3TX0A

Unphosphorylated bacillus cereus phosphopentomutase in a p212121 crystal form
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
Knots found
sequence length
391
structure length
391
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDTMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 143
structure length 391
sequence length 391
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3tx0A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3tx0A01
3Q3QA 1ED9A 5GOVA 2IUCA 2GSOA 4N7TA 4LR9A 1KHLA 3M8WA 2D1GA 3M7VA 4B56A 1KHNA 1B8JA 3KD8A 4GTWA 1P49A 4KM4A 3M8YA 1Y6VA 1EW2A 1KHJA 3NKMA 1EW8A 4LRFA 1FSUA 5LRMA 4YR1A 3LXQA 3NKQA 5EGEA 1N2KA 4LR2A 1E33P 2W8SA 3IDDA 1KH9A 2GA3A 2W5QA 3MK2A 4LRAA 4KAVA 3NVLA 4LQYA 4UPHA 2RH6A 1O98A 3ED4A 3UO0A 1ZEDA 3UN3A 1K7HA 4UPLA 2GLQA 1ELYA 3BDGB 3NKNA 3UNYA 1E1ZP 2VQRA 1E3CP 1N2LA 2ZKTA 1HDHA 3MK0A 4CXUA 1AJAA 5KXAA 1EW9A 3CMRA 4UORA 3E2DA 1URAA 3DYCA 4UPIA 3B5QA 2X98A 3UN5A 4LR7A 4FDJA 4LRBA 1ELZA 3T00A 4UOPA 5K4PA 1O99A 1SHQA 3WAVA 4CXSA 3WAWA 5LIAA 1ZEBA 5C66A 1KH7A 3WAYA 3NKPA 2IFYA 1EJJA 4ZG9A 5IJSA 3A52A 4MIVA 1ALHA 3SZYA 5IJQA 3T02A 1ALKA 3SZZA 3BDHA 2W5SA 1ZEFA 1AJCA 3DPCA 1EQJA 3WAXA 1HJKA 2IUCB 5L0EA 2W5TA 4KJDA 5INHA 3OT9A 2W5VA 4CYRA 5TJ3A 1URBA 4ZG7A 1AJBA 4UOOA 4ZGAA 3TWZA 2QZUA 5HRTA 2XRGA 2W5WA 1KHKA 1Y7AA 4FDIA 4NWJA 2W8DA 5DLWA 5L0BA 3TX0A 3TG0A 5EGHA 1SHNA 2GSUA 1AUKA 5DLVA 4GTXA 1ED8A 4TN0A 2ANHA 2XR9A 5LRNA 4QAXA 2GSNA 4GTZA 3BDGA 4CXKA 2W5XA 4KJGA 5GRRA 3WBHA 5LQQA 4MHXA 3NKOA 1AJDA 4LRCA 4UPKA 1ELXA 1HQAA 3NKRA 5DLTA 3BDFA 3MK1A 4LRDA 1ANJA 3M8ZA 2G9YA 1ALJA 1E2SP 4MY4A 1ALIA 3T01A 1EI6A 4CYSA 4LR8A 4LREA 5AJ9A 4ZG6A 1ANIA 2W5RA 3IGYB 3UN2A 1KH5A 3IGZB 4GTYA 4NWXA 1KH4A 5L0KA 4KAYA
chains in the Genus database with same CATH superfamily
4OJGA 2Z4PA 3IBCB 3KG4A 2AJ1A 3I9ZA 2RQMA 1A7GE 3K7RA 3Q24A 4DR2J 1QVGR 4PWDA 4H4OB 4PXBA 2VU5A 2ZDOA 4X62J 2V34A 1XNRF 1F2GA 2A6MA 2OI2A 3DGPB 4Y65A 5L1JA 2BJDA 3TANA 5KG0A 4C8KA 1CLFA 3P8BB 2B9WA 4ZN3A 3SCKE 3CJQA 2KFZA 4LFBJ 2JEGA 3KKFA 4FPIA 2L9NA 5HATA 2DRDA 3R97A 1YWXA 4LF9J 2PN6A 2EC0A 4I69A 3ZZPA 2IIHA 2OPSB 3KLGB 2K1RA 4EU0A 2E9ZA 1IM4A 3SFGA 3M8SA 4CI0B 2N7YA 2YX7A 4RW4A 5HROA 4NA3A 2ZZMA 4G1QB 2GA3A 2W5QA 1F5BA 4NLYA 3QO9A 3S1TA 4LIWA 3W2WA 2UU9J 2PA3A 5B0AA 4G65A 4TLQA 3QMQA 4F50A 3OFEA 4IG0A 3ULHA 3ISZA 5B0GA 3SCJE 3WC2A 2FYXA 2MTLA 3I6PA 1FK9B 1PG5B 1U1NA 3UN3A 1RTDA 2VFSA 3LP2A 3N5BA 4RWXA 4WTYA 3R5JB 4NCGA 3AJDA 2CQ4A 2U2FA 4DL0C 5AJ3J 4R8UA 4AL5A 1JLAB 1SC6A 3CCMS 2BR0A 1TQLA 1RTJA 1FDBA 2LXFA 4KO0A 3VAGA 1NZ8A 1ZA1B 2G13A 2XY7A 1PGZA 1AJAA 1TL7B 3IWLA 5L8RC 1VBXA 1Q86T 4JBCA 2FJBB 1RHJB 4OX9F 2JEJA 4LF7F 5U47A 1Q79A 3K5OA 2PEHA 3MM7A 4DPUA 2ALYB 2QE5A 4Q45A 5DLFA 3NNCA 1CS4B 5EWEA 1UWAA 3OL9A 2GZOA 2WZ1A 2DBBA 3R6GB 4RPFA 4K0KJ 4H4OA 1MLAA 2W24A 3EXCX 1IKWB 2O1PA 3H7HB 4NZ7A 5LT5A 4LF5F 2VZ9A 3K0JA 4DX6A 2Q79A 2QFJA 4MJKA 3GV5B 1S77D 1HYSA 2HS0A 4P72A 4DUZF 3A52A 3SBMA 3BPSP 3BN7A 4DFKA 1F3FA 4NLPA 2KZZA 1BQMB 4O3OA 3NY0A 3RRKA 5I42B 3HZEA 1XMOJ 4C8ZA 2VH7A 5J1EB 2PD1A 4RU9A 4PPZA 4R25A 4DFMA 5L0EA 5M2UA 1ZM3A 1BLUA 4O0NA 3H59A 3NOGA 5KFMA 2YXLA 2DNOA 2J0QD 3JTOA 5EWFA 6FD1A 2EG1A 2F8EX 1M1HA 3PR5B 3CULA 1XR6A 3TWZA 1M5PC 3AOBA 2DNNA 4ECYA 2VG6A 5ETTA 2JH3A 3PVXA 4I64A 4USUA 4P6QA 4ZVGA 1HMVA 1Q1KA 2GMHA 4OI6A 1A0OB 3DC2A 4OYXA 1S1WA 4JV0A 4DJBA 4OI0A 1TKZA 2Y1JA 1GH8A 3I4PA 2KM8C 4N8OA 3MMCA 3TA0A 1F5CA 2PMWA 2ZNZA 5AE2A 2RAQA 4Z7YA 2VFVA 4ED0A 4NLTA 4MHXA 4J9KA 1FO1A 4G6VB 4WU3A 5IZHA 1Y5LB 5C5JA 1DY3A 1LW0A 4DLEA 4C11A 3B54A 2UVUA 4O4GB 2CA9A 1FX4A 2YNIA 1LKZA 3UDLA 3HVTB 4ES2A 4O3SA 3M8QA 1DAXA 4YDXA 2PDAA 3WZ0A 3PW7A 1N34J 4A8SA 4KYZA 5A8RB 2N82B 2IRUA 2JLFA 1S6QB 3MWBA 3KWMA 4RW6B 2I6WA 2EK1A 1U02A 2NUUG 2VF3A 3PKYA 3PW4A 1V5IB 4ZP9A 3I96A 3ISND 3VR1A 2VG7B 4LVNP 4ETZA 4U95A 5KFOA 3KK1B 3SYZA 1D9DA 4N7TA 2W7PA 3RRGA 2HVDA 4V1Ak 1WEXA 3AXMA 2BJ8A 2BUNA 1HD0A 5HP1A 2DHHA 1S48A 2KJWA 2HIQA 2XEXA 1PO6A 3C14A 2IM0A 5C24B 1REVB 2UVRA 1S1UA 1PAUB 4N56A 2VG5B 3K17A 4ENOA 1ZOTA 3PYFA 2C1EB 3P5BP 4LRFA 2BYCA 4I2PB 5D4PA 4ECXA 5MLCV 1X4EA 4DLGA 4A8YA 2Y3YA 4B9SA 2H48B 4TY8B 3R6LB 1C4CA 2RU3A 2LDYA 4QR2A 5AXLA 5FLXY 1HWIA 2MB0B 3D0GE 4UQGA 2Q43A 3MK2A 3MEGB 4LRAA 2C22A 4M95A 4KAVA 3NCQA 4EZ9A 3QRPA 1CJVA 4CM2A 4RW9B 4LSLA 3PRVA 3V4MA 3K57A 1E6YB 1D3WA 1B99A 4IDKB 5AXMA 1LV5A 2J7KA 5B0FA 3L95X 2BJ3A 4AQYF 2ALZA 2HFSA 1TMMA 4J9VA 2CVIA 4X4OA 1NK0A 1NSQA 2JEIA 4F26A 4AL6A 1BQMA 2W2OP 4U9RA 1NO8A 1X9MA 5K8NA 1NJWA 1WG4A 4CLKA 2W25A 4C0OC 1WNEA 1RWVB 4QZVB 5H1SV 2V2VA 3G71S 4ES1A 2DH7A 3N28A 