3T02A

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with phosphonoacetate
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFANPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphonoacetate hydrolase
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
total genus 126
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3t02A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3t02A01
4GTZA 3SZYA 5TJ3A 2W5WA 4LR2A 4UOPA 3NKRA 5INHA 1ANIA 1O99A 3T00A 1AJDA 3CMRA 1KH4A 2RH6A 5HRTA 4MY4A 5AJ9A 3A52A 3B5QA 1SHQA 2IFYA 1KH7A 3IGZB 4UORA 3UN2A 4ZG7A 3TG0A 1ED9A 4LRCA 4UPLA 4LR9A 4ZG9A 3TWZA 5EGHA 4LREA 1HDHA 5IJQA 3WAWA 4CYRA 2W5QA 4KJGA 5L0KA 3NVLA 3TX0A 1ALKA 2W5TA 1EW2A 3WAYA 1E1ZP 3T01A 3UNYA 3Q3QA 5LRNA 2W8DA 3M7VA 1E2SP 4KAVA 3WAXA 3IGYB 1B8JA 3MK0A 5IJSA 3UN5A 1URAA 1URBA 5LQQA 3NKMA 3T02A 1ZEDA 3UN3A 1P49A 4B56A 2D1GA 5DLWA 3ED4A 1Y6VA 4MHXA 1KHJA 3M8YA 1K7HA 2GLQA 5DLTA 5LRMA 3M8ZA 3BDHA 4GTWA 4ZGAA 4NWXA 4ZG6A 4QAXA 5L0BA 2W5SA 3NKPA 1ALIA 4KAYA 1KHLA 4YR1A 1SHNA 4LR7A 1AJBA 3DPCA 1EI6A 3NKNA 1FSUA 2GA3A 4LQYA 1E33P 3WBHA 1HJKA 1HQAA 1N2LA 4CXUA 3NKOA 4LR8A 4LRBA 4MIVA 2GSOA 4NWJA 4TN0A 1ELXA 4FDIA 5GOVA 1EQJA 1ZEFA 2GSNA 1EW8A 1O98A 2X98A 1E3CP 2IUCB 3MK1A 5GRRA 5EGEA 4KJDA 2W5XA 4N7TA 4GTYA 3BDGA 4FDJA 5KXAA 5L0EA 1AJAA 1ED8A 1ANJA 3LXQA 4UPIA 2VQRA 4GTXA 3IDDA 3E2DA 1ALJA 2W5VA 1KHKA 3WAVA 1EW9A 4KM4A 1AJCA 2W5RA 1ALHA 2GSUA 1KHNA 3DYCA 2W8SA 4CXSA 2G9YA 4UOOA 3M8WA 5C66A 3BDGB 3UO0A 5LIAA 1ZEBA 2ZKTA 1KH5A 5DLVA 1ELZA 3KD8A 1AUKA 3NKQA 3MK2A 2IUCA 2XR9A 4CYSA 2QZUA 4UPHA 4CXKA 1KH9A 3SZZA 1ELYA 5K4PA 4UPKA 1N2KA 2ANHA 3BDFA 4LRDA 3OT9A 1EJJA 2XRGA 4LRFA 4LRAA 1Y7AA
chains in the Genus database with same CATH superfamily
5IYBK 5TJ3A 3SZYA 4UOPA 5IP9C 4AYBD 5IYDC 2B63C 1K83A 4XLPA 2PMZL 4A3BC 1ANIA 2W7VA 4FZBA 2VUMA 5AJ9A 2R93A 1XZQA 3L4KA 3GTOC 1SHQA 2IFYA 2FQOA 4A3CC 4KMDA 3UN2A 3GTJK 3S1MC 1TWHA 3TTGA 1EFWA 3RZOC 1YX2A 1TWGC 4LRCA 4LR9A 4GTDA 4YFKA 2W5QA 1JVIA 2VUMK 3H3VD 3K7AC 3WODA 1WCMK 3CQZC 4A3EK 3NVLA 4G0WA 1ALKA 3GTKA 4DDQA 4RMFA 3T01A 2W8DA 3TFHA 4BY1C 3FKIC 3M3YC 2JA8K 3T02A 3S1QC 3FKIK 4BY1K 4A3DC 4A3DK 1PJ6A 3S2DK 1XXAA 3ED4A 3LAPA 2D6FC 5IYCC 3I4MC 1K7HA 1IQ0A 1DCOA 1PJ7A 4OIOA 2E2IA 1TWGK 2NVXC 1PJ5A 3A8JA 4KAYA 3N0CA 1KHLA 1IE0A 2VUMC 1IBAA 3HOXK 4LR7A 4OINA 