1FSUA

Crystal structure of 4-sulfatase (human)
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
Knots found
sequence length
492
structure length
474
Chain Sequence
SRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-ACETYLGALACTOSAMINE-4-SULFATASE
publication title Structure of a human lysosomal sulfatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 164
structure length 474
sequence length 492
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.1.6.12: N-acetylgalactosamine-4-sulfatase.
pdb deposition date 1996-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.10 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 1fsuA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 1fsuA01
1SHQA 4KJDA 1E3CP 3BDGB 4UPKA 3A52A 3IGYB 2W5TA 4GTZA 3NKOA 1K7HA 1ALHA 4CXKA 2W5XA 3OT9A 4ZG6A 3NVLA 4LQYA 5C66A 4ZGAA 3MK2A 3M8WA 4LRCA 1EJJA 4KAVA 1O98A 3IDDA 1KHLA 3BDGA 3T02A 1E33P 1KH7A 3WAWA 1ZEBA 5IJSA 1ANJA 3UN2A 1EW2A 3T00A 1ANIA 1EW8A 4KM4A 3TG0A 1URBA 4LR9A 4MY4A 3NKQA 3UNYA 1E1ZP 1ALKA 5L0BA 2QZUA 1B8JA 3SZYA 1KH9A 3NKPA 5LRMA 4YR1A 5LIAA 1EQJA 5IJQA 4UPLA 1ALJA 4LR7A 3MK0A 3BDHA 2W8DA 3WAXA 5EGHA 4KAYA 3WAYA 3SZZA 3TX0A 3DYCA 3TWZA 3BDFA 5LRNA 4CYSA 1ZEFA 4LREA 2D1GA 4UORA 5HRTA 1AJAA 5K4PA 5LQQA 4NWXA 1KHJA 2ANHA 1KH4A 2W5WA 4TN0A 3M8ZA 2GSUA 2W5VA 2IFYA 3B5QA 4UPHA 1P49A 1ELYA 1AJCA 2GSNA 5DLWA 4GTWA 4UOPA 3ED4A 2ZKTA 2W5RA 3MK1A 4LR2A 4ZG7A 4FDIA 2X98A 5INHA 2IUCA 4FDJA 1ELXA 1HDHA 1ELZA 4LR8A 4UPIA 3WAVA 4N7TA 2RH6A 3CMRA 3T01A 3LXQA 1KH5A 5L0KA 2IUCB 3M8YA 1KHKA 3WBHA 5DLVA 1ALIA 1Y6VA 2XR9A 4LRAA 2GSOA 2VQRA 3E2DA 4GTYA 4MIVA 5KXAA 4B56A 1HQAA 5GRRA 1ED9A 4LRBA 1AJBA 3UO0A 1HJKA 2GLQA 3M7VA 4MHXA 4QAXA 2G9YA 5EGEA 3Q3QA 4LRDA 1AUKA 1URAA 3UN3A 5AJ9A 2XRGA 1E2SP 3KD8A 1O99A 2W8SA 4KJGA 2W5SA 1KHNA 3UN5A 4UOOA 1AJDA 3NKMA 1FSUA 5L0EA 1N2KA 4CXUA 3IGZB 4GTXA 2GA3A 1EI6A 3DPCA 5DLTA 4CXSA 1EW9A 1ED8A 3NKRA 1SHNA 2W5QA 4CYRA 4NWJA 1Y7AA 1N2LA 1ZEDA 5GOVA 4ZG9A 3NKNA 5TJ3A 4LRFA