3PIPQ 1D0EA 4C8OA 4NASA 1KONA 1TKXB 3NWGA 5LOQA 4O0IA 4LF8J 4PYDA 5B0EA 5D4OA 4DR7F 2BQ3A 3HCXA 2XHWA 1ZBTA 3GFHA 3KXDA 1RJJA 2CQ3A 1ELZA 3T00A 3UD5A 4A8MP 1GT8A 3GE9A 4WFAQ 2UXBJ 2CWKA 2OPPB 3BKUA 3CJRA 3O8WA 3ZZTA 5IFMA 1T0TV 1VRUB 3QT7A 3LAKA 3KUGA 2M70A 4U67Q 1SH0A 2VBXA 5KFQA 2DGSA 2IAJB 2YVSA 4CLYA 1EHWA 1Q95G 2O5DA 3CDAA 2VQFJ 3KFWX 3FMBA 4X4TA 2XYGB 1WSVA 2AD9A 4I56A 1VQ7S 4RO0A 1T05B 3SZYA 2QEXS 2WAQD 3KUEA 4ZVFA 1Z2ZA 1MROA 5MAOA 1S0OA 1ALKA 3SZZA 1V6HA 4BHQA 2CQHA 2W5SA 3DPCA 1XNQJ 2GIFA 4JI8J 3W64A 3PFEA 1F60B 3OT9A 1FWPA 2MQ8A 5I3QA 5GAGU 1HBMB 5EX3A 2HIYA 3G96A 2A2DA 1H73A 5CD4A 4QOTA 5HMZA 1CVJA 3HHLC 1AT1B 4KPCA 1XERA 1Y5NB 2G2ZA 1V9OA 3THPA 5HRTA 4CO5A 1S0NA 2KDOA 1FXDA 2XMKA 2YY3A 3K8VA 1VRTB 4H4KA 4PAAA 4RLEA 1P1LA 5E3PA 1RT4A 1GMWD 2OEMA 3BH7B 3P4UB 5HMYA 2UXCJ 2AJQA 5F41A 3IS9A 2NXUA 3BO4A 2DHGA 4OJ3A 4B9UA 2R2UA 3DKDA 4X4VA 2DEIA 2GAGC 2XTJP 3JTPA 4EBEA 1WWHA 1KSPA 4L72B 2QLXA 4X4QA 2MQOA 4ED2A 3RB6A 4OX7A 2W5XA 1IBKF 4U6PA 3WBHA 3J81j 2CIMA 3JSMA 1HR0J 4C7QA 4F2SA 1AJDA 3TRGA 1S10A 3PJWA 1RT7B 1XJWB 1RBOB 2VBYA 2W9CA 5H9FK 4KKOA 2BANB 1ZS6A 5A8KB 2V5HG 1SC4B 1ITPA 2J7UA 4EUVA 2G9YA 1V3SA 1VQPS 4JV5F 3DRPB 3M1VB 3KLVA 3BPDA 1NEEA 4TNOA 2LU2A 4UW2A 2QX0A 1TKDA 4C8YA 4A8XA 3CW2C 1HWJA 3W5YA 4CRJA 5CYJA 5B0BA 4KAIA 1UJ4A 3HD2A 5CD4H 2B7BB 3AD7C 2V8VA 4QCLA 3ILLA 4P2SA 4WFXA 3DRYA 5C42A 5L1IA 5H9FJ 2V9KA 1SB6A 2RQKA 1FKPB 2SXLA 5K8OA 2R2SA 2D1GA 5DG9A 2BA9A 2AGPA 1PYOB 3I9V9 1X0PA 3MEGA 2VPXB 4QR1A 2KT5A 4DZDA 1UAWA 2DNZA 4QYZK 2B56A 3CCWA 1BWVA 2JFDA 2AZ3A 5B0CA 4WYLA 1Y6VA 2UP1A 3OTDA 1G6BA 1OO0B 3GG0A 4DL4A 1Q4RA 5L9XA 3PEHA 1JLEB 1MWYA 4M1KA 2RKIB 4K5RA 5KG5A 1T9VA 4IFVA 2W8SA 3R7SB 4Y2AA 3X3UA 4CYUA 2GJFA 2ZVIA 4URGA 3HVRA 1M5OC 4F4KA 3BQ0A 1H2TZ 3BH6B 2QLWA 5A76A 3QGHA 3EGWB 2QA4S 3HSZA 2GJIA 2R2RA 4RBVA 1JLFA 1KR4A 5F8IA 4TY9A 4USWA 3DOLA 2CPDA 5D4NA 3EPGA 4MAKA 1RT6A 4C3KA 2R7XA 4NEYA 1DLOA 1ELYA 1YI2S 3HFKA 4YY3F 3GG1A 4JI4F 1VYAA 2V2QA 3N9UC 4IFYB 1JWWA 2ASDA 1NKEA 2UVVA 1XK8A 5B7WA 2BJ7A 1F9FA 2ZKUA 1XR7A 1FWKA 4DPWA 1URAA 2EKYA 5AT1B 3SZ2A 3DYCA 4YS2A 3HFVA 2CWXA 2A18A 2RUSA 3HX9A 4K5SA 4MIWA 4TN2A 4YN3B 1IN0A 4DBQA 1HNIA 4RUBA 3MEEB 4TU7A 4LR7A 1Z4UA 2JOQA 3RBZA 4DV0F 1HW8A 4ZVTB 5K4PA 2HWIA 3OR2A 1YRUA 2BE7D 4HT7A 4L3KA 4KY3A 4Q2LA 3PXGa 4PG4A 7AT1B 5LMNJ 2RD5C 4NEZA 4P2MA 1JXLA 3V6HA 4WIIA 1FVSA 4F7VA 1S7IA 2FB0A 2BE9B 2BQRA 2HHPA 1O8BA 5BR8F 2GJ2A 4KQZA 4XPEA 2Z8QA 2AU0A 1M5VC 2DHXA 4HLBA 5HSPA 4NL5A 3ZC4A 1BGXT 1F6TA 1XN9A 3BBFA 1JLAA 1T95A 1H7XA 3T02A 4B17A 2F65A 5AXKA 1LW0B 2O3DA 2BX6A 2OD4A 4O4GA 1X9WA 4EWTA 3RRHA 3QT5A 4IG3B 3NMRA 5DO2A 2DXFA 2V8GA 1H74A 4LSNB 4RX6A 3RZAA 2YQ0A 2W5VA 2QSFA 1V3RA 1RP5A 2M9KA 4JUZA 2QJ3A 1U24A 1WF0A 2GHPA 2K3IA 3D1QA 3LANA 3HHNB 4JI3F 3W3SA 3TVYA 4QU6A 2KRRA 1KHKA 2BW7A 4C8NA 3TARA 2W8DA 2CJ9A 4GO7X 2BANA 1JXVA 3E3XA 2VG6B 4LBPA 4CO0A 4QWAA 2V4QA 4KT0C 1C0TA 3SXLA 3THVA 4MKBA 4JI3J 2PSZA 3IA0A 1C0UB 1FKOB 4HVZA 5C24A 2KXNB 1S57A 3F0NA 1HBNA 1FWLA 2QV6A 1H2UX 2XMVA 3KUHA 4WWSA 5D0HA 4JI0F 3KK2B 4B3SF 4LMZA 4CXKA 3NS5A 1R43A 3R5GA 2ATLA 4KJGA 3ZZRA 2DNGA 3DU5A 4IG3A 4ZVQB 3GQCA 3G9CA 2FVQA 2OH2A 2E5GA 4DFPA 4UPKA 3MAAA 1UEVA 1MWQA 2QZ8A 3OHBA 3TJ8A 1XMBA 4Q0BA 4A8KA 4MFBB 1Q53A 4MY4A 5ETKA 2OP5A 2EVZA 1LK5A 1RWNB 2HGNA 2Y0BB 3F44A 3FRZA 3VGVA 4CLTA 1N88A 4QWEA 3Q0AA 3LP2B 1T05A 3UE2A 5IC4B 4F0MA 1KH5A 3BDGB 2OFHX 2AJ0A 1NSPA 2ZE2A 3ILJA 1WD6A 2DRAA 5KOXA 1T9WA 3T19A 3PX6A 5T14A 1EETA 2YH0A 3UVJA 1S4EA 1JLGB 2GVDB 2XHCA 3M8WA 4URSA 4WZQA 1SIZA 2ZOMA 1UVJA 3HZGA 3MMCB 4ZLNA 2CNKB 5CABA 2EFPA 5HROB 2KN4A 4W92B 2E66A 2FTRA 2D9OA 3MCMA 4U7CA 3NGDA 2W7OA 4ECWA 3PW5A 3QJPA 1HMVB 2V2ZA 4Q8EA 4UZCA 2VJVA 1R8HA 3UDEA 3AHPA 3N6NA 3T5JA 4LBHA 5IT0A 3CCLS 1RHMB 1VQOS 2XYPB 3OSPA 2HWTA 2AKWB 2FHKA 3NKYA 3TA1A 4DF4A 3DXSX 4LR2A 4LQ3A 4ZJLA 1G2EA 3J81U 1FHTA 1T9YA 4DV4F 4ZPBA 5E5NA 1YITS 5KFLA 4XDDA 4YEAA 4N77A 2LEAA 3P45B 3C6TA 2RIJA 1GTEA 3WX4A 3VVTA 5F8LA 3MHYA 2FIUA 4LSLB 5D78A 1K47A 1WORA 2WONB 4DCOB 3HHEA 4C48A 1L5UA 3BS9A 1IR0A 3NCRA 4NZ0A 2H4WB 1X4GA 1S9GB 5B0DA 2IJRA 1LFWA 4ITSA 2U1AA 3QFWA 3D6HB 4HHHA 4NLDA 1WC3A 5DDRC 4Q5VA 3VWSA 2MPUA 2ERRA 1U1QA 1RT6B 2WBRA 1IBKJ 2PI5A 1RTHB 1F1BB 3FCVA 4F36A 1MMNA 3WQPA 2XCAA 4ZPAA 2BM0A 3RJMB 2WB1D 3KLEB 3L7PA 4B3MJ 1RA7A 4OIXA 3MAQA 1T94A 2LQBA 1FDDA 2X98A 4R5PA 4NLQA 1EZZB 2KYXA 2DGOA 3R5BA 4P52A 3SQGA 3TUIC 3S8SA 5EWGA 2I1RA 4B3TJ 2Y1RI 4USHA 3G87A 2ZZNA 3CCTA 2LU1A 3WIUA 2FVCA 2HNYB 4EO8A 2W8LA 5K8PA 3TI0A 4LF6J 2PA8D 3DLKA 4DV5J 2ZC3A 4LUBA 2UUBF 1GNKA 3MGJA 1FNOA 1HWKA 2E5JA 3G2XA 2ROEA 