4BLBA 1K83C 4KAWX 3S1NC 3S1NK 4Y7NK 1HJKA 4P9SA 4KB4A 3M4OK 1XXBA 3TFIA 3HXAA 1BS2A 4G7OA 4A3GC 4TN0A 1TWGA 1ELXA 1USOA 4QJVA 1WSVA 4C3HK 1TWFK 4QIWL 3FHZA 1EW8A 2ZUEA 1AB4A 3MK1A 3H0GK 5C4JC 3TFJA 3GTKC 1J98A 5IP9K 3GDZA 5IYDK 4FDJA 1AJAA 4XSXA 4WJ4A 1ANJA 3LXQA 1ALJA 4AH6A 4YFXA 1Y1WK 3CAGA 1EW9A 5FLMK 1AJCA 2W5RA 2YU9K 4A93C 3HOYK 1ALHA 5JFEA 2W8SA 1C0AA 2PA8D 5C66A 1I50A 1ZVUA 5LIAA 4KMHA 1KH5A 1RU0A 1ELZA 5DLVA 3LPXA 2BE5A 4GFQA 3MK2A 1F9NA 1WIHA 2Y0SD 4CXKA 2JA6C 3RZDK 5CJ9A 1I3QC 4C45A 2GAHC 3SZZA 3FOEA 4Y52C 3GTJC 3HOWK 2NVYA 4UPKA 1BJTA 4GTAA 2P8TA 2ANHA 1EJJA 4KDDA 2R7ZC 4KM8A 1WORA 4OIPA 1Y7AA 4BKWA 1VGXA 5C3EK 5INHA 2JA5K 3GTPK 4FM9A 4OIRA 1AJDA 3AH5A 2RH6A 2JH3A 4MY4A 3GIRA 3HOZC 1TWAC 4GTFA 3A52A 3S2HC 3IGZB 3S1RK 3I4NC 4C3IC 4XSZA 4PAAA 3S17K 4A3MC 4ZG9A 3S14C 2JA5A 4LREA 3PO2C 3GTMC 4KJGA 4BXXK 5L0KA 4BY7K 2JA5C 3TX0A 1BGWA 5C3EC 3PO3K 1EW2A 1JOEA 1E1ZP 3WAYA 1YCLA 4GZYA 4A3LC 5LRNA 3GTLK 4KAVA 3IGYB 4GTEA 1I3QK 1URBA 2JA6K 1GE9A 1ZEDA 3UN3A 3GTLC 4B56A 1Y6VA 5IOTA 1IW7A 2EBBA 5DLTA 5LRMA 3GTMK 3M8ZA 3MMLB 3BDHA 4GTWA 4ZGAA 4OIQA 2NVQK 1I6HC 4NWXA 4GTLA 4LK0A 3PO3C 5L0BA 3CQZA 5IOSA 1SFOA 1XZPB 2RGRA 2W5SA 2JA6A 5M5WK 4BXXC 1TWHC 3A8KA 3NKNA 4LQYA 3S14K 3HOUC 3S17C 4GTBA 3AD8C 5C44K 5C44C 2CFAA 1XPPA 1B4BA 1INNA 3GTMA 2R93C 4C2MC 4X6AC 1WCMA 5M5XK 3HOZK 4A3FK 1O26A 1O98A 3AD7C 4YFNA 5GRRA 1ZBSA 4P5AA 4KJDA 4J3NA 3GTPC 2W5XA 3OREA 3HOWC 2JA7C 3BDGA 2XCRB 1ED8A 3H0GA 1K83K 3FKIA 2O5IA 4Y52K 3S0XA 3DXJA 3LAJA 2E2HC 4KM4A 4LOWA 2GSUA 2XCOA 4KN7A 3S16K 4A3LK 4UOOA 3M8WA 4WILA 2E2HA 1DCPA 1ZEBA 4ILDA 1EK8A 5IP7K 2IUCA 2QZUA 2JA8C 1KH9A 3S1RC 3GTKK 4LRDA 2E2JC 4LRFA 4JK1A 1TWAK 4GTZA 4G0UA 4LR2A 4A3GK 3NKRA 4A3KK 1O28A 1EQRA 3AQPA 1KH4A 1TWCC 1TWFC 1B4AA 3N0BA 1I50C 1Y1VA 4Q5SA 4G0VA 3GTQC 4UORA 4ZG7A 4A3CK 3M4OC 3TG0A 3GTOK 2PA8L 1YNNA 3L4JA 3RZDC 3H3VL 4XCHA 1ED9A 3TWZA 5EGHA 3BP3A 5C4XK 1G51A 4KATA 2R92C 5JVOA 3GEHA 3S2DC 3UNYA 2A68A 3M7VA 2WB1D 5IYCK 3I4MK 1WQFA 4ZH4A 3GTOA 1B8JA 3HOVC 3GTGA 3MK0A 3UN5A 2ZFZA 1J6XA 1URAA 1DCHA 1ZXOA 3M3YK 3NKMA 2E2IC 2R7ZA 5LQQA 3GTLA 1P49A 4C3JK 4C3JC 5DLWA 3S1QK 4A3JC 1KHJA 1I3QA 2R92K 4A3EC 1WCMC 3V4GA 3N3YA 3GSIA 5FJ8K 4C3HC 1Y1VC 4BBRC 1F7VA 2NVXA 4KN4A 3NKPA 4LLGA 1ALIA 4YR1A 3GTQK 1VRQC 3DPCA 2YU9A 3ADAC 1FSUA 2GA3A 1O24A 1VJEA 4Y7NC 1SFOC 1SFOK 