chains in the Genus database with same CATH superfamily
3HIHA 1SHQA 4KJDA 1E3CP 3BDGB 4UPKA 3FS3A 4XB0A 3A52A 3IGYB 2W5TA 4GTZA 4LKLA 3NKOA 1K7HA 1ALHA 4CXKA 2W5XA 3Q1IA 3OT9A 3NVLA 4ZG6A 4LQYA 5C66A 4ZGAA 3MK2A 3GYVA 3M8WA 4LRCA 4WHLA 1UMWA 1EJJA 4KAVA 1O98A 3LM3A 4HABA 3IDDA 1KHLA 3BDGA 3T02A 1E33P 5DNJA 1KH7A 3P36A 4O6WA 1ZEBA 3WAWA 2IA9A 5IJSA 1ANJA 3UN2A 1EW2A 3T00A 1ANIA 1EW8A 4KM4A 3TG0A 1URBA 4LR9A 4MY4A 3NKQA 3UNYA 1E1ZP 1ALKA 5L0BA 2QZUA 3RQ7A 1B8JA 1KH9A 3NKPA 3P2WA 4WHKA 3HIKA 1EQJA 5DAYA 5IJQA 3SZYA 4UPLA 2N19A 4YR1A 1ALJA 4LR7A 3P35A 3MK0A 2E50A 3BDHA 4RS6A 2W8DA 3WAXA 5EGHA 4G7NA 4KAYA 5LRMA 3WAYA 4WHHA 3SZZA 3TX0A 4O9WA 4DFWA 3DYCA 3TWZA 3BDFA 5LRNA 4CYSA 1ZEFA 4LREA 4LKMA 2D1GA 4UORA 4E9CA 1AJAA 5K4PA 5HRTA 5LQQA 4NWXA 1KHJA 2ANHA 1KH4A 2W5WA 2VKZG 4TN0A 3HFDA 3M8ZA 4HCOA 2GSUA 4O56A 2W5VA 4X9RA 2IFYA 5LHZA 3B5QA 4UPHA 1P49A 1ELYA 1AJCA 5DMSA 2GSNA 4GTWA 5DLWA 4UOPA 3C5LA 3ED4A 2ZKTA 2W5RA 3MK1A 4LR2A 4ZG7A 4FDIA 2X98A 5INHA 2IUCA 4FDJA 1ELXA 2OGQA 5DMVC 1HDHA 1ELZA 2UV8G 4LR8A 4UPIA 3WAVA 4H5XA 4N7TA 3BZIA 2RH6A 3CMRA 3T01A 3GYWA 3LXQA 1KH5A 5L0KA 2IUCB 3M8YA 1KHKA 3WBHA 3KDRA 1E2TA 5DLVA 1ALIA 4N7ZA 1Y6VA 2XR9A 3HMJG 4LRAA 1F32A 4E9DA 2GSOA 2VQRA 3E2DA 4GTYA 2I9ZA 4MIVA 5KXAA 4B56A 1HQAA 5GRRA 3P2ZA 1ED9A 4NK7A 4LRBA 5J19A 1F34B 4RCPA 1AJBA 3UO0A 4H71A 3P37A 1HJKA 2GLQA 3P34A 3M7VA 4MHXA 2G9YA 4QAXA 4X9VA 3Q3QA 4LRDA 1AUKA 5EGEA 1URAA 3UN3A 2I9XA 5AJ9A 2XRGA 4X9WA 1E2SP 4E67A 1A87A 4HY2A 3KD8A 1O99A 2W8SA 4KJGA 2W5SA 1KHNA 4NKBA 3UN5A 4J7BB 4UOOA 3FVHA 1AJDA 3NKMA 1FSUA 5L0EA 1N2KA 4CXUA 2OJXA 3IGZB 1Q4OA 4N7VA 4GTXA 2GA3A 4N9JA 1EI6A 3DPCA 4CXSA 1Q4KA 5DLTA 1EW9A 5LIAA 1ED8A 3NKRA 1SHNA 2W5QA 4CYRA 5TJ3A 4NWJA 1Y7AA 1N2LA 1ZEDA 5GOVA 4ZG9A 3NKNA 4YYPA 4LRFA
chains in the Genus database with same CATH topology
