The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
25
|
sequence length |
133
|
structure length |
133
|
Chain Sequence |
AMIKSWKPQELSISYHQFTVFQKDSTPPVMDWTDEAIEKGYAAADGAISFEAQRNTKAFILFRLNSSETVNSYEKKVTVPFHVTENGIHIESIMSKRLSFDLPKGDYQLTCWTVPAEMSDLHADTYIIDAVSV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of ComJ, inhibitor of the DNA degrading activity of NucA, from Bacillus subtilis
rcsb |
| molecule keywords |
DNA-entry nuclease inhibitor
|
| molecule tags |
Hydrolase inhibitor
|
| source organism |
Bacillus subtilis subsp. subtilis
|
| total genus |
25
|
| structure length |
133
|
| sequence length |
133
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature | |
| pdb deposition date | 2013-09-16 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF11033 | ComJ | Competence protein J (ComJ) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Substrate Binding Domain Of DNAk; Chain A, domain 1 | Substrate Binding Domain Of DNAk; Chain A, domain 1 |
#chains in the Genus database with same CATH superfamily 4MQD A; #chains in the Genus database with same CATH topology 4EZT A; 3D2F A; 4EZN A; 4JNE A; 5TKY A; 4EZR A; 4B9Q A; 4EZX A; 2V7Y A; 4EZP A; 4EZU A; 4JWD A; 4MQD A; 4F01 A; 3D2E A; 4FL9 A; 4WV7 A; 3DQG A; 4HY9 A; 2KHO A; 3ZEF A; 1DKY A; 3DPO A; 4EZW A; 1CKR A; 4I43 A; 2BPR A; 4EZY A; 1DKZ A; 1Q5L A; 1BPR A; 4EZQ A; 4E81 A; 4HYB A; 3SBS A; 4EZV A; 3N8E A; 1DKX A; 1U00 A; 4JWI A; 2QXL A; 4PO2 A; 2OP6 A; 3C7N B; 4JWE A; 3H0X A; 4EZO A; 4ILG A; 4R5I A; 3C7N A; 4R5K A; 3QNJ A; 4JNF A; 1DG4 A; 5E84 A; 4EZZ A; 3DOB A; 1YUW A; 3SBT B; 4R5L A; 4R5J A; 4R5G A; 4WV5 A; 3DPP A; 4ILH B; 7HSC A; 4JWC A; 4EZS A; 4JN4 A; 4ILI A; 4F00 A; 3DPQ A; #chains in the Genus database with same CATH homology 4EZT A; 3D2F A; 4EZN A; 4JNE A; 5TKY A; 4EZR A; 4B9Q A; 4EZX A; 2V7Y A; 4EZP A; 4EZU A; 4JWD A; 4MQD A; 4F01 A; 3D2E A; 4FL9 A; 4WV7 A; 3DQG A; 4HY9 A; 2KHO A; 3ZEF A; 1DKY A; 3DPO A; 4EZW A; 1CKR A; 4I43 A; 2BPR A; 4EZY A; 1DKZ A; 1Q5L A; 1BPR A; 4EZQ A; 4E81 A; 4HYB A; 3SBS A; 4EZV A; 3N8E A; 1DKX A; 1U00 A; 4JWI A; 2QXL A; 4PO2 A; 2OP6 A; 3C7N B; 4JWE A; 3H0X A; 4EZO A; 4ILG A; 4R5I A; 3C7N A; 4R5K A; 3QNJ A; 4JNF A; 1DG4 A; 5E84 A; 4EZZ A; 3DOB A; 1YUW A; 3SBT B; 4R5L A; 4R5J A; 4R5G A; 4WV5 A; 3DPP A; 4ILH B; 7HSC A; 4JWC A; 4EZS A; 4JN4 A; 4ILI A; 4F00 A; 3DPQ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...