4YHHJ 2HMIB 2EBEA 1EQ0A 2C2OB 3LGMA 1QAIA 1U2CA 1NK7A 4IDKA 2MSTA 3RR8A 3RBDA 2IPOB 3NS7B 1FRMA 2HURA 3IM8A 1JLFB 3NGTA 4F25A 1IBLF 1FEEA 1RT1B 2W5TA 4KJDA 2R7OA 4EBCA 1RWOB 2C2NA 4O44A 4ZJOA 2BACA 2HQFA 1L3SA 1TZ0A 1IBMJ 4PKDB 4ZGAA 1IBMF 2B8QA 3BGFA 4CLUA 2P5VA 5HLFB 2ASJA 3CC7S 5F8JA 1TK5A 5J2MB 4EYHB 5DLWA 4P71A 1ZYQA 2P8IA 4PG8A 1R8AA 3OXFA 4ZCIA 2E1MC 2VC1A 2XMMA 2FC9A 1N6QA 4NRTA 1ED8A 3KLIA 1OQ3A 2G1DA 2PC6A 4KFBA 4LQ9A 2GSNA 1ZETA 3W8GA 2LECA 1RAFB 1KFSA 1KRPA 3D2WA 1RTIA 3A8JA 3I5CA 4N41A 1JKHA 3VV2B 4QIEA 2B5JB 4J7CA 4DUZJ 3UCGA 5EGYA 2F4VJ 4WBFA 1FRJA 3W63A 2YPYA 1IJFB 4WFBQ 2XNQA 5GADI 4Q8FA 2C3PA 3HHLD 1C2PA 3K2YA 4W98A 2WVFA 5SUHA 1U1RA 2R7QA 2W5RA 5HJYA 2B4OA 1UZDA 4DX8H 5KFYA 2LA6A 3OFFA 1SIWB 2XYHB 5KFSA 3VGUA 5KFDA 2R9LA 3T1HJ 2M8HA 3R9LA 3H4BA 2Y8YA 5GOVA 3OR1A 4HHJA 1RACB 1TR0A 1YJTA 3DDIA 4HYKA 3KHHA 3RYLA 2Z30B 3RTVA 3V6DA 1VI7A 3M6WA 1WF2A 2IA6A 1AXQA 1YHQS 1OYEA 2DNYA 1D1UA 4PZVA 1T9UA 4YR3A 4IR9A 1YBUA 1RT5B 2XLKA 4DG1B 2W4PA 4TU8A 1HBOB 2K2PA 1KWMA 4FN5A 1U6ZA 4MIBA 1RTJB 4KO0B 4HT5A 1GQEA 2WB4A 1RCXB 4OI3A 2UZAA 3DDKA 4NI2B 3MZIA 1TK0A 1HI1A 1NB2A 1WC1A 3PYGA 2RRBA 1W7WA 2BM1A 1UPPA 3D5MA 5F9NA 2VOOA 2DNLA 4LFAJ 2IY5B 4L73A 2AHOB 2IVFB 1Q82T 5I3UB 3I56S 2ZD1B 1VQ4S 2POKA 1U2FA 1X5TA 2MKSA 2QC3A 1TUVA 2GGPB 1WC4A 1XR5A 2YNHA 4O23A 2IRYA 2QL9B 3UNYA 1RZMA 2WVBA 3W61A 5GAEI 2UUCF 1N2LA 2ZOGA 3IN5A 5D0RA 5DDQC 4CXUA 1C1CB 2KKHA 2EPIA 3AJ1A 1Y7PA 3HKWA 1GXLA 3T9NA 4CT9A 4RNNA 1SC3B 3CD5A 3W9JA 1ZTTA 1NPKA 2EEYA 4AQYJ 1FJGJ 2FUG9 1NPPA 3D67A 2YQ3A 1WI6A 3MEDA 4A4JA 3MCNA 4ZP7A 3KDOA 2IYIA 5AXNA 2CVEA 4DQRA 3JSYA 4NLWA 4ZVSB 4B9VA 3VAMA 3DRXA 3I87A 4RU2A 1QUPA 3T5KA 3LPEA 2R2TA 1DRZA 1J27A 1ZEBA 1SJFA 3T6BA 1W25A 4KRWA 3TX8A 5E41A 2G9OA 3NKPA 3V6JA 2CNNB 2MQQA 1RAHB 4WKRA 4OYBA 3T1AA 1NUEA 2MY7A 4WP9A 5HI7A 4Y2CA 1I6JA 1X4DA 3BDEA 4K4SA 2DB1A 4Y3CA 1GX5A 2BVZA 2CQ0A 4TXSA 3DLKB 5IV3A 1HQ2A 2XNRA 2GMLA 3PYEA 4K59A 1FERA 1D8ZA 3FSIA 2Z0GA 3WAXA 3KLFB 1X5OA 5LXYA 5F8NA 2B6AB 3J7Z5 4DV1F 2QFIA 5KG1A 4HH0A 4NLVA 2HQGA 4KFBB 4G1QA 5C2GA 2UUAJ 5KFWA 2WVEA 4J90A 1P1TA 4J9QA 2WHOA 3LOUA 1HBUA 3IRXB 4USVA 3W8PA 1PC4A 2JZ5A 4MK9A 4RZRA 2VQEJ 2MKHA 1NK8A 2RRAA 3FBBA 3FCWA 2PFFB 3N79A 2YNIB 3TG0A 3TX0A 1CSJA 4UQTA 5KT3A 2CPZA 1FE4A 2HAIA 4U8VA 1FKAF 4BCAA 4LT6A 3GV8B 1C1CA 1VJQA 2WW4A 4RBTA 2R8IA 4CDIA 3UD3P 5DGAA 2Q1LA 3GWCA 4H4MB 4B9NA 4LF8F 1VQLS 1KOHA 4LVOP 1KQFB 4WE1A 4GTZA 2FHJD 3TZWA 2YKMA 4DSKA 1LWEA 3DMJB 3CMAS 1IQZA 2GIRA 3KK3B 3ITHB 3DDNA 1OY8A 4QYRA 4LRCA 4BWMA 2L41A 2DIUA 4BBYA 4NMXA 1TL3B 1U8WA 2AEJA 5DG7A 1ROFA 3PV8A 2XLJA 3MMJA 3BDFA 3R1HA 2EFNA 1ANJA 5IM0A 1AUSL 3I31A 1ALJA 2ZM6F 2OGUA 3HFZB 5EHHA 1NK6A 1NCLA 2HZAA 2DKOB 4B08A 5I4MA 2RILA 4WFNQ 4GC6A 4V19J 2JLEA 3P49B 2RNEA 1WC0A 2C3UA 1S99A 2DO4A 4OYAA 2GC8A 2XS7A 1X4FA 1NDPA 1DTTA 2MKYA 4DZ6A 4KAYA 4KHRA 2HBYB 1B7FA 4CZCA 1VK3A 2B43A 2KVIA 3OFGA 2BOPA 3W60A 4LR9A 4JV1A 3TQEA 1U09A 1HKAA 4FKXA 3K89A 5CXTA 1S4FA 1I1GA 1ZPVA 1WKKA 2HK3A 2ILYA 1P49A 1RLCL 1TL1B 1ZM9A 3MPVA 1VBZA 2ZJPQ 1M90T 4XAKA 1SJ3P 4ZLJA 2RF2A 4OX8A 4ZHRA 5IWAF 1FSUA 5F8GA 2IA0A 4KHPF 3MM8B 3GSIA 2BMBA 1HQEA 4FNHA 5KFJA 5CCMA 3QZ7A 2FD2A 3MTJA 3DRRA 2K06A 2ZJQQ 3PJ9A 1YJVA 5EDWA 2XBPA 4OYMA 4HACB 1T3OA 2YNGB 1CS4A 2VV5A 4DL5A 4Y34A 3NVLA 4UTGA 4LQYA 2M3DA 5E3CA 3CCES 3R3TA 4KV8B 3O1LA 2MKCA 4A48A 1OY6A 2XG8A 4OYOA 3CD7A 1GX6A 1Y3JA 2H4YB 3Q8QB 1ZZNA 3H40A 4F02A 3TYTA 3JTNA 1YJ9S 1HARA 2OELA 2PIIA 4CO2A 2ZKTA 1JNZB 4TY8A 4UZBA 1LFPA 2NUHA 2HBRB 3A8IA 3L7OA 3MPYA 3MM8A 5D77A 4PRFA 4HR2A 4C11B 4DR1J 4A8QA 1R0AA 3NLCA 4YHHF 2IC3A 3LA0A 2J6UA 2IYGA 2J7WA 2B8PA 5DETA 1ICEB 3EGVA 3GB0A 3KDNA 2G0CA 3AQPA 5K14B 5RUBA 1BE4A 3J7ZT 2MJUA 4OHVA 3UN5A 1S72S 3QBCA 2WW8A 4KGXB 4BC7A 5C25B 1JK9B 1Q8BA 4CTAB 2ZH3A 1RXOB 1N36F 2NPFA 1XBWA 4FZVA 2D9PA 3BBCA 3G86A 3D3CJ 2ADCA 5DDOC 3R2CJ 3BBBA 4I67A 2HAFA 3MPWA 4OZ5A 2N7CA 4ICLA 4LF1A 4U7UK 4UOCA 2K7KA 3M2UA 3PO5A 4B9TA 5ITHA 4M5GA 3OBIA 2B7CB 5GMKa 3R27A 4MK7A 3U7JA 1KHWA 4MIVA 1X60A 4WF9Q 5T7LA 1NJYA 4F4WA 1LWCA 1X9SA 2DHSA 4ZLPA 2ZJRQ 1KLMB 3RU0A 4QYZJ 1VOMA 2LP4A 1BQXA 1RISA 1ZAVA 2BRKA 1GTHA 2DNKA 2AIRB 2KI2A 4J5OA 4M8LA 1VLOA 4WFZA 5BJRA 4PUOA 3CJTA 1GAOA 5JUMA 4M5HA 3IR7B 4EK2A 5IT4A 2B3TB 3HULA 1GMVA 2YKMB 3J7YU 2WOMB 2DNHA 1BHNA 4OI1A 1U25A 4ED4A 1NH7A 3FSXA 3X1LB 4S0MA 1Y7AA 4JYAJ 2RDIA 3BKFA 2DR5A 4JP8A 4J9NA 4E98A 2WVCA 3ZTOA 2IFXA 1S6QA 1VDHA 4N47A 5HMXA 3CTRA 3DFEA 5DLVA 2HVIA 4DR7J 3KJNB 4TN0A 2JC0A 3NGUA 5LRNA 1Y10A 2YX4A 1X7VA 2YH1A 2MYFA 3LGNA 5J2NB 3ENVA 4K2XA 1NHUA 4RKUC 2XY6A 2C2RA 4W90B 2MZQA 1KHVA 1FF2A 