1SHQA 4KJDA 1E3CP 3BDGB 4UPKA 3FS3A 3A52A 3IGYB 2W5TA 4GTZA 3NKOA 1K7HA 1ALHA 4CXKA 2W5XA 3OT9A 4ZG6A 3NVLA 4LQYA 5C66A 4ZGAA 3MK2A 3GYVA 3M8WA 4LRCA 1EJJA 4KAVA 1O98A 3LM3A 3IDDA 1KHLA 3BDGA 3T02A 1E33P 1KH7A 3WAWA 1ZEBA 5IJSA 1ANJA 3UN2A 1EW2A 3T00A 1ANIA 1EW8A 4KM4A 3TG0A 1URBA 4LR9A 4MY4A 3NKQA 3UNYA 1E1ZP 1ALKA 5L0BA 2QZUA 1B8JA 3SZYA 1KH9A 3NKPA 5LRMA 4YR1A 5LIAA 1EQJA 5DAYA 5IJQA 4UPLA 1ALJA 4LR7A 3MK0A 2E50A 3BDHA 2W8DA 3WAXA 5EGHA 4G7NA 4KAYA 3WAYA 3SZZA 3TX0A 3DYCA 3TWZA 3BDFA 5LRNA 4CYSA 1ZEFA 4LREA 2D1GA 4UORA 5HRTA 1AJAA 5K4PA 5LQQA 4NWXA 2ANHA 1KHJA 1KH4A 2W5WA 2VKZG 4TN0A 3HFDA 3M8ZA 2GSUA 2W5VA 2IFYA 3B5QA 4UPHA 1P49A 1ELYA 1AJCA 2GSNA 5DLWA 4GTWA 4UOPA 3ED4A 2ZKTA 2W5RA 3MK1A 4LR2A 4ZG7A 4FDIA 2X98A 5INHA 2IUCA 4FDJA 1ELXA 1HDHA 1ELZA 2UV8G 4LR8A 4UPIA 3WAVA 4N7TA 2RH6A 3CMRA 3T01A 3GYWA 3LXQA 1KH5A 5L0KA 2IUCB 3M8YA 1KHKA 3WBHA 3KDRA 1E2TA 5DLVA 1ALIA 4N7ZA 1Y6VA 2XR9A 3HMJG 4LRAA 2GSOA 2VQRA 3E2DA 4GTYA 4MIVA 5KXAA 4B56A 1HQAA 5GRRA 1ED9A 4NK7A 4LRBA 1AJBA 3UO0A 1HJKA 2GLQA 3M7VA 4MHXA 4QAXA 2G9YA 5EGEA 3Q3QA 4LRDA 1AUKA 1URAA 3UN3A 5AJ9A 2XRGA 1E2SP 3KD8A 1O99A 2W8SA 4KJGA 2W5SA 1KHNA 4NKBA 3UN5A 4UOOA 1AJDA 3NKMA 1FSUA 5L0EA 1N2KA 4CXUA 3IGZB 4N7VA 4GTXA 2GA3A 4N9JA 1EI6A 3DPCA 4CXSA 5DLTA 1EW9A 1ED8A 3NKRA 1SHNA 2W5QA 4CYRA 4NWJA 1Y7AA 1N2LA 1ZEDA 5GOVA 4ZG9A 3NKNA 5TJ3A 4LRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SHQ A;  4KJD A;  1E3C P;  3BDG B;  4UPK A;  3A52 A;  3IGY B;  2W5T A;  4GTZ A;  3NKO A;  1K7H A;  1ALH A;  4CXK A;  2W5X A;  3OT9 A;  4ZG6 A;  3NVL A;  4LQY A;  5C66 A;  4ZGA A;  3MK2 A;  3M8W A;  4LRC A;  1EJJ A;  4KAV A;  1O98 A;  3IDD A;  1KHL A;  3BDG A;  3T02 A;  1E33 P;  1KH7 A;  3WAW A;  1ZEB A;  5IJS A;  1ANJ A;  3UN2 A;  1EW2 A;  3T00 A;  1ANI A;  1EW8 A;  4KM4 A;  3TG0 A;  1URB A;  4LR9 A;  4MY4 A;  3NKQ A;  3UNY A;  1E1Z P;  1ALK A;  5L0B A;  2QZU A;  1B8J A;  3SZY A;  1KH9 A;  3NKP A;  5LRM A;  4YR1 A;  5LIA A;  1EQJ A;  5IJQ A;  4UPL A;  1ALJ A;  4LR7 A;  3MK0 A;  3BDH A;  2W8D A;  3WAX A;  5EGH A;  4KAY A;  3WAY A;  3SZZ A;  3TX0 A;  3DYC A;  3TWZ A;  3BDF A;  5LRN