1I50K 3JSTA 5IORA 2R92A 4NOIA 3RZOK 2Y0SL 1TWCK 1N2LA 3S1MK 3NKOA 4LR8A 4MIVA 4A3BK 4LJZA 2GSOA 2B63K 1XZPA 2NVXK 4FDIA 1ZQ1C 2CW0A 3NUHA 2PPBA 2GSNA 1EQJA 2X98A 2IUCB 4PABA 4A3KC 3G4AA 1YNJA 3FOFA 4N7TA 4A3JK 4GTYA 5IYBC 5KXAA 4GT9A 5HL8A 3GEIA 3GTPA 4UPIA 2E2IK 3E2DA 3GTJA 1TWHK 5IOQA 4MEXA 1KHKA 3HOVK 2B63A 1F7UA 1J6WA 4G7HA 3WAVA 4YG2A 1I6VA 3S16C 4KB2A 1EH1A 3BDGB 3CQZK 3IPJA 1WOPA 2GAGC 3K7AK 3KD8A 5C4XC 3NKQA 5L46A 2E2HK 3VA7A 4MEYA 2JA7K 3HKZD 1ELYA 4AYBL 3OT9A 1IS1A 1V5VA 2NVTC 2XRGA 1UV7A 4BBSK 2W5WA 4MQ9A 4C2MK 2R93K 1O99A 3T00A 1R9TC 3CMRA 3PO2K 2NVYC 2KWAA 5HRTA 4A3MK 3S15C 3GEEA 3QX3A 2JA7A 2E2JK 3BP8C 3HOUK 1HI9A 1WQHA 4X6AK 3B5QA 2P5MA 4GTCA 2V6TA 1KH7A 1O2FB 5D4DA 1X31C 5CHPA 2O5JA 4UPLA 1WQGA 3S15K 1IL2A 2NVQC 1KQ4A 1HDHA 5IJQA 2A6HA 3WAWA 4G7ZA 5M3FK 4CYRA 1VH2A 5IP7C 5M3MK 2W5TA 4BLAA 4A3IC 4O2DA 3Q3QA 1E2SP 1L0WA 2V6SA 3WAXA 5IJSA 1O27A 1O29A 2A6EA 3OPFA 2D1GA 4MHXA 1Y1WA 2ZUFA 3GTGK 3BUEA 1O25A 4BY7C 3M8YA 3ERED 2GLQA 1O2AA 3HOYC 1WOSA 4A3FC 4ZG6A 4QAXA 4A3IK 2Y3PA 1VLOA 4C3IK 4KC6A 1SHNA 1AJBA 1EI6A 2FQTA 1E33P 3WBHA 3OEPA 1WOOA 4KASA 2NVYK 3I4NK 1TWFA 2V6UA 3GTQA 1HQAA 4CXUA 4LRBA 5E68A 2PMZD 1R9TK 3H0GC 5C4JK 3AD9C 4KM9A 4NWJA 5GOVA 4BBSC 2WAQL 1I6HK 4WJ3M 1ZEFA 4KMUA 1USMA 5TMCA 1E3CP 3EQLA 5EGEA 4LK1A 1WSRA 1SMYA 2CFAB 1JQWA 1TWAA 3GTGC 5M5YK 5L0EA 1HQMA 3A8IA 2NVTK 2R7ZK 4P5BA 2VQRA 4GTXA 2XCQA 1ISEA 1R9TA 3IDDA 3HOXC 2W5VA 2PHCB 3AQOA 3HKZL 2WAQD 1Y1VK 4BBRK 4QIWD 4CXSA 1KHNA 3DYCA 4XLNA 2A69A 4M1XA 2G9YA 5FLMC 1ZYRA 1J6VA 3UO0A 2ZKTA 1XXCA 4QJVB 1XZQB 1AUKA 1O2BA 1DD5A 4A93K 2YU9C 4KARA 2XR9A 4CYSA 4KMAA 1BDFA 4UPHA 3G4CA 1F93A 1Y1WC 5TMFA 4Q4ZA 1TWCA 5K4PA 1N2KA 2WB1L 3S2HK 3BDFA 4LRAA
chains in the Genus database with same CATH topology
4GTZA 3SZYA 5TJ3A 2W5WA 4LR2A 4UOPA 3NKRA 5INHA 1ANIA 1O99A 3T00A 1AJDA 3CMRA 1KH4A 2RH6A 5HRTA 4MY4A 5AJ9A 3A52A 3B5QA 1SHQA 2IFYA 1KH7A 3IGZB 4UORA 3UN2A 4ZG7A 3TG0A 1ED9A 4LRCA 4UPLA 4LR9A 4ZG9A 3TWZA 5EGHA 4LREA 1HDHA 5IJQA 3WAWA 4CYRA 2W5QA 4KJGA 5L0KA 3NVLA 3TX0A 1ALKA 2W5TA 1EW2A 3WAYA 1E1ZP 3T01A 3UNYA 3Q3QA 5LRNA 2W8DA 3M7VA 1E2SP 4KAVA 3WAXA 3IGYB 1B8JA 3MK0A 5IJSA 3UN5A 1URAA 1URBA 5LQQA 3NKMA 3T02A 1ZEDA 3UN3A 1P49A 4B56A 2D1GA 5DLWA 3ED4A 1Y6VA 4MHXA 1KHJA 3M8YA 1K7HA 2GLQA 5DLTA 5LRMA 3M8ZA 3BDHA 4GTWA 4ZGAA 4NWXA 4ZG6A 