5F8MA 3CCQS 1UW9A 2ZUAA 1PJ5A 1DBDA 4M5JA 3GU0A 3AA8A 2F3JA 1JKHB 1U7LA 1GMUA 1LOUA 4ILMA 2HVHA 3DLGB 3SQOP 2ACYA 3NBPB 2RU9A 3M8ZA 2LFVA 3MPUB 3FQKA 5HAOA 1UJ6A 3GMGA 1ALIA 3Q8UA 2Q6BA 1JLCA 3CUNA 2BE2A 2XMUA 2PMZD 3BQ1A 3DRSA 1X4BA 2RJZA 4Y0FA 4IH5A 1U47A 4ES3A 2ZH6A 1NJZA 3CIMA 5CYQB 2UV8A 3RAQA 4DQPA 2X3DA 2CQIA 3OXGA 5BXIA 4DR6J 5KT4A 3TAPA 2E1AA 1SBRA 5K20B 3KLFA 1WOPA 1ZZFA 2W01A 2W7AA 1WKJA 3GJQB 3N4WA 4LF2A 4UOFA 5E0OA 3VALA 4ECUA 4G3IA 3TNVA 3BR9A 1RDRA 3GYGA 2WVDA 3GSDA 4JI5J 4B56A 1TL5A 3OFHA 3VAKA 4IUFA 5BYRA 4KM4A 2R7SA 2CZ4A 4GMKA 5AE1A 1KHJA 4C98A 2JLGA 4Y2MA 5ETOA 4C3MA 5BR8J 2CQ2A 4B3SJ 2AEMA 3QAUA 3PY8A 2OAUA 2J8SA 2RB7A 5CYMB 4CM0A 4CLSA 3RGIA 3HSGA 1PC5A 3ELHA 2E5LF 1IWGA 1R7IA 4DR2F 3CNQP 3MR5A 3G8TA 1RHQB 1UVMA 1YRXA 2LQ8A 2VDHA 3HHLA 3LW5C 4MFBA 4P10A 3DHXA 3KHGA 3PW2A 2OPRB 2MHNA 3CJ3A 3U02A 3W2VB 1RKJA 1T11A 3GCXP 3L9ZA 4KIAA 1VQ8S 4HI2A 1WACA 4B3TF 3DLJA 2HNDA 2GS8A 1TKTB 3ET6A 3H8YA 1RE1B 4JI2F 3D4JA 2R7RA 3OQ2A 4DQIA 1R8PA 2RE1A 4I6AA 4LF9F 2DK2A 1HBNB 1JLEA 4TYAA 1SUQB 1S1TB 3A3OB 3FEZA 1YQHA 5B08A 4XK8C 1IR1A 1CJTB 1Q5VA 2OO4A 3AB2B 5J2PA 2I8EA 2CG4A 2VDIA 3W5XA 2DPIA 2MZRA 1L3KA 2KTQA 3RUBL 1HBUB 1YVFA 2DY1A 2D74B 2UXCF 3V6DB 1KBRA 1R0BG 1JLQA 2CJKA 1HNZJ 2NQPA 1Q78A 4X65F 3E51A 3MAHA 1EP4A 2OPQA 4KHMA 4AXJA 3WAVA 2WSCC 4I6WA 5KFZA 2XULA 3CC4S 2W8KA 5C66A 2CPFA 4OZLA 2CQBA 2HG4A 5KFAA 4XPCA 4JI8F 4FF1A 1KDNA 2UUWA 3TP2A 7FDRA 1MU2A 3RAMA 1QE1B 1VBYA 4X2BA 4KKOB 5A8KA 3BSNA 3M2UB 2W4DA 4RR5A 3NL0A 2ZD1A 1AJCA 2NXJA 3S6EA 4NX9A 3OTOJ 5EX0A 2PE8A 2J5AA 4CH0S 2RS8A 4FBTA 5D0EA 1YZ6A 2MQNA 1G1XA 1RWPB 2HFZA 3OTBA 3QNWB 4DSFA 1HD1A 2OPRA 4ID8A 4CYRA 1EB0A 2ZBQA 3S7RA 3J81Y 5IOLA 2VJUA 2CADA 3FC9A 3DI6B 3FVYA 2FGOA 2W9BA 1X5PA 1HNZF 3C8YA 3N6LA 5L0BA 1CJUB 2C42A 3RG6A 3U1LA 2BQUA 2G4BA 2VG5A 2AJ4A 1YG0A 3L4BC 2VKZG 1CC8A 3GLJA 4IH7A 3SSRA 5HN0A 4DQQA 4TVAB 1R6YA 4C0BA 4B3MF 3IR6B 4QAXA 3FK4A 3RBXA 5C25A 5G0RA 5T41A 1HWLA 1FTRA 1N33F 1IKVA 1JLBA 2ABYA 3TAMA 3V2UC 3VZIA 3I82A 3VAJA 3MM9B 2Y1IA 4JI1F 2QLJB 1UZHA 3D9BA 2W1BA 1UL3A 3CDEA 3CJ2A 3V81B 1WOSA 2KVQE 1YIJS 3MXHP 4YR2A 4KTQA 1SQGA 2BJ9A 1HPZB 4F0KA 1Z2LA 1KOOA 2LA4A 3NMAA 4EEYA 3FJ2A 3ZZOA 2JWNA 1C0UA 1FKOA 5KFFA 1Q7YT 2ZDPA 1RBLA 3GONA 4I4BA 2RSQA 1HI8A 3UR3C 8ATCB 1K73T 3QGGA 1IWAA 4X4RA 2V8DA 2KXFA 2H1YA 5DQHA 3CDBA 1XTZA 5SZTA 1OMSA 1YKWA 2QYCA 2B0GA 3L7UA 3L09A 3VF0B 3PFOA 1EAYC 3PCOB 6FDRA 2ZM6J 4J9UE 4B3RF 4DHVA 1KC8T 1MN9A 3SV4A 4C3LA 3IRWP 4C8LA 1FJCA 2AX1A 5CZXA 4ZVOB 6AT1B 4N5SA 2RT3A 3CSKA 2HHXA 4ILRA 2CQCA 5D8HB 5HQMA 2E29A 2XO6A 1QAJA 1F0XA 5C42B 2ZHBA 1EW8A 3R1LA 2YWHA 3KNGA 3FEXB 4YQWA 3KMSA 5L1LA 4IFYA 4KR0B 3VQTA 3G6XA 1Y0HA 1WDTA 4ID5A 5HVHA 1JJ2R 2OEJA 1E33P 2LQ9A 1ACMB 1WG1A 3AXKA 4PCQA 3T9ZA 2OIHA 3H4DA 1TELA 2FZKB 3EDRB 1N0VC 3D28A 1TTHB 2R7WA 2N3LA 4MTPA 4X66F 3UCUP 1U1LA 4IQXA 4CO4A 3QLHB 4V19X 3P96A 5J2QB 2HFOA 4DPTA 1TU0B 3EZUA 4G1PA 1K7HA 1TL7A 2GLQA 2MZSA 1PBUA 1KLMA 2I5JB 2O66A 3VTIA 4AT1B 2MLXA 4RW4B 5KT6A 3MR6A 4ED5A 1AFIA 1SV5B 1OYDA 1TL4A 3I0RA 5CZVA 2GO8A 3MR7A 1SH2A 4D3GA 1Y3KA 2NPIA 1YSJA 2YKOA 1L3VA 5KXAA 4DR5F 3J7A1 4UORA 1W26A 4DI6A 4NLGA 2X1GA 2AYMA 4C4WA 2DHAA 3C6TB 3AOCA 3O2IA 3PJXA 2UUCJ 3OTCA 2H5IB 3J7YI 2EWHA 3CXCR 2VKRA 1S12A 3FBCA 2GX8A 4FYVB 4K4YA 3H5YA 3Q86A 4XIUA 1O0PA 3ETOA 4CLWA 5LSOA 5DQGA 3N0VA 3UVJB 2ZWPA 2MHEA 4YB5A 3MUTP 3EZOA 2VQEF 1QM9A 1RT4B 2HQ3A 3QJJA 1N5YA 2OMOA 3E01A 5I42A 2CG8A 4DL6A 4ZG9A 4YP3A 5CQGA 4JB8B 4TKTA 4UUWA 1YTYA 3I0RB 2XMAA 3CCRS 5L9NA 1N32J 2NZCA 2RQ4A 1K9MT 1ALHA 5IM0B 4ER8A 3LF0A 2E1CA 2AJ2A 2CPYA 2Y9HA 3M8PA 5E3RA 4PWDB 3NBPA 1FRIA 4OV1A 4C6AA 4CO1A 3NNHA 1JB0C 3PKMA 3RB4A 3JS9A 4NZ6A 3ZNJ1 3KK1A 1EQJA 2KFYA 3VAIA 1J5OA 1DJ0A 3C2PA 4GKJJ 3OW2R 4J91A 4CWBA 1AW0A 2VFUA 1GXUA 2FLOA 1S1WB 3BN4A 4KGZB 1AJBA 4UUXA 2OPSA 1FTCA 4HHUA 5KG6A 2R42A 4NWJA 3E01B 1RAOA 4OI2A 1B7YB 2ZH2A 4OLOA 1U8SA 5EGHA 1X4AA 2MLYA 3A8KA 1OQ6A 1WTFA 1FNMA 2YWWA 5JVGQ 3QFHA 1E6VA 1HNWF 3GP9A 3UW1A 2V8HA 3W66A 1XNQF 1IKXB 1UFLA 2BV3A 1P9QC 4URQU 2X3GA 3BDPA 3H2LA 1FK9A 2DR9A 3VCDA 3QGPA 4GKKJ 5J1EA 4PYAA 4PUOB 3V4IB 5D3GB 1NZAA 4LF6F 1Z1ZA 5KG7A 5L1KA 1DARA 2ZFHA 3BB5A 1LWCB 3O6QA 5BYQA 3KK2A 4OJ1A 3K5MA 1IJEB 2RHSB 3MMBA 4ANDA 5THWA 1Y00A 2WK4A 3HLUA 3FSYA 2E5LJ 1I51B 4Y28C 3QLHA 1CJKB 2E7WA 1QTNB 3IXQA 2J9DE 4NLXA 1VJWA 4TQRA 1NDLA 2XO7A 1L3UA 4FF2A 3US5A 1WC5A 1VFJA 4DL7A 1YJNS 1B8JA 1UEKA 3GFYA 3KMQA 3P3DA 1LXJA 1NHKL 3NCPA 2LCWA 5AJ3F 2P9EA 3BR8A 4NLSA 4H4MA 2MZ1A 1C0TB 3LWLA 3QSYB 1CQNA 3CB4A 4I1TA 2YKNB 1H98A 1NK5A 1N33J 3H0PA 1CJUA 4DV5F 4CIOA 2UUBJ 4O3RA 2HHUA 