A;  4CYS A;  1ZEF A;  4LRE A;  2D1G A;  4UOR A;  5HRT A;  1AJA A;  5K4P A;  5LQQ A;  4NWX A;  1KHJ A;  2ANH A;  1KH4 A;  2W5W A;  4TN0 A;  3M8Z A;  2GSU A;  2W5V A;  2IFY A;  3B5Q A;  4UPH A;  1P49 A;  1ELY A;  1AJC A;  2GSN A;  5DLW A;  4GTW A;  4UOP A;  3ED4 A;  2ZKT A;  2W5R A;  3MK1 A;  4LR2 A;  4ZG7 A;  4FDI A;  2X98 A;  5INH A;  2IUC A;  4FDJ A;  1ELX A;  1HDH A;  1ELZ A;  4LR8 A;  4UPI A;  3WAV A;  4N7T A;  2RH6 A;  3CMR A;  3T01 A;  3LXQ A;  1KH5 A;  5L0K A;  2IUC B;  3M8Y A;  1KHK A;  3WBH A;  5DLV A;  1ALI A;  1Y6V A;  2XR9 A;  4LRA A;  2GSO A;  2VQR A;  3E2D A;  4GTY A;  4MIV A;  5KXA A;  4B56 A;  1HQA A;  5GRR A;  1ED9 A;  4LRB A;  1AJB A;  3UO0 A;  1HJK A;  2GLQ A;  3M7V A;  4MHX A;  4QAX A;  2G9Y A;  5EGE A;  3Q3Q A;  4LRD A;  1AUK A;  1URA A;  3UN3 A;  5AJ9 A;  2XRG A;  1E2S P;  3KD8 A;  1O99 A;  2W8S A;  4KJG A;  2W5S A;  1KHN A;  3UN5 A;  4UOO A;  1AJD A;  3NKM A;  1FSU A;  5L0E A;  1N2K A;  4CXU A;  3IGZ B;  4GTX A;  2GA3 A;  1EI6 A;  3DPC A;  5DLT A;  4CXS A;  1EW9 A;  1ED8 A;  3NKR A;  1SHN A;  2W5Q A;  4CYR A;  4NWJ A;  1Y7A A;  1N2L A;  1ZED A;  5GOV A;  4ZG9 A;  3NKN A;  5TJ3 A;  4LRF A; 
#chains in the Genus database with same CATH topology
 3HIH A;  1SHQ A;  4KJD A;  1E3C P;  3BDG B;  4UPK A;  3FS3 A;  4XB0 A;  3A52 A;  3IGY B;  2W5T A;  4GTZ A;  4LKL A;  3NKO A;  1K7H A;  1ALH A;  4CXK A;  2W5X A;  3Q1I A;  3OT9 A;  3NVL A;  4ZG6 A;  4LQY A;  5C66 A;  4ZGA A;  3MK2 A;  3GYV A;  3M8W A;  4LRC A;  4WHL A;  1UMW A;  1EJJ A;  4KAV A;  1O98 A;  3LM3 A;  4HAB A;  3IDD A;  1KHL A;  3BDG A;  3T02 A;  1E33 P;  5DNJ A;  1KH7 A;  3P36 A;  4O6W A;  1ZEB A;  3WAW A;  2IA9 A;  5IJS A;  1ANJ A;  3UN2 A;  1EW2 A;  3T00 A;  1ANI A;  1EW8 A;  4KM4 A;  3TG0 A;  1URB A;  4LR9 A;  4MY4 A;  3NKQ A;  3UNY A;  1E1Z P;  1ALK A;  5L0B A;  2QZU A;  3RQ7 A;  1B8J A;  1KH9 A;  3NKP A;  3P2W A;  4WHK A;  3HIK A;  1EQJ A;  5DAY A;  5IJQ A;  3SZY A;  4UPL A;  2N19 A;  4YR1 A;  1ALJ A;  4LR7 