4QAXA 5L0BA 2W5SA 3NKPA 1ALIA 4KAYA 1KHLA 4YR1A 1SHNA 4LR7A 1AJBA 3DPCA 1EI6A 3NKNA 1FSUA 2GA3A 4LQYA 1E33P 3WBHA 1HJKA 1HQAA 1N2LA 4CXUA 3NKOA 4LR8A 4LRBA 4MIVA 2GSOA 4NWJA 4TN0A 1ELXA 4FDIA 5GOVA 1EQJA 1ZEFA 2GSNA 1EW8A 1O98A 2X98A 1E3CP 2IUCB 3MK1A 5GRRA 5EGEA 4KJDA 2W5XA 4N7TA 4GTYA 3BDGA 4FDJA 5KXAA 5L0EA 1AJAA 1ED8A 1ANJA 3LXQA 4UPIA 2VQRA 4GTXA 3IDDA 3E2DA 1ALJA 2W5VA 1KHKA 3WAVA 1EW9A 4KM4A 1AJCA 2W5RA 1ALHA 2GSUA 1KHNA 3DYCA 2W8SA 4CXSA 2G9YA 4UOOA 3M8WA 5C66A 3BDGB 3UO0A 5LIAA 1ZEBA 2ZKTA 1KH5A 5DLVA 1ELZA 3KD8A 1AUKA 3NKQA 3MK2A 2IUCA 2XR9A 4CYSA 2QZUA 4UPHA 4CXKA 1KH9A 3SZZA 1ELYA 5K4PA 4UPKA 1N2KA 2ANHA 3BDFA 4LRDA 3OT9A 1EJJA 2XRGA 4LRFA 4LRAA 1Y7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTZ A;  3SZY A;  5TJ3 A;  2W5W A;  4LR2 A;  4UOP A;  3NKR A;  5INH A;  1ANI A;  1O99 A;  3T00 A;  1AJD A;  3CMR A;  1KH4 A;  2RH6 A;  5HRT A;  4MY4 A;  5AJ9 A;  3A52 A;  3B5Q A;  1SHQ A;  2IFY A;  1KH7 A;  3IGZ B;  4UOR A;  3UN2 A;  4ZG7 A;  3TG0 A;  1ED9 A;  4LRC A;  4UPL A;  4LR9 A;  4ZG9 A;  3TWZ A;  5EGH A;  4LRE A;  1HDH A;  5IJQ A;  3WAW A;  4CYR A;  2W5Q A;  4KJG A;  5L0K A;  3NVL A;  3TX0 A;  1ALK A;  2W5T A;  1EW2 A;  3WAY A;  1E1Z P;  3T01 A;  3UNY A;  3Q3Q A;  5LRN A;  2W8D A;  3M7V A;  1E2S P;  4KAV A;  3WAX A;  3IGY B;  1B8J A;  3MK0 A;  5IJS A;  3UN5 A;  1URA A;  1URB A;  5LQQ A;  3NKM A;  3T02 A;  1ZED A;  3UN3 A;  1P49 A;  4B56 A;  2D1G A;  5DLW A;  3ED4 A;  1Y6V A;  4MHX A;  1KHJ A;  3M8Y A;  1K7H A;  2GLQ A;  5DLT A;  5LRM A;  3M8Z A;  3BDH A;  4GTW A;  4ZGA A;  4NWX A;  4ZG6 A;  4QAX A;  5L0B A;  2W5S A;  3NKP A;  1ALI A;  4KAY A;  1KHL A;  4YR1 A;  1SHN A;  4LR7 A;  1AJB A;  3DPC A;  1EI6 A;  3NKN A;  1FSU A;  2GA3 A;  4LQY A;  1E33 P;  3WBH A;  1HJK A;  1HQA A;  1N2L A;  4CXU A;  3NKO A;  4LR8 A;  4LRB A;  4MIV A;  2GSO A;  4NWJ A;  4TN0 A;  1ELX A;  4FDI A;  5GOV A;  1EQJ A;  1ZEF A;  2GSN A;  1EW8 A;  1O98 A;  2X98 A;  1E3C P;  2IUC B;  3MK1 A;  5GRR A;  5EGE A;  4KJD A;  2W5X A;  4N7T A;  4GTY A;  3BDG A;  4FDJ A;  5KXA A;  5L0E A;  1AJA A;  1ED8 A;  1ANJ A;  3LXQ A;  4UPI A;  2VQR A;  4GTX A;  3IDD A;  3E2D A;  1ALJ A;  2W5V A;  1KHK A;  3WAV A;  1EW9 A;  4KM4 A;  1AJC A;  2W5R A;  1ALH A;  2GSU A;  1KHN A;  3DYC A;  2W8S A;  4CXS A;  2G9Y A;  4UOO A;  3M8W A;  5C66 A;  3BDG B;  3UO0 A;  5LIA A;  1ZEB A;  2ZKT A;  1KH5 A;  5DLV A;  1ELZ A;  3KD8 A;  1AUK A;  3NKQ A;  3MK2 A;  2IUC A;  2XR9 A;  4CYS A;  2QZU A;  4UPH A;  4CXK A;  1KH9 A;  3SZZ A;  1ELY A;  5K4P A;  4UPK A;  1N2K A;  2ANH A;  3BDF A;  4LRD A;  3OT9 A;  1EJJ A;  2XRG A;  4LRF A;  4LRA A;  1Y7A A; 