3EMTA 1NKBA 1RADB 4ECSA 1ZM2A 3KG0A 5IXUA 3OLAA 5HVFA 4IR1A 1TAUA 4OYZA 1HFEL 2UXBF 2OTJS 2R4FA 4ELTA 4JOUA 5HP1B 2E1PA 2EFQA 3DLBA 1H38A 4B3OB 4L6V3 3D6MB 4FYYB 4EI2A 2M88A 4Q0BB 3BYRA 3EWGA 1DQ9A 2DGVA 3CO9A 4MK8A 3EYZA 4AL7A 3U1MA 3GCWP 1CULA 3BREA 1MWZA 4YB1P 1O98A 2GVZA 1S9FA 4NRUA 2KU7A 2V68A 4NXNJ 3OJSA 2GSOA 2DXDA 3N01A 3M9OB 2RS2A 1HBOA 3AB4B 3GR0A 4P9SA 4WXWA 5ETLA 3SSSA 2W4CA 3DM2A 1HDHA 1RLDA 4PXDA 5F0WA 1HQEB 5J1NA 2GIQA 2DGTA 5J1PA 2PT0A 5GADU 1KTQA 1MN7A 5HBMB 4DV2F 4ED8A 2ROPA 2AYBA 3B5QA 2I0XA 2DO0A 4O3PA 2PI4A 3DI6A 1O6XA 4ZVPB 5LMUJ 3W2WB 4LSZB 3T5LA 3TJAA 1TK8A 4ZJQA 1O99A 1Q7LB 5D15A 2DH9A 5FDLB 2F9JA 3TO8A 1S9EB 2L9WA 3D3BJ 3KJFB 2AYGA 3J7AN 2R7TA 4CXSA 4RW9A 4BLGA 2Q66A 2RUGA 3KG1A 1DTTB 2DCLA 2HSEB 3D0IE 4FPRA 4RNFA 1RHRB 3A4TA 1VQSA 2VB6A 4M5MA 4K50A 1IBLJ 1OJ4A 3EVOA 4IQMA 3PTWA 2AYEA 3C15B 1EX8A 1RAEB 2MSSA 3CT9A 4ZK7M 3PEJA 3JSMB 4ED1A 1XMOF 3MPDA 4U8YA 3TJ9A 2QA2A 1TL1A 1VQ9S 2E9TA 1YK9A 4FP9A 2AZ1A 1NSKL 2BBEA 2MMYA 4QPXA 1FJ7A 1QLNA 1TP7A 1C4AA 2AF6A 1ZTWA 1HQUA 3GZ7A 5DZ6A 1TFYA 3G8SA 1RAIB 1CBKA 3FKBA 1D09B 2ZBCA 4OL8A 1KQGB 1EJ7L 1KNZA 4L76A 2WSFC 4RW6A 4U96A 1B64A 2GSUA 2ZH8A 3IBFB 2L3MA 3BF4A 2GW8A 2Z2MA 4DWIA 1FFWB 2H9ZA 2ATCB 2NXEA 3O5TB 4K4XA 4PG5A 4Q44A 5E3AA 3ENAA 1A9NB 2YX1A 1H2VZ 3GPAA 4NA1A 3OJUA 3BSCA 2RQCA 4ECVA 3LP0A 1V3ZA 1I3OB 3M6XA 3SV3A 2Y8WA 1CJKA 1OY9A 2BJ1A 2D41A 3CMQA 3AT1B 5CA5A 5FD1A 2BDPA 1DURA 3P5TL 1WJ9A 4HEA9 1NK4A 4B9LA 4A8WA 2J6SA 1CG2A 1NPRA 1RK8A 2LQ5A 2XWXA 3C3LA 3GFXA 3MR2A 1S76D 2J76E 1U2RA 3MTKA 1NJXA 4DV3F 2BKPA 1Q0NA 2EG2A 2FJEB 2KYZA 2NCKL 2D1CA 4C2MA 2C2KB 2E44A 3SIPB 3J80Y 2BEFA 4OHWA 1DZ5A 2GGPA 4USIA 4IRKA 3CEDA 1Q8IA 1FRLA 2QA4G 1VRTA 2B4PA 2XI3A 4ZP6A 8RUCA 3KK3A 2CJBA 2CJAA 4OZ3A 5HK4A 4G1IA 3SCLE 2FJWA 5F9LA 3C6UA 3BGUA 3FFIB 3CF5Q 3OXLA 3DYAB 4DV7J 3CIZA 2EW9A 4OMFG 3CJSA 3IBWA 4DR3F 2FJVA 1UW4A 3IO1A 1EARA 3Q8VA 3H2UB 1SJ4P 2QA1A 3ZZUA 2FVRA 3W65A 5HVGA 2K7JA 1M5KC 4LF4J 1IVZA 1LEOA 1S97A 2J8AA 2W2MP 3CWJA 3DRSB 4B3RJ 4YMEA 4X64J 5G4DA 2Q3PA 3R5CA 2OMLA 5ETMA 2FHOB 4ZITA 1OPIA 1BC6A 2HK2A 4NYZA 1XEZA 2WOMA 2JC1A 3TVKA 3M05A 2CQDA 2GAHC 3G6VA 3JYTA 1D9AA 4PQAA 4YUDA 2K8GA 1CC7A 4DV3J 2FDNA 3UDVA 2B9YA 4FXDA 1HHQA 3LP0B 5DJBA 1GMWA 4UPLA 1YJUA 2IBOA 4ZCLA 4DL3A 1T3NA 3FZBA 1ULRA 4RUHA 3J80U 2F9DA 3BZQA 4F3MA 4J9SA 2G0IA 1S6OA 4J37A 3IAM9 3A12A 1UA1A 4DV7F 2MJNA 4MT1A 3ED4A 1Y11A 2F40A 4DSEA 2H5EA 4AFFA 2UUAF 3GJTB 2XSJB 1ZA2B 4F8RA 2YPZA 2GO9A 4FVMA 1U49A 3PR4A 2V6AA 4NXMJ 3QATA 1FFGB 2J9CA 1HBMA 3KLIB 5IS2A 3QZ8A 3VAHA 2HNDB 3EXYA 4UOPA 4AXIA 3DLEB 1VQNS 3IC1A 5HQ8A 1IUJA 1HW9A 2H5JB 3MURP 4J9RA 1BY9A 1T8EA 5ETVA 1NJIT 5LIAA 3H5SA 2UU9F 4B9MA 5ETSA 4WP8A 2ZH7A 3LWMA 4GVBA 2AGQA 3GIKA 3MMAB 1R0AB 2V0NA 4NI2A 2D3ZA 5IJSA 1HR0F 2JRSA 2V63A 4NCBA 3LGHA 4QR0A 5FLXU 4CCHA 2D3UA 1FJGF 1SH3A 1YZ7A 3B4DA 3G82A 2C2DA 4OYIA 4K4WA 3BM7A 1ZPWX 3W1YC 3H98A 1UVNA 1Q8LA 3IWXA 3NGSA 2KH9A 4QIVA 4ZPVR 1KQKA 5HJXA 2BOAA 5ETPA 1FE0A 3NAIA 1LW2B 2LQJA 4JI2J 3VZHA 1WKLA 1NXIA 5A8RA 3GV7B 3OVBA 1H3DA 4JI7J 2BJEA 3JAMU 3DRPA 2XWYA 1RU2A 1XIQA 2X1BA 2G0JA 3D68A 3WHIA 4A8OA 4GVBB 4QWCA 3CCVS 4GC7A 2NR0A 4K0KF 2CKWA 4C97A 4RUAA 2HRTA 3CDUA 2HWHA 2I2YA 2R7VA 1EP4B 2OPQB 1DTQB 4LFCF 4K4ZA 2VOPA 3IP0A 1WHWA 2L9DA 3CO0P 3E8OA 1B0PA 3ZNUA 3NOCA 3W7BA 4A46A 4ILLA 4LBIA 3JSBA 5LQQA 2WCXA 2Z57B 1UKUA 2VBZA 2XMWA 2VG7A 2FY8A 1FCAA 3AOAA 3W62A 4ECZA 4YFUA 2JFKA 2Y0SD 2UUTA 3C66A 4ZPTR 4P7TA 3RW6A 1VS3A 3PRDA 3NWRA 2XS5A 1RT3B 3H2VE 2V4JA 2XC9A 4HACA 2G1HA 1ZAWA 2ZE2B 3BKTA 4XTTA 3CPWR 3KJVB 4P74A 3HM9A 2IBKA 2JNJA 4UT4A 3Q8SB 4BDPA 4FF3A 5AJ9A 3UD4P 1YX2A 3QGIA 1SJQA 2RKIA 2IM2A 4QW9A 3IGZB 3HDSA 2DNPA 1DQ8A 5KFEA 2V94A 4ICLB 1EIYB 2J0XA 4I2PA 3BEGB 1ELOA 3AD8C 4ZIVA 4Q7AA 3Q3QA 1ED9A 3C19A 3MAAB 2C2MB 3OR2B 2A6OA 1BQNA 4RW8A 2AJFE 2EFGA 2HS4A 4UOHA 1IKXA 3SDEA 1KHNA 1Y4ZB 2KT3A 2M7SA 4O3QA 4DUYF 1N6QB 4K4UA 1VIOA 4GTWA 4DCJB 4I0WA 3VGSA 4ZA1A 4DU7A 5KFPA 4EGLA 2XGPA 3QRQA 3NKMA 4FYXB 4WTOB 4NXNF 3D7SB 2HRYA 5LRMA 3AJ2A 3AODA 1NKCA 4E2FB 2C2EA 3NKQA 3A1YG 2NSBA 5KFTA 1SUQA 2H65B 4LJMA 4A8FA 4Y2KA 1ZH5A 3T1HF 2PMHA 1RBAA 4WU2A 5KG3A 4DV0J 1G4CA 3V5RA 4LSNA 4OYPA 5LMUF 4DU8A 1Q81T 4H54A 5LMNF 3PNIA 4YDDB 4IG0B 3M8PB 3LQVA 4ETXA 1JLQB 4DR1F 1I5OB 1VK8A 5ADZA 2F4VF 3CD6S 3K5PA 3Q89A 1VIXA 1WC6A 3K58A 2CAJA 2WRMA 3JQJA 5KFKA 4AUKA 1WTBA 2CJYB 3B78A 2NREA 1IR2A 1SKUB 5LJ5Y 4A47A 4DR3J 2OJ3A 3DLGA 2IAJA 1R27B 1YLXA 4Y2IA 3F73A 1RYRA 3Q22A 2VFTA 4ZIWA 3HP6A 4F67A 5A6PA 2RMLA 3C6UB 2QSWA 3FFIA 3NEKA 1UVKA 3S01A 3DYAA 1AUDA 2KFNA 4FDJA 3D1HA 1FKPA 4TYBA 2HVEA 