4GQYA

Crystal structure of cbsx2 in complex with amp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
157
structure length
147
Chain Sequence
GYTVGDFMTPRQNLHVVKPSTSVDDALELLVEKKVTGLPVIDDNWTLVGVVSDYDLLALDSISGDVDSTWKTFNELQKLISKTYGKVVGDLMTPSPLVVRDSTNLEDAARLLLETKFRRLPVVDADGKLIGILTRGNVVRAALQIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Change in single cystathionine beta-synthase domain-containing protein from a bent to flat conformation upon adenosine monophosphate binding
pubmed doi rcsb
molecule keywords CBS domain-containing protein CBSX2, chloroplastic
molecule tags Protein binding
source organism Arabidopsis thaliana
total genus 41
structure length 147
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 4gqyA00
5K23C 3SL7A 4UUUA 2QRCE 4FRYA 5KS7A 3L31A 2YVYA 5K25C 3DDJA 3KPBA 2QRDE 2OOXE 3OI8A 3KH5A 4DQWA 3PC4A 5K24C 2QREE 2YVXA 3LQNA 3OCMA 3ORGA 4ESYB 3LFZA 4ESYA 4GQVA 2P9MA 2UV4A 4IYSA 3LV9A 3LHHA 2NYEA 1YAVA 4L28A 1PBJA 4O9KA 2YZIA 3T4NC 2EF7A 2QLVC 4GQYA 2YVZA 4P1OA 5LXQA 4GQWA 1O50A 2D4ZA 2NYCA 3TE5C 3KPCA 3KXRA 4NOCA 2QR1E 2RIFA 3OCOA 3FWRA 4COOA 2OUXA 4IY2A 2ZY9A 4HG0A 2UV6A 4PCUA 3I8NA 1XKFA 2O16A 3FNAA 4FXSA 3FWSA 2UV5A 5MMZA 3TDHC 2RIHA 3PC2A 4L27A 2RC3A 2YZQA 3KPDA 2QH1A 1Y5HA 3GBYA 4IY4A 4L3VA 3FHMA 3HF7A 4P1GA 3FV6A 4IY0A 2PFIA 3L2BA 2OOYE 5K22B 1PVMA 3PC3A 2EMQA 5IIPA 3K2VA 3K6EA 2UV7A 4IY3A 4L0DA
chains in the Genus database with same CATH superfamily
5K23C 3SL7A 4UUUA 2QRCE 4FRYA 5KS7A 3L31A 2YVYA 5K25C 3DDJA 3KPBA 2QRDE 2OOXE 3OI8A 3KH5A 2JA3A 4DQWA 3PC4A 5K24C 2QREE 2YVXA 3LQNA 3OCMA 3ORGA 4ESYB 3LFZA 4ESYA 4GQVA 2P9MA 2UV4A 4IYSA 3LV9A 3LHHA 2NYEA 1YAVA 4L28A 1PBJA 4O9KA 2YZIA 3T4NC 2EF7A 2QLVC 4GQYA 2YVZA 4P1OA 5LXQA 4GQWA 1O50A 2D4ZA 2NYCA 2J9LA 3KPCA 3TE5C 3KXRA 4NOCA 2QR1E 2RIFA 3OCOA 3FWRA 4COOA 2OUXA 4IY2A 2ZY9A 4HG0A 2UV6A 4PCUA 3I8NA 1XKFA 2O16A 3FNAA 4FXSA 3FWSA 2UV5A 5MMZA 3TDHC 2RIHA 3PC2A 4L27A 2RC3A 2YZQA 3KPDA 2QH1A 1Y5HA 3GBYA 4IY4A 4L3VA 3FHMA 3HF7A 4P1GA 3FV6A 4IY0A 2PFIA 3L2BA 2OOYE 5K22B 1PVMA 3PC3A 2EMQA 5IIPA 3K2VA 3K6EA 2UV7A 4IY3A 4L0DA
chains in the Genus database with same CATH topology
5K23C 3SL7A 4UUUA 2QRCE 4FRYA 5KS7A 3L31A 2YVYA 5K25C 3DDJA 3KPBA 2QRDE 2OOXE 3OI8A 3KH5A 2JA3A 4DQWA 3PC4A 5K24C 2QREE 2YVXA 3LQNA 3OCMA 3ORGA 4ESYB 3LFZA 4ESYA 4GQVA 2P9MA 2UV4A 4IYSA 3LV9A 3LHHA 2NYEA 1YAVA 4L28A 1PBJA 4O9KA 2YZIA 3T4NC 2EF7A 2QLVC 4GQYA 2YVZA 4P1OA 5LXQA 4GQWA 1O50A 2D4ZA 2NYCA 2J9LA 3KPCA 3TE5C 3KXRA 4NOCA 2QR1E 2RIFA 3OCOA 3FWRA 4COOA 2OUXA 4IY2A 2ZY9A 4HG0A 2UV6A 4PCUA 3I8NA 1XKFA 2O16A 3FNAA 4FXSA 3FWSA 2UV5A 5MMZA 3TDHC 2RIHA 3PC2A 4L27A 2RC3A 2YZQA 3KPDA 2QH1A 1Y5HA 3GBYA 4IY4A 4L3VA 3FHMA 3HF7A 4P1GA 3FV6A 4IY0A 2PFIA 3L2BA 2OOYE 5K22B 1PVMA 3PC3A 2EMQA 5IIPA 3K2VA 3K6EA 2UV7A 4IY3A 4L0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K23 C;  3SL7 A;  4UUU A;  2QRC E;  4FRY A;  5KS7 A;  3L31 A;  2YVY A;  5K25 C;  3DDJ A;  3KPB A;  