A;  3P35 A;  3MK0 A;  2E50 A;  3BDH A;  4RS6 A;  2W8D A;  3WAX A;  5EGH A;  4G7N A;  4KAY A;  5LRM A;  3WAY A;  4WHH A;  3SZZ A;  3TX0 A;  4O9W A;  4DFW A;  3DYC A;  3TWZ A;  3BDF A;  5LRN A;  4CYS A;  1ZEF A;  4LRE A;  4LKM A;  2D1G A;  4UOR A;  4E9C A;  1AJA A;  5K4P A;  5HRT A;  5LQQ A;  4NWX A;  1KHJ A;  2ANH A;  1KH4 A;  2W5W A;  2VKZ G;  4TN0 A;  3HFD A;  3M8Z A;  4HCO A;  2GSU A;  4O56 A;  2W5V A;  4X9R A;  2IFY A;  5LHZ A;  3B5Q A;  4UPH A;  1P49 A;  1ELY A;  1AJC A;  5DMS A;  2GSN A;  4GTW A;  5DLW A;  4UOP A;  3C5L A;  3ED4 A;  2ZKT A;  2W5R A;  3MK1 A;  4LR2 A;  4ZG7 A;  4FDI A;  2X98 A;  5INH A;  2IUC A;  4FDJ A;  1ELX A;  2OGQ A;  5DMV C;  1HDH A;  1ELZ A;  2UV8 G;  4LR8 A;  4UPI A;  3WAV A;  4H5X A;  4N7T A;  3BZI A;  2RH6 A;  3CMR A;  3T01 A;  3GYW A;  3LXQ A;  1KH5 A;  5L0K A;  2IUC B;  3M8Y A;  1KHK A;  3WBH A;  3KDR A;  1E2T A;  5DLV A;  1ALI A;  4N7Z A;  1Y6V A;  2XR9 A;  3HMJ G;  4LRA A;  1F32 A;  4E9D A;  2GSO A;  2VQR A;  3E2D A;  4GTY A;  2I9Z A;  4MIV A;  5KXA A;  4B56 A;  1HQA A;  5GRR A;  3P2Z A;  1ED9 A;  4NK7 A;  4LRB A;  5J19 A;  1F34 B;  4RCP A;  1AJB A;  3UO0 A;  4H71 A;  3P37 A;  1HJK A;  2GLQ A;  3P34 A;  3M7V A;  4MHX A;  2G9Y A;  4QAX A;  4X9V A;  3Q3Q A;  4LRD A;  1AUK A;  5EGE A;  1URA A;  3UN3 A;  2I9X A;  5AJ9 A;  2XRG A;  4X9W A;  1E2S P;  4E67 A;  1A87 A;  4HY2 A;  3KD8 A;  1O99 A;  2W8S A;  4KJG A;  2W5S A;  1KHN A;  4NKB A;  3UN5 A;  4J7B B;  4UOO A;  3FVH A;  1AJD A;  3NKM A;  1FSU A;  5L0E A;  1N2K A;  4CXU A;  2OJX A;  3IGZ B;  1Q4O A;  4N7V A;  4GTX A;  2GA3 A;  4N9J A;  1EI6 A;  3DPC A;  4CXS A;  1Q4K A;  5DLT A;  1EW9 A;  5LIA A;  1ED8 A;  3NKR A;  1SHN A;  2W5Q A;  4CYR A;  5TJ3 A;  4NWJ A;  1Y7A A;  1N2L A;  1ZED A;  5GOV A;  4ZG9 A;  3NKN A;  4YYP A;  4LRF A; 
#chains in the Genus database with same CATH homology