#chains in the Genus database with same CATH topology
 5IYB K;  5TJ3 A;  3SZY A;  4UOP A;  5IP9 C;  4AYB D;  5IYD C;  2B63 C;  1K83 A;  4XLP A;  2PMZ L;  4A3B C;  1ANI A;  2W7V A;  4FZB A;  2VUM A;  5AJ9 A;  2R93 A;  1XZQ A;  3L4K A;  3GTO C;  1SHQ A;  2IFY A;  2FQO A;  4A3C C;  4KMD A;  3UN2 A;  3GTJ K;  3S1M C;  1TWH A;  3TTG A;  1EFW A;  3RZO C;  1YX2 A;  1TWG C;  4LRC A;  4LR9 A;  4GTD A;  4YFK A;  2W5Q A;  1JVI A;  2VUM K;  3H3V D;  3K7A C;  3WOD A;  1WCM K;  3CQZ C;  4A3E K;  3NVL A;  4G0W A;  1ALK A;  3GTK A;  4DDQ A;  4RMF A;  3T01 A;  2W8D A;  3TFH A;  4BY1 C;  3FKI C;  3M3Y C;  2JA8 K;  3T02 A;  3S1Q C;  3FKI K;  4BY1 K;  4A3D C;  4A3D K;  1PJ6 A;  3S2D K;  1XXA A;  3ED4 A;  3LAP A;  2D6F C;  5IYC C;  3I4M C;  1K7H A;  1IQ0 A;  1DCO A;  1PJ7 A;  4OIO A;  2E2I A;  1TWG K;  2NVX C;  1PJ5 A;  3A8J A;  4KAY A;  3N0C A;  1KHL A;  1IE0 A;  2VUM C;  1IBA A;  3HOX K;  4LR7 A;  4OIN A;  4BLB A;  1K83 C;  4KAW X;  3S1N C;  3S1N K;  4Y7N K;  1HJK A;  4P9S A;  4KB4 A;  3M4O K;  1XXB A;  3TFI A;  3HXA A;  1BS2 A;  4G7O A;  4A3G C;  4TN0 A;  1TWG A;  1ELX A;  1USO A;  4QJV A;  1WSV A;  4C3H K;  1TWF K;  4QIW L;  3FHZ A;  1EW8 A;  2ZUE A;  1AB4 A;  3MK1 A;  3H0G K;  5C4J C;  3TFJ A;  3GTK C;  1J98 A;  5IP9 K;  3GDZ A;  5IYD K;  4FDJ A;  1AJA A;  4XSX A;  4WJ4 A;  1ANJ A;  3LXQ A;  1ALJ A;  4AH6 A;  4YFX A;  1Y1W K;  3CAG A;  1EW9 A;  5FLM K;  1AJC A;  2W5R A;  2YU9 K;  4A93 C;  3HOY K;  1ALH A;  5JFE A;  2W8S A;  1C0A A;  2PA8 D;  5C66 A;  1I50 A;  1ZVU A;  5LIA A;  4KMH A;  1KH5 A;  1RU0 A;  1ELZ A;  5DLV A;  3LPX A;  2BE5 A;  4GFQ A;  3MK2 A;  1F9N A;  1WIH A;  2Y0S D;  4CXK A;  2JA6 C;  3RZD K;  5CJ9 A;  1I3Q C;  4C45 A;  2GAH C;  3SZZ A;  3FOE A;  4Y52 C;  3GTJ C;  3HOW K;  2NVY A;  4UPK A;  1BJT A;  4GTA A;  2P8T A;  2ANH A;  1EJJ A;  4KDD A;  2R7Z C;  4KM8 A;  1WOR A;  4OIP A;  1Y7A A;  4BKW A;  1VGX A;  5C3E K;  5INH A;  2JA5 K;  3GTP K;  4FM9 A;  4OIR A;  1AJD A;  3AH5 A;  2RH6 A;  2JH3 A;  4MY4 A;  