2NYIA 2V67A 4FDFA 1BQNB 4MYTA 4P75A 4PABA 5A2QY 2KG1A 4F4YA 1NAQA 2QLBB 3R2DJ 3NAHA 3QT8A 3H25A 1TV6B 3FGVA 1LWFB 3ZTRA 4KH0B 1N48A 1P27B 3KLHB 4M5IA 4RW7A 4DN0A 4FXVA 3QYYA 1DQAA 1VRQC 4PWWA 3C16B 3K5LA 1WEZA 3RR7A 2ASYA 4M5LA 1ZEFA 3OR1B 4UF4A 1E6YA 2XZWA 3T3FA 2P9GA 5CHCB 3HKZD 4HTJA 4YR0A 3KHRA 2CPEA 1VQKS 3JSRA 3M9MB 1RU1A 4J9PA 3OUYA 1S0VA 3LAMA 4CNZA 4NCAA 5T7LB 3IG1A 3HI9A 4USJC 5KFGA 4ID5B 3IR5B 4EO6A 5H9EK 3HK2A 1URBA 2QZUA 1NH8A 1BMQB 3H20A 4UY85 3UCZP 2XMJA 1H0HB 2ZH1A 4KE5A 2WTFA 2NSCA 3TZXA 2XB2D 2D3OR 4OJHA 3DOKA 3CVKA 1SHNA 3TA2A 2ZITA 2VD3A 4AYBD 2XY5A 4H4KC 2YKNA 3BSAA 3HF5A 4ANEA 2HZVA 3AH6A 3M2RA 1S1UB 5FJ4A 3R7BB 3OPKA 2QRRA 5H9EJ 3H90A 1D8YA 2EI5A 2GMJA 5CH7B 5GRRA 2A0FB 2OKQA 3QIPB 5DLGA 2CJQA 3GR1A 1TL3A 2ZHAA 4DPXA 1U4BA 1K0TA 5I3UA 1HNWJ 4I7FA 3IWNC 1KQSR 1NDKA 1N5VA 1B70B 1RWXB 2JHEA 1PJ7A 4X84A 4IOAQ 2V8PA 4LREA 4LFAF 1ANIA 5DQIA 1U1KA 4NXMF 3UN2A 3EUNA 1FA0A 2B4VA 1FESA 1RT3A 1UETA 3L3CA 4NWXA 2CNLB 3I32A 2XCPA 2M8DB 2R3VA 1FXLA 2R8HA 4MYUA 2B5JA 2B9XA 5LM7E 1NHVA 2WSEC 3ILOA 1T9TA 2LXIA 1PAEX 2OSQA 1P8GA 4XDCA 1MMLA 1YJWS 3M7VA 5D0GA 2VA3A 1RA6A 2IDLA 3QIPA 4RNOA 1QE1A 4RNHA 5B09A 1CPZA 3AA9A 1S6PB 4CLZA 3I55S 1H7WA 2AT1B 4MKYA 4N76A 4KGKA 1N5TA 3B82A 2RHQB 1R8BA 1U26A 3H42A 1FD2A 5KG4A 1U6BA 3EVMA 3G6ES 2DNMA 4DXLA 1QAXA 1X8DA 2H51B 4NWBA 2VPYB 4RL1A 3ZTQA 3NNAA 2UVWA 1F2HA 1N32F 1KVIA 1H6KX 1VQYA 3M4XA 1OPZA 2EFVA 3EE3A 4QIWD 4R5PB 1HNVB 1RT1A 4BS2A 3Q2SC 2D7SA 2IM3A 1QAYA 3Q8RB 2DITA 3CCJS 2J9DA 1IXKA 2Z2YB 3MOZA 2PO4A 2B6AA 3ADAC 2OLWA 4LF4F 2RH6A 1T9XA 3M2VA 3EX7B 4GKJF 3I4HX 4QPTA 5G0RB 3GILA 1E1ZP 2CQGA 2ZVSA 2ADBA 3BGRA 2FLLA 3BO3A 1IM6A 3FZ2A 3CJ4A 1IBCB 4DUYJ 2IC3B 2FHMA 3WC0A 1K1QA 3ENQA 2JL9A 3DNCA 3MCOA 5DRKA 1FRHA 4OZ2A 4LFCJ 3B4MA 5K8MA 3FEYB 3DXBA 1KVKA 4HI1A 5KFBA 2H54B 3G8QA 2Z56B 2AWZA 2BRLA 2FC8A 3H5UA 4ZPCA 3IG1B 3TZZA 3BV8A 1R0CB 3MM6B 4LRBA 1JIHA 1LXNA 2K3KA 3IMQJ 5D4LA 3ZTPA 1NU4A 5HQLA 3UR0A 3U1NA 1GXTA 1DFDA 2IRXA 5KOWA 4ZPDA 5L38A 3CCSS 1B0VA 3FUYA 3DOKB 1BUXA 1UVLA 2YNGA 3UI3A 2MQLA 3GJSB 4IKAA 3G4SS 1UVIA 3QIDA 2IFYA 3DM2B 3UPFA 4I2QA 1RGVA 1WI8A 3EVWA 4IO1A 3TQ1A 2DY9A 2GFFA 4ALZA 4ED3A 4DQSA 4HKQA 3HVTA 5IJQA 4MKVA 3DGPA 1MMDA 2GVZB 1RAAB 1R89A 2RH3A 4JI6J 2HYIB 3TUZC 4JI6F 2YNFA 2YKAA 1ZAXA 2HHVA 1YJ7A 1HJKA 1U48A 1RTIB 1SKSA 3SSQA 5GAHI 4C8MA 1X4HA 2VQFF 2KT2A 3C16A 3PG9A 3SQGB 3PX4A 1FFSB 1RB0A 3C46A 1S59A 2M5YA 2Q6CA 3PHTA 5DM7Q 2CDQA 1IKYB 2ZH4A 4ELUA 2XMTA 1JLCB 2HPUA 2A3JA 2XZDB 3WX8A 3BGOP 3LALA 2F63A 3IFEA 1KTVA 5JXSA 2RF2B 3AFGA 4EMDA 1PYTA 1FRKA 1WHXA 2YWEA 4ZHRB 4P2XA 5DGBA 3OLBA 4J9OA 2FZGB 4KPYA 3THTA 5JJBA 3MMBB 3Q8PB 2ZBPA 2MLZA 2ANHA 2HQCA 1HHTP 2DT9A 1FJEB 2OFGX 3BDGA 2GA7A 4KB7A 4YB6A 2KM8B 1X0FA 1J5OB 3HT0A 4JI4J 3EGZA 2AEFA 3TZYA 3HJFA 2ROGA 1EETB 1OSDA 1N52B 3JQMA 3KJQB 4DSIA 1JLGA 2GVDA 4OHZA 1KFDA 2VONA 4DSJA 1B0TA 1LWXA 1SL0A 1M1KT 3MK1A 4FNIA 1XC9A 2OD6A 4WKYA 4ZCMA 5HL7Q 2J9EA 3KNAA 2KO1A 2CZ9A 3NXZA 5F3TA 1E2SP 2IMOA 4DR4J 5F8HA 3KLHA 3ZTSA 1RQ0A 1WDDA 2QTWA 1SL1A 4I2QB 1MW7A 1U1PA 1TAQA 1SKWA 1AA1B 4YOEA 5KT7A 1G3OA 2NS1B 2V50A 3HJVA 4KH1B 1UPMB 3QWUA 2M2BA 2Y1LB 1WF1A 1MNEA 1XMQF 1N34F 3QO9B 1J5EF 1JXEA 3LP1B 4HTIA 5KT5A 3OUYB 1VGYA 4CTAA 3Q23A 1I94J 3DLLQ 4UY8T 3SDEB 2BZ2A 3K5NA 3KD8A 3T1YJ 4EFAC 1LK7A 1Q16B 2FZCB 3PYDA 3T1YF 2BKNA 2DJWA 1EW2A 4J9MA 2LMIA 3M6VA 4D3HA 4AD6A 5GAGI 4WIQA 1U0HA 1P9YA 3R8YA 3CCUS 2GV1A 1KD1T 1SV5A 3PO4A 4DMZA 4M94A 2JJ4D 1S0MA 2DPJA 1S9GA 1FXRA 4MIAA 2DGUA 3IDDA 4DEZA 3Q83A 3GIMA 2XZTB 3GYNA 4ANCA 3VVUA 3DCAA 2CQPA 1OIAA 4PG7A 4YB7A 1TV6A 3M6UA 2A10A 2LDIA 4N8NA 5IQQA 3D54A 3UNGC 2ZHOA 4QW8A 4NMLA 2NLWA 4E8UA 2QT7A 3IM9A 3NS6A 4W4MA 4X64F 3NP5A 3VHQA 1S1VB 1RCOB 4X4SA 3OSNA 2IJFA 3MF5A 1HNVA 1ZM4A 2L48A 4P73A 4HL9A 4OZJA 5AE3A 3MFIA 2JSXA 2C3YA 2NYHA 5A0YB 5IT9U 3OTEA 2VQRA 1JJCB 2HQDA 3KLGA 1UFKA 3DRRB 4ED6A 4DV1J 4X4PA 2ZNYA 2B9EA 1I94F 1RT5A 2DISA 2CNOB 3MCSA 4M5KA 1T7PA 1SQEA 3E2DA 3QPIA 2D69A 1F9EB 2HQIA 3T5HA 4KV8A 4K4VA 2FJDB 1BXNA 5ETNA 2YQ1A 4NOHA 2KHCA 2YKPA 4JYAF 3MEEA 1RWUA 2G2OA 2IMWP 1DTQA 4OV6A 3PDNA 5LL6d 1W2IA 1QY7A 5A8WB 3SEOA 3KHLA 2R7UA 3HO1A 3WAWA 2BABA 2F8MA 2ZH9A 4MH8A 4JI7F 1R3NA 3M30A 5JMNA 1KH7A 2A2CA 1EJJA 1GK8A 2HKEA 4EYIB 3HD1A 2VC0A 3PX0A 4GKKF 3BSOA 1U45A 4IOCQ 1HPZA 2OUGA 2MZJA 4DG1A 3RB0A 3KJVA 3HT3A 2P9CA 1UJ5A 3CJ0A 3GJRB 4WP3A 2ZH5A 3M32A 4DPOA 3MUMP 4JI0J 1SQFA 3FBFA 3DU6A 2IUCB 3QT6A 3F41A 1KS2A 1S9EA 2RDJA 3AY0A 5IT9Y 5INHA 4WPAA 2KL8A 2VA2A 3CJ5A 1MSWD 4ZPWR 3AD9C 2J0WA 3K8WA 4OZNA 3TAQA 4GRSA 5DG8A 2BKOA 2ZWOA 2QGFB 4ZS6A 4IO9Q 2N4CA 1AYEA 