 1SHQ A;  4KJD A;  1E3C P;  3BDG B;  4UPK A;  3FS3 A;  3A52 A;  3IGY B;  2W5T A;  4GTZ A;  3NKO A;  1K7H A;  1ALH A;  4CXK A;  2W5X A;  3OT9 A;  4ZG6 A;  3NVL A;  4LQY A;  5C66 A;  4ZGA A;  3MK2 A;  3GYV A;  3M8W A;  4LRC A;  1EJJ A;  4KAV A;  1O98 A;  3LM3 A;  3IDD A;  1KHL A;  3BDG A;  3T02 A;  1E33 P;  1KH7 A;  3WAW A;  1ZEB A;  5IJS A;  1ANJ A;  3UN2 A;  1EW2 A;  3T00 A;  1ANI A;  1EW8 A;  4KM4 A;  3TG0 A;  1URB A;  4LR9 A;  4MY4 A;  3NKQ A;  3UNY A;  1E1Z P;  1ALK A;  5L0B A;  2QZU A;  1B8J A;  3SZY A;  1KH9 A;  3NKP A;  5LRM A;  4YR1 A;  5LIA A;  1EQJ A;  5DAY A;  5IJQ A;  4UPL A;  1ALJ A;  4LR7 A;  3MK0 A;  2E50 A;  3BDH A;  2W8D A;  3WAX A;  5EGH A;  4G7N A;  4KAY A;  3WAY A;  3SZZ A;  3TX0 A;  3DYC A;  3TWZ A;  3BDF A;  5LRN A;  4CYS A;  1ZEF A;  4LRE A;  2D1G A;  4UOR A;  5HRT A;  1AJA A;  5K4P A;  5LQQ A;  4NWX A;  2ANH A;  1KHJ A;  1KH4 A;  2W5W A;  2VKZ G;  4TN0 A;  3HFD A;  3M8Z A;  2GSU A;  2W5V A;  2IFY A;  3B5Q A;  4UPH A;  1P49 A;  1ELY A;  1AJC A;  2GSN A;  5DLW A;  4GTW A;  4UOP A;  3ED4 A;  2ZKT A;  2W5R A;  3MK1 A;  4LR2 A;  4ZG7 A;  4FDI A;  2X98 A;  5INH A;  2IUC A;  4FDJ A;  1ELX A;  1HDH A;  1ELZ A;  2UV8 G;  4LR8 A;  4UPI A;  3WAV A;  4N7T A;  2RH6 A;  3CMR A;  3T01 A;  3GYW A;  3LXQ A;  1KH5 A;  5L0K A;  2IUC B;  3M8Y A;  1KHK A;  3WBH A;  3KDR A;  1E2T A;  5DLV A;  1ALI A;  4N7Z A;  1Y6V A;  2XR9 A;  3HMJ G;  4LRA A;  2GSO A;  2VQR A;  3E2D A;  4GTY A;  4MIV A;  5KXA A;  4B56 A;  1HQA A;  5GRR A;  1ED9 A;  4NK7 A;  4LRB A;  1AJB A;  3UO0 A;  1HJK A;  2GLQ A;  3M7V A;  4MHX A;  4QAX A;  2G9Y A;  5EGE A;  3Q3Q A;  4LRD A;  1AUK A;  1URA A;  3UN3 A;  5AJ9 A;  2XRG A;  1E2S P;  3KD8 A;  1O99 A;  2W8S A;  4KJG A;  2W5S A;  1KHN A;  4NKB A;  3UN5 A;  4UOO A;  1AJD A;  3NKM A;  1FSU A;  5L0E A;  1N2K A;  4CXU A;  3IGZ B;  4N7V A;  4GTX A;  2GA3 A;  4N9J A;  1EI6 A;  3DPC A;  4CXS A;  5DLT A;  1EW9 A;  1ED8 A;  3NKR A;  1SHN A;  2W5Q A;  4CYR A;  4NWJ A;  1Y7A A;  1N2L A;  1ZED A;  5GOV A;  4ZG9 A;  3NKN A;  5TJ3 A;  4LRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...