3GIR A;  3HOZ C;  1TWA C;  4GTF A;  3A52 A;  3S2H C;  3IGZ B;  3S1R K;  3I4N C;  4C3I C;  4XSZ A;  4PAA A;  3S17 K;  4A3M C;  4ZG9 A;  3S14 C;  2JA5 A;  4LRE A;  3PO2 C;  3GTM C;  4KJG A;  4BXX K;  5L0K A;  4BY7 K;  2JA5 C;  3TX0 A;  1BGW A;  5C3E C;  3PO3 K;  1EW2 A;  1JOE A;  1E1Z P;  3WAY A;  1YCL A;  4GZY A;  4A3L C;  5LRN A;  3GTL K;  4KAV A;  3IGY B;  4GTE A;  1I3Q K;  1URB A;  2JA6 K;  1GE9 A;  1ZED A;  3UN3 A;  3GTL C;  4B56 A;  1Y6V A;  5IOT A;  1IW7 A;  2EBB A;  5DLT A;  5LRM A;  3GTM K;  3M8Z A;  3MML B;  3BDH A;  4GTW A;  4ZGA A;  4OIQ A;  2NVQ K;  1I6H C;  4NWX A;  4GTL A;  4LK0 A;  3PO3 C;  5L0B A;  3CQZ A;  5IOS A;  1SFO A;  1XZP B;  2RGR A;  2W5S A;  2JA6 A;  5M5W K;  4BXX C;  1TWH C;  3A8K A;  3NKN A;  4LQY A;  3S14 K;  3HOU C;  3S17 C;  4GTB A;  3AD8 C;  5C44 K;  5C44 C;  2CFA A;  1XPP A;  1B4B A;  1INN A;  3GTM A;  2R93 C;  4C2M C;  4X6A C;  1WCM A;  5M5X K;  3HOZ K;  4A3F K;  1O26 A;  1O98 A;  3AD7 C;  4YFN A;  5GRR A;  1ZBS A;  4P5A A;  4KJD A;  4J3N A;  3GTP C;  2W5X A;  3ORE A;  3HOW C;  2JA7 C;  3BDG A;  2XCR B;  1ED8 A;  3H0G A;  1K83 K;  3FKI A;  2O5I A;  4Y52 K;  3S0X A;  3DXJ A;  3LAJ A;  2E2H C;  4KM4 A;  4LOW A;  2GSU A;  2XCO A;  4KN7 A;  3S16 K;  4A3L K;  4UOO A;  3M8W A;  4WIL A;  2E2H A;  1DCP A;  1ZEB A;  4ILD A;  1EK8 A;  5IP7 K;  2IUC A;  2QZU A;  2JA8 C;  1KH9 A;  3S1R C;  3GTK K;  4LRD A;  2E2J C;  4LRF A;  4JK1 A;  1TWA K;  4GTZ A;  4G0U A;  4LR2 A;  4A3G K;  3NKR A;  4A3K K;  1O28 A;  1EQR A;  3AQP A;  1KH4 A;  1TWC C;  1TWF C;  1B4A A;  3N0B A;  1I50 C;  1Y1V A;  4Q5S A;  4G0V A;  3GTQ C;  4UOR A;  4ZG7 A;  4A3C K;  3M4O C;  3TG0 A;  3GTO K;  2PA8 L;  1YNN A;  3L4J A;  3RZD C;  3H3V L;  4XCH A;  1ED9 A;  3TWZ A;  5EGH A;  3BP3 A;  5C4X K;  1G51 A;  4KAT A;  2R92 C;  5JVO A;  3GEH A;  3S2D C;  3UNY A;  2A68 A;  3M7V A;  2WB1 D;  5IYC K;  3I4M K;  1WQF A;  4ZH4 A;  3GTO A;  1B8J A;  3HOV C;  3GTG A;  3MK0 A;  3UN5 A;  2ZFZ A;  1J6X A;  1URA A;  1DCH A;  1ZXO A;  3M3Y K;  3NKM A;  2E2I C;  2R7Z A;  5LQQ A;  3GTL A;  1P49 A;  4C3J K;  4C3J C;  5DLW A;  3S1Q K;  4A3J C;  1KHJ A;  1I3Q A;  2R92 K;  4A3E C;  1WCM C;  3V4G A;  3N3Y A;  3GSI A;  5FJ8 K;  4C3H C;  1Y1V C;  4BBR C;  1F7V A;  2NVX A;  4KN4 A;  3NKP A;  4LLG A;  1ALI A;  4YR1 A;  3GTQ K;  1VRQ C;  3DPC