3MMAA 3QAEA 2W5WA 4FDIA 2KXHA 4WXOA 3UQSA 5K9FA 2CZVC 2HFUA 3FRYA 2KRBA 2MZTA 4USMA 3JB9k 1NBEB 2CJXB 2FGCA 4ZLLA 1HA1A 3D1OA 2JVRA 2VPZB 1VC0A 3U27A 5HLFA 1S6PA 4OX6A 2QYGA 1OWXA 4ZMMA 2FVPA 5DDPC 2EFOA 4NPOA 1VC6A 2DGXA 1HWUA 2QG9B 5ETRA 4PR6A 5IWAJ 2LXUA 1JX4A 3HVAA 2NZ4A 2CUYA 3O44A 3WBZA 3MUVP 5D6GA 2RDDA 3V81A 1IQTA 2DGQA 1KKHA 2GHWA 1HQAA 2W2QP 4FKYA 1REGX 2AQ4A 2CPXA 3G82B 5IQ6A 4B3OA 1RAGB 1C1BA 1FDNA 5CYQA 3R5AA 2X1AA 2HHHF 4FBUA 3AAWB 3TVZA 2HHSA 8AT1B 4X62F 1RYSA 1XNRJ 2L08A 2F7VA 2IHR1 1TKZB 2YWKA 3CJ8A 3FNNA 2E9RX 3IGYB 2KHDA 4OZ0A 4B02A 5CAAA 2MKIA 1VISA 2KZMA 2WONA 3V4IA 5D3GA 3NGKA 2EC2A 4DV4J 4ECQA 4AE5A 4JV5J 1KHLA 1RT2A 3CJKA 1TVRA 2N4DA 2QMXA 3A8EA 5DZ7A 1LWEB 1X4CA 3DMJA 3HSJA 1RABB 4O44B 4RJVA 5KFHA 4RNMA 4CYUB 4K8RA 1HI0P 2HFNA 5J2NA 2DR8A 5L0KA 2XLIA 4DL2A 2FVSA 1U6FA 4MMOA 2W2NP 1WEYA 1NMEB 3KLEA 1HIYA 4DUTA 5HANA 2DXEA 1AROP 4L74A 4Z2XA 3ZO7A 2EXUA 2X7IA 3CGIA 4NE9C 4YR1A 1RHKB 1RWMB 3NRBA 4OZ1A 1NK9A 1OS5A 3QWPA 2OTLS 3MR3A 5EGEA 1APSA 2CRLA 4ZN1A 3P6YC 4ZVRB 1SCJB 3IGVA 3D0HE 4WYWA 1TKTA 3ET6B 2EK6A 3JAMY 2UXDJ 4RUCA 1UCNA 1U1OA 2HGMA 2YTCA 1FDAA 3MM5B 4PXEA 1WHVA 3SFUA 5J2QA 3RB3A 3MEDB 2DRBA 2R8GA 4UPHA 4CLFA 2CYYA 2CXEA 4DV2J 1ZEDA 2FHJA 3EJMA 2FJXA 1T03B 4PXCA 4FS2A 2R8KA 1L3TA 1CQMA 1U0SA 1VLYA 2PEBA 3LTOA 4WJBA 1RTZA 5CYMA 2XM3A 1VC5A 2MQMA 1N54B 2DEJA 2H3EB 1C1BB 2ZEJA 3VAFA 3N5FA 3TEGA 2VIHA 4DSLA 2QO3A 3RAXA 2R8JA 4UPIA 3K59A 1FD8A 2DIVA 4FYDA 4NCGB 1RWKB 3SMZA 2E1RA 3LP1A 3TR5A 3QSIA 4CNYA 4CP5A 3EZ5A 4R0JA 2HNZB 5GAHU 3MM6A 2QL5B 2B51A 2GCFA 2QN6B 1TVRB 2DNQA 3DOLB 5I3PA 5GAEU 4CH1A 4OQJA 1JNRB 2KJVA 3AQOA 3BGLA 2LYVA 2Z2LA 2VUGA 3CCZA 3MEKA 1WUUA 4Q2MA 2AW0A 3W2VA 3GIJA 1QSLA 1UA0A 2AP6A 2GQQA 5M2PA 1QD1A 1UMJA 4ZG7A 2IJNA 2FLNA 4OHYA 4DFJA 4GO5X 1JQGA 5KFXA 4FF4A 3G6YA 1VMBA 2J6TA 3PW0A 1VHFA 1J2VA 1S5ZA 3HSDA 3MECB 4QIFA 1DLOB 3ZZYA 1SL2A 2LEBA 3BQ2A 3OL7A 5DS7A 5EUHA 2HHWA 3M2VB 1S49A 2QMUB 4OLPA 1RWWB 2YNFB 4WK1A 1TUWA 1RI7A 4YY3J 3LUYA 4BWJA 2W9AA 2F1FA 1QSSA 2CPJA 3DLHA 1PJ6A 3O3LA 2MXYA 1G7CB 1WOOA 2M4MA 2LLZA 5E2QA 1YJRA 1Q5YA 3NG8A 1H72C 3V6KA 1M0SA 3M8QB 3DN9A 9ATCB 1VBKA 1UFWA 5KFUA 2V4JB 3TW0A 2GNKA 3QQCD 3LO3A 1N36J 5KT2A 4I7FB 1PSDA 4UOGA 2X51A 3IRXA 3JQKA 1REVA 1SVDA 2V2KA 3MM9A 5C2CA 4R0EA 4QU7A 2XR9A 1HQUB 3F56A 4DX5A 4F4XA 1PYSB 2ASLA 5F3ZA 3D66A 3T6JA 3T41A 3GIIA 4KBIA 4ERDA 3OVAA 1S79A 4P7VA 3NKOA 2QLFB 3IAS9 1VQ6S 4KGMA 1WSRA 1PCAA 1RAJA 2VHGA 3HVWA 2IM1A 3UFCX 4DN9A 3NKRA 5DLTA 4F3QA 1EQMA 3ICLA 5LXRA 4LRDA 3LH2S 2DR6A 3B8HA 3C15A 4K2JA 1VQ5S 2HMIA 4ZG6A 3ILIA 1EI6A 1SC1B 4LR8A 1QJHA 4NYOA 4X66J 4CYSA 5KFNA 4CLPA 5A2QU 4Y00A 5GMEA 2XQCA 1F5AA 1JMTA 5GVQA 2P2CB 4CT8A 1P6TA 1S1VA 4P2FA 1URNA 4DR6F 1KH4A 2AMCB 1R31A 5JVHQ 1VR6A 2N3OA 3SI8A 2IUCA 1NLKL 2HBZB 3POTA 4FXWA 2MGZA 1S7HA 1CJVB 1IKYA 2M52A 2MKJA 4DV6J 1TFWA 1KH9A 5HMWA 1FEHA 2Z58B 4PEOA 4RW7B 2C28A 1TKXA 2CQ1A 4LIRA 3W9IA 4ZVEA 3M2RB 2XSJA 4ED7A 4ELVA 3KOAA 1PBAA 4Z37A 2DNRA 4WCEQ 3I5AA 1XWLA 2BW2A 1N0UA 4QWBA 1N5YB 1R6VA 3ISNC 4KC5A 4O4RA 3FMWA 1K8AT 1M5SA 1YGYA 1XMQJ 3GIRA 3MDFA 4IOBA 3B6BA 3DLEA 3HPOA 5GMDA 1YDLA 5A8WA 2HZCA 1WG5A 3C14B 2KB2A 4RWWA 1V5VA 3H5XA 4PQUA 1NSAA 5C7PA 2GHVC 3OD2A 5LSLA 3CDWA 1AB8A 2CFXA 3POTB 2MGZB 3A13A 3PRBA 1CULB 3R5DA 2RRNA 2ZBRA 5K5MA 4ZDNA 2OPPA 7FD1A 4OX9J 4BC9A 3UO0A 1NNDA 3A3PB 3I5BA 1N4LA 1FNXH 3PACA 1YBTA 2JVOA 2BXJA 1E3CP 3OTOF 2P6SA 5A0YA 1JJHA 2HHQA 3MK0A 5HBMA 2C3MA 1GFWB 1LWFA 1SI9A 2W9CB 2ZZTA 1U0HB 4DV6F 2D3O1 4ZVUB 1S1XB 1WELA 1SKRA 2HNYA 4KJIA 2QMWA 4ZOSA 5J2MA 2P6TA 1FI4A 3FDSA 3Q8YA 4U7UD 1CEZA 3VGTA 3TEHB 3ZZZA 1O5JA 5F0UA 4M63A 5KAKA 1QUVA 3W5ZA 3PIOQ 4CLLA 4FS1A 2AV5A 1TMJA 4NLRA 1Y5IB 2DYAA 1HHSA 2E7VA 4X65J 2HS3A 2VFRA 3M8RA 1QSYA 1UWBA 3HHDA 4QWDA 2HBQB 4F2RA 3DOMA 4M5DB 4K4TA 2UXDF 4I68A 1FVQA 4DDFA 3OL6A 1M5HA 2ACMA 4NYPA 4JI1J 3DHWC 4LF7J 2FJAB 2DGWA 4ATNA 1JJ4A 2I5JA 3UDCA 4HDHA 4QBUA 2JX2A 1LNQA 1K0VA 5FIIA 2HFVA 4NLOA 2ZOFA 4K7QA 3EM1A 1F3VA 1SXLA 4USTA 4X4NA 2DVIA 4C0HA 3I0SB 4CH7A 3DGVA 1VHIA 3KYLA 4IRDA 3RW7A 4CO3A 4QJVA 4ZKAA 5TJ3A 4LF5J 2F5GA 2BE2B 4USKA 2YKQA 4Y6IA 2WBMA 5IV4A 2XRGA 1E6VB 1YBAA 4OFZA 2I9SA 3A3NB 1EKRA 4MKAA 4WK3A 4Q43A 2VICA 1B4SA 2HHHJ 2DCUB 4QIGA 4XO0A 1N5SA 5KTQA 1GEHA 4KGVB 1URRA 3WIVA 5KFIA 1AUKA 1IKWA 1S1TA 4ECTA 2JEFA 4C9DA 3MI7X 1NM2A 2F8HA 2AX0A 4ZVHA 4ZCKA 1KN6A 2ZBIA 3E2EA 1HLWA 1XQIA 2OHDA 2G2YA 4RW8B 3I0SA 3VQSA 2FPHX 4F04B 3ITHA 4F4ZA 5M2RA 3JYTB 1NRKA 1W2BR 2YWGA 3CMRA 3FQLA 4TQSA 2XI2A 4L75A 4DF8A 2QIFA 1D9FA 3MOJB 1K1SA 1MROB 2DTJA 2W9BB 2E7XA 4R8UB 1HNXJ 1OSCA 2FQQB 4IYQA 1B3TA 