2QRD E;  2OOX E;  3OI8 A;  3KH5 A;  4DQW A;  3PC4 A;  5K24 C;  2QRE E;  2YVX A;  3LQN A;  3OCM A;  3ORG A;  4ESY B;  3LFZ A;  4ESY A;  4GQV A;  2P9M A;  2UV4 A;  4IYS A;  3LV9 A;  3LHH A;  2NYE A;  1YAV A;  4L28 A;  1PBJ A;  4O9K A;  2YZI A;  3T4N C;  2EF7 A;  2QLV C;  4GQY A;  2YVZ A;  4P1O A;  5LXQ A;  4GQW A;  1O50 A;  2D4Z A;  2NYC A;  3TE5 C;  3KPC A;  3KXR A;  4NOC A;  2QR1 E;  2RIF A;  3OCO A;  3FWR A;  4COO A;  2OUX A;  4IY2 A;  2ZY9 A;  4HG0 A;  2UV6 A;  4PCU A;  3I8N A;  1XKF A;  2O16 A;  3FNA A;  4FXS A;  3FWS A;  2UV5 A;  5MMZ A;  3TDH C;  2RIH A;  3PC2 A;  4L27 A;  2RC3 A;  2YZQ A;  3KPD A;  2QH1 A;  1Y5H A;  3GBY A;  4IY4 A;  4L3V A;  3FHM A;  3HF7 A;  4P1G A;  3FV6 A;  4IY0 A;  2PFI A;  3L2B A;  2OOY E;  5K22 B;  1PVM A;  3PC3 A;  2EMQ A;  5IIP A;  3K2V A;  3K6E A;  2UV7 A;  4IY3 A;  4L0D A; 
#chains in the Genus database with same CATH topology
 5K23 C;  3SL7 A;  4UUU A;  2QRC E;  4FRY A;  5KS7 A;  3L31 A;  2YVY A;  5K25 C;  3DDJ A;  3KPB A;  2QRD E;  2OOX E;  3OI8 A;  3KH5 A;  2JA3 A;  4DQW A;  3PC4 A;  5K24 C;  2QRE E;  2YVX A;  3LQN A;  3OCM A;  3ORG A;  4ESY B;  3LFZ A;  4ESY A;  4GQV A;  2P9M A;  2UV4 A;  4IYS A;  3LV9 A;  3LHH A;  2NYE A;  1YAV A;  4L28 A;  1PBJ A;  4O9K A;  2YZI A;  3T4N C;  2EF7 A;  2QLV C;  4GQY A;  2YVZ A;  4P1O A;  5LXQ A;  4GQW A;  1O50 A;  2D4Z A;  2NYC A;  2J9L A;  3KPC A;  3TE5 C;  3KXR A;  4NOC A;  2QR1 E;  2RIF A;  3OCO A;  3FWR A;  4COO A;  2OUX A;  4IY2 A;  2ZY9 A;  4HG0 A;  2UV6 A;  4PCU A;  3I8N A;  1XKF A;  2O16 A;  3FNA A;  4FXS A;  3FWS A;  2UV5 A;  5MMZ A;  3TDH C;  2RIH A;  3PC2 A;  4L27 A;  2RC3 A;  2YZQ A;  3KPD A;  2QH1 A;  1Y5H A;  3GBY A;  4IY4 A;  4L3V A;  3FHM A;  3HF7 A;  4P1G A;  3FV6 A;  4IY0 A;  2PFI A;  3L2B A;  2OOY E;  5K22 B;  1PVM A;  3PC3 A;  2EMQ A;  5IIP A;  3K2V A;  3K6E A;  2UV7 A;  4IY3 A;  4L0D A; 
#chains in the Genus database with same CATH homology
 5K23 C;  3SL7 A;  4UUU A;  2QRC E;  4FRY A;  5KS7 A;  3L31 A;  2YVY A;  5K25 C;  3DDJ A;  3KPB A;  2QRD E;  2OOX E;  3OI8 A;  3KH5 A;  2JA3 A;  4DQW A;  3PC4 A;  5K24 C;  2QRE E;  2YVX A;  3LQN A;  3OCM A;  3ORG A;  4ESY B;  3LFZ A;  4ESY A;  4GQV A;  2P9M A;  2UV4 A;  4IYS A;  3LV9 A;  3LHH A;  2NYE A;  1YAV A;  4L28 A;  1PBJ A;  4O9K A;  2YZI A;  3T4N C;  2EF7 A;  2QLV C;  4GQY A;  2YVZ A;  4P1O A;  5LXQ A;  4GQW A;  1O50 A;  2D4Z A;  2NYC A;  2J9L A;  3KPC A;  3TE5 C;  3KXR A;  4NOC A;  2QR1 E;  2RIF A;  3OCO A;  3FWR A;  4COO A;  2OUX A;  4IY2 A;  2ZY9 A;  4HG0 A;  2UV6 A;  4PCU A;  3I8N A;  1XKF A;  2O16 A;  3FNA A;  4FXS A;  3FWS A;  2UV5 A;  5MMZ A;  3TDH C;  2RIH A;  3PC2 A;  4L27 A;  2RC3 A;  2YZQ A;  3KPD A;  2QH1 A;  1Y5H A;  3GBY A;  4IY4 A;  4L3V A;  3FHM A;  3HF7 A;  4P1G A;  3FV6 A;  4IY0 A;  2PFI A;  3L2B A;  2OOY E;  5K22 B;  1PVM A;  3PC3 A;  2EMQ A;  5IIP A;  3K2V A;  3K6E A;  2UV7 A;  4IY3 A;  4L0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...