A;  2YU9 A;  3ADA C;  1FSU A;  2GA3 A;  1O24 A;  1VJE A;  4Y7N C;  1SFO C;  1SFO K;  1I50 K;  3JST A;  5IOR A;  2R92 A;  4NOI A;  3RZO K;  2Y0S L;  1TWC K;  1N2L A;  3S1M K;  3NKO A;  4LR8 A;  4MIV A;  4A3B K;  4LJZ A;  2GSO A;  2B63 K;  1XZP A;  2NVX K;  4FDI A;  1ZQ1 C;  2CW0 A;  3NUH A;  2PPB A;  2GSN A;  1EQJ A;  2X98 A;  2IUC B;  4PAB A;  4A3K C;  3G4A A;  1YNJ A;  3FOF A;  4N7T A;  4A3J K;  4GTY A;  5IYB C;  5KXA A;  4GT9 A;  5HL8 A;  3GEI A;  3GTP A;  4UPI A;  2E2I K;  3E2D A;  3GTJ A;  1TWH K;  5IOQ A;  4MEX A;  1KHK A;  3HOV K;  2B63 A;  1F7U A;  1J6W A;  4G7H A;  3WAV A;  4YG2 A;  1I6V A;  3S16 C;  4KB2 A;  1EH1 A;  3BDG B;  3CQZ K;  3IPJ A;  1WOP A;  2GAG C;  3K7A K;  3KD8 A;  5C4X C;  3NKQ A;  5L46 A;  2E2H K;  3VA7 A;  4MEY A;  2JA7 K;  3HKZ D;  1ELY A;  4AYB L;  3OT9 A;  1IS1 A;  1V5V A;  2NVT C;  2XRG A;  1UV7 A;  4BBS K;  2W5W A;  4MQ9 A;  4C2M K;  2R93 K;  1O99 A;  3T00 A;  1R9T C;  3CMR A;  3PO2 K;  2NVY C;  2KWA A;  5HRT A;  4A3M K;  3S15 C;  3GEE A;  3QX3 A;  2JA7 A;  2E2J K;  3BP8 C;  3HOU K;  1HI9 A;  1WQH A;  4X6A K;  3B5Q A;  2P5M A;  4GTC A;  2V6T A;  1KH7 A;  1O2F B;  5D4D A;  1X31 C;  5CHP A;  2O5J A;  4UPL A;  1WQG A;  3S15 K;  1IL2 A;  2NVQ C;  1KQ4 A;  1HDH A;  5IJQ A;  2A6H A;  3WAW A;  4G7Z A;  5M3F K;  4CYR A;  1VH2 A;  5IP7 C;  5M3M K;  2W5T A;  4BLA A;  4A3I C;  4O2D A;  3Q3Q A;  1E2S P;  1L0W A;  2V6S A;  3WAX A;  5IJS A;  1O27 A;  1O29 A;  2A6E A;  3OPF A;  2D1G A;  4MHX A;  1Y1W A;  2ZUF A;  3GTG K;  3BUE A;  1O25 A;  4BY7 C;  3M8Y A;  3ERE D;  2GLQ A;  1O2A A;  3HOY C;  1WOS A;  4A3F C;  4ZG6 A;  4QAX A;  4A3I K;  2Y3P A;  1VLO A;  4C3I K;  4KC6 A;  1SHN A;  1AJB A;  1EI6 A;  2FQT A;  1E33 P;  3WBH A;  3OEP A;  1WOO A;  4KAS A;  2NVY K;  3I4N K;  1TWF A;  2V6U A;  3GTQ A;  1HQA A;  4CXU A;  4LRB A;  5E68 A;  2PMZ D;  1R9T K;  3H0G C;  5C4J K;  3AD9 C;  4KM9 A;  4NWJ A;  5GOV A;  4BBS C;  2WAQ L;  1I6H K;  4WJ3 M;  1ZEF A;  4KMU A;  1USM A;  5TMC A;  1E3C P;  3EQL A;  5EGE A;  4LK1 A;  1WSR A;  1SMY A;  2CFA B;  1JQW A;  1TWA A;  3GTG C;  5M5Y K;  5L0E A;  1HQM A;  3A8I A;  2NVT K;  2R7Z K;  4P5B A;  2VQR A;  4GTX A;  2XCQ A;  1ISE A;  1R9T A;  3IDD A;  3HOX C;  2W5V A;  2PHC B;  3AQO A;  3HKZ L;  2WAQ D;  1Y1V K;  4BBR K;  4QIW D;  4CXS A;  1KHN A;  3DYC A;  4XLN A;  2A69 A;  4M1X A;  2G9Y A;  5FLM C;  1ZYR A;  1J6V A;  3UO0 A;  2ZKT A;  1XXC A;  4QJV B;  1XZQ B;  1AUK A;  1O2B A;  1DD5 A;  4A93 K;  2YU9 C;  4KAR A;  2XR9 A;  4CYS A;  4KMA A;  1BDF A;  4UPH A;  3G4C A;  1F93 A;  1Y1W C;  5TMF A;  4Q4Z A;  1TWC A;  5K4P A;  1N2K A;  2WB1 L;  3S2H K;  3BDF A;  4LRA A; 
