A 4R69A 1BIFA 1T4GA 3BM5A 1N4DA 2GX6A 3GAMA 3COVA 2AN5A 3KPWA 4KL8S 1E79D 4X93A 5JSKA 1YOVA 4ZT7A 5KWSA 2Z5FA 4DRYA 4NRDA 4OFBA 3QGMA 1JDJA 2RGAA 5ABPA 5HZMA 2HBQA 4OHXA 5KHLB 1KDRA 2ZBPA 1I51A 1EPUA 3IURA 4CE6A 1FDOA 3CUTA 4QUHA 4DCPA 2LZ0A 4YAWA 4DGQA 5HYVA 5EEHA 1SUAA 2OAP1 2YW2A 1MIHA 5F77