#chains in the Genus database with same CATH homology
 4GTZ A;  3SZY A;  5TJ3 A;  2W5W A;  4LR2 A;  4UOP A;  3NKR A;  5INH A;  1ANI A;  1O99 A;  3T00 A;  1AJD A;  3CMR A;  1KH4 A;  2RH6 A;  5HRT A;  4MY4 A;  5AJ9 A;  3A52 A;  3B5Q A;  1SHQ A;  2IFY A;  1KH7 A;  3IGZ B;  4UOR A;  3UN2 A;  4ZG7 A;  3TG0 A;  1ED9 A;  4LRC A;  4UPL A;  4LR9 A;  4ZG9 A;  3TWZ A;  5EGH A;  4LRE A;  1HDH A;  5IJQ A;  3WAW A;  4CYR A;  2W5Q A;  4KJG A;  5L0K A;  3NVL A;  3TX0 A;  1ALK A;  2W5T A;  1EW2 A;  3WAY A;  1E1Z P;  3T01 A;  3UNY A;  3Q3Q A;  5LRN A;  2W8D A;  3M7V A;  1E2S P;  4KAV A;  3WAX A;  3IGY B;  1B8J A;  3MK0 A;  5IJS A;  3UN5 A;  1URA A;  1URB A;  5LQQ A;  3NKM A;  3T02 A;  1ZED A;  3UN3 A;  1P49 A;  4B56 A;  2D1G A;  5DLW A;  3ED4 A;  1Y6V A;  4MHX A;  1KHJ A;  3M8Y A;  1K7H A;  2GLQ A;  5DLT A;  5LRM A;  3M8Z A;  3BDH A;  4GTW A;  4ZGA A;  4NWX A;  4ZG6 A;  4QAX A;  5L0B A;  2W5S A;  3NKP A;  1ALI A;  4KAY A;  1KHL A;  4YR1 A;  1SHN A;  4LR7 A;  1AJB A;  3DPC A;  1EI6 A;  3NKN A;  1FSU A;  2GA3 A;  4LQY A;  1E33 P;  3WBH A;  1HJK A;  1HQA A;  1N2L A;  4CXU A;  3NKO A;  4LR8 A;  4LRB A;  4MIV A;  2GSO A;  4NWJ A;  4TN0 A;  1ELX A;  4FDI A;  5GOV A;  1EQJ A;  1ZEF A;  2GSN A;  1EW8 A;  1O98 A;  2X98 A;  1E3C P;  2IUC B;  3MK1 A;  5GRR A;  5EGE A;  4KJD A;  2W5X A;  4N7T A;  4GTY A;  3BDG A;  4FDJ A;  5KXA A;  5L0E A;  1AJA A;  1ED8 A;  1ANJ A;  3LXQ A;  4UPI A;  2VQR A;  4GTX A;  3IDD A;  3E2D A;  1ALJ A;  2W5V A;  1KHK A;  3WAV A;  1EW9 A;  4KM4 A;  1AJC A;  2W5R A;  1ALH A;  2GSU A;  1KHN A;  3DYC A;  2W8S A;  4CXS A;  2G9Y A;  4UOO A;  3M8W A;  5C66 A;  3BDG B;  3UO0 A;  5LIA A;  1ZEB A;  2ZKT A;  1KH5 A;  5DLV A;  1ELZ A;  3KD8 A;  1AUK A;  3NKQ A;  3MK2 A;  2IUC A;  2XR9 A;  4CYS A;  2QZU A;  4UPH A;  4CXK A;  1KH9 A;  3SZZ A;  1ELY A;  5K4P A;  4UPK A;  1N2K A;  2ANH A;  3BDF A;  4LRD A;  3OT9 A;  1EJJ A;  2XRG A;  4LRF A;  4LRA A;  1Y7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...