3GYXB 1T02A 2YNHB 1U1MA 3TOQA 3TUPA 1LQ9A 1MG7A 1YRTA 4WFYA 4KSEB 1RT7A 1KP6A 2VASA 2EBGA 3LPYA 2B4UA 2A1BA 2O01C 3BO2A 4EBDA 1QVFR 3GFZA 4TU9A 4DX7A 4I6YA 2AGOA 2UV8G 3IGNA 2V69A 1IKVB 1JLBB 2CDRB 5L46A 4PQUB 1AZSA 2C2ZB 5E3QA 1HYSB 1ELXA 4OYWA 4FVCA 2LEPA 1KEKA 3IS9B 3M8YA 3HMJG 2MEWA 5K14A 1CJTA 5J2PB 3OVSA 1S1XA 3ENWA 3KTQA 4ECRA 2M0GB 1J5EJ 4NLUA 5LSRA 1QTMA 3LXQA 2LVWA 2HVZA 1O51A 2GQ2A 3CE8A 1PKUA 2MQPA 1N2KA 5IC6B 2VODA 3UWTA 1HNIB 3D6FB 1UWBB 5BYSA 1HNXF 3CMES 1VRUA 2HRUA 3BYPA 3SCIE 3MM5A 4DR4F 1VCTA 4KHPJ 2OEKA 4GTXA 2OSRA 2YBVA 3MD3A 2FY1A 3TAMB 4PPDA 3PZPA 3OV7A 2VL1A 3NKNA 2HLUA 2MY8A 3MECA 3RBEA 5L39A 3OL8A 2J0SD 1MU2B 2YWFA 4CQ1A 3EICA 3FCHA 1PILA 3MM7B 4IRCA 2F4FA 2GQCA 4JI5F 3EPIA 3DOMB 2IVMA 3ONQA 2ZUGA 4M5DA 3CC2S 1BWEA 1EW9A 4OHXA 5CCLA 1N56A 1N5QA 3GTYX 2COLA 2EKNA 3M30B 5DM6Q 2XGQA 4OI4A 1SJRA 5FDLA 3R7NB 2XS2A 3Q2TC 3QJLA 2HLTA 2Z2ZA 3EGNA 3FBEA 4NA2A 2ZC4A 2DH8A 4O3NA 3ZXWA 1LW2A 1RTDB 5KFCA 2O67A 5LJ3Y 1FT8A 4PG6A 1NB7A 2PGCA 4F4AA 1SHQA 1SPBP 2W2PP 4PWUA 2V4RA 5ETQA 4J9LA 1EKSA 2NXNA 3M32B 1N8RT 1TUGB 3WAYA 3N6MA 2E5IA 2XSFA 2NXCA 1RTHA 1UP1A 4F0HA 1HL6A 3BJYA 1FX2A 2HHTA 4ZP8A 2CPHA 1M1GA 3ETMA 4X4UA 1Q8KA 2APOA 3PM9A 3NGRA 3M1VA 2V9WA 1SJ1A 4DR5J 1DHMA 3OHAA 3BDHA 2PFDA 2QL7B 5KFRA 2MDAA 3D6TB 3ZZ0A 5EN1A 5HO4A 3EDQB 4DS4A 4DOZA 1Y9OA 1X31C 1PIEA 1R8CA 2DR7A 4L3NA 2HEKA 1RHUB 4GVLA 5KFVA 2KG0A 1RUSA 4WE1B 5KG2A 1RT2B 2RVJA 2LKZA 2VPWB 3CJKB 1KLNA 4JV2A 4UOOA 2I38A 4E0DA 5A6WA 2K1RB 2HGLA 2C3OA 1RKIA 1K44A 2E5HA 4TLRA 4QQBA 4Z7CA 2MKKA 3PHEA 4DCPB 3M9NB 1BD6A 1UTAA 3JXOA 5E33A 3BGRB 1WHYA 1AZSB 2HNZA 3W9HA 1S6UA 4HDGA 2FLPA 4HH1A 1AFJA 1VQMS 3QRRA 4F3OA 4LFBF 4RBUA 3MD1A 4FYWB 3HHKA 2IDEA 2IVYA 2ILZA 3ZFVA 5E7OB 1RSCA 4IH6A 3WDOA 1NDCA 1X5SA 1KVJA 3HHLB 1QDUB 4M5NA 3HXMA 3MFHA 4WZMA 2JDJA 4IFVB 3T01A 3TUJC 2CPIA 4DS5A 1T03A 4GTYA 2X1FA 1A6LA 1F9HA 2DD8S 4DPYA 9RUBA 3CD0A 4EZ6A 2VBWA 1UEUA 2HW3A 1FRXA
chains in the Genus database with same CATH topology
3Q3QA 1ED9A 5GOVA 2IUCA 2GSOA 4N7TA 4LR9A 1KHLA 3M8WA 2D1GA 3M7VA 4B56A 1KHNA 1B8JA 3KD8A 4GTWA 1P49A 4KM4A 3M8YA 1Y6VA 1EW2A 1KHJA 3NKMA 1EW8A 4LRFA 1FSUA 5LRMA 4YR1A 3LXQA 3NKQA 5EGEA 1N2KA 4LR2A 1E33P 2W8SA 3IDDA 1KH9A 2GA3A 2W5QA 3MK2A 4LRAA 4KAVA 3NVLA 4LQYA 4UPHA 2RH6A 1O98A 3ED4A 3UO0A 1ZEDA 3UN3A 1K7HA 4UPLA 2GLQA 1ELYA 3BDGB 3NKNA 3UNYA 1E1ZP 2VQRA 1E3CP 1N2LA 2ZKTA 1HDHA 3MK0A 4CXUA 1AJAA 5KXAA 1EW9A 3CMRA 4UORA 3E2DA 1URAA 3DYCA 4UPIA 3B5QA 2X98A 3UN5A 4LR7A 4FDJA 4LRBA 1ELZA 3T00A 4UOPA 5K4PA 1O99A 1SHQA 3WAVA 4CXSA 3WAWA 5LIAA 1ZEBA 5C66A 1KH7A 3WAYA 3NKPA 2IFYA 1EJJA 4ZG9A 5IJSA 3A52A 4MIVA 1ALHA 3SZYA 5IJQA 3T02A 1ALKA 3SZZA 3BDHA 2W5SA 1ZEFA 1AJCA 3DPCA 1EQJA 3WAXA 1HJKA 2IUCB 5L0EA 2W5TA 4KJDA 5INHA 3OT9A 2W5VA 4CYRA 5TJ3A 1URBA 4ZG7A 1AJBA 4UOOA 4ZGAA 3TWZA 2QZUA 5HRTA 2XRGA 2W5WA 1KHKA 1Y7AA 4FDIA 4NWJA 2W8DA 5DLWA 5L0BA 3TX0A 3TG0A 5EGHA 1SHNA 2GSUA 1AUKA 5DLVA 4GTXA 1ED8A 4TN0A 2ANHA 2XR9A 5LRNA 4QAXA 2GSNA 4GTZA 3BDGA 4CXKA 2W5XA 4KJGA 5GRRA 3WBHA 5LQQA 4MHXA 3NKOA 1AJDA 4LRCA 4UPKA 1ELXA 1HQAA 3NKRA 5DLTA 3BDFA 3MK1A 4LRDA 1ANJA 3M8ZA 2G9YA 1ALJA 1E2SP 4MY4A 1ALIA 3T01A 1EI6A 4CYSA 4LR8A 4LREA 5AJ9A 4ZG6A 1ANIA 2W5RA 3IGYB 3UN2A 1KH5A 3IGZB 4GTYA 4NWXA 1KH4A 5L0KA 4KAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q3Q A;  1ED9 A;  5GOV A;  2IUC A;  2GSO A;  4N7T A;  4LR9 A;  1KHL A;  3M8W A;  2D1G A;  3M7V A;  4B56 A;  1KHN A;  1B8J A;  3KD8 A;  4GTW A;  1P49 A;  4KM4 A;  3M8Y A;  1Y6V A;  1EW2 A;  1KHJ A;  3NKM A;  1EW8 A;  4LRF A;  1FSU A;  5LRM A;  4YR1 A;  3LXQ A;  3NKQ A;  5EGE A;  1N2K A;  4LR2 A;  1E33 P;  2W8S A;  3IDD A;  1KH9 A;  2GA3 A;  2W5Q A;  3MK2 A;  4LRA A;  4KAV A;  3NVL A;  4LQY A;  4UPH A;  2RH6 A;  1O98 A;  3ED4 A;  3UO0 A;  1ZED A;  3UN3 A;  1K7H A;  4UPL A;  2GLQ A;  1ELY A;  3BDG B;  3NKN A;  3UNY A;  1E1Z P;  2VQR A;  1E3C P;  1N2L A;  2ZKT A;  1HDH A;  3MK0 A;  4CXU A;  1AJA A;  5KXA A;  1EW9 A;  3CMR A;  4UOR A;  3E2D A;  1URA A;  3DYC A;  4UPI A;  3B5Q A;  2X98 A;  3UN5 A;  4LR7 A;  4FDJ A;  4LRB A;  1ELZ A;  3T00 A;  4UOP A;  5K4P A;  1O99 A;  1SHQ A;  3WAV A;  4CXS A;  3WAW A;  5LIA A;  1ZEB A;  5C66 A;  1KH7 A;  3WAY A;  3NKP A;  2IFY A;  1EJJ A;  4ZG9 A;  5IJS A;  3A52 A;  4MIV A;  1ALH A;  3SZY A;  5IJQ A;  3T02 A;  1ALK A;  3SZZ A;  3BDH A;  2W5S A;  1ZEF A;  1AJC A;  3DPC A;  1EQJ A;  3WAX A;  1HJK A;  2IUC B;  5L0E A;  2W5T A;  4KJD A;  5INH A;  3OT9 A;  2W5V A;  4CYR A;  5TJ3 A;  1URB A;  4ZG7 A;  1AJB A;  4UOO A;  4ZGA A;  3TWZ A;  2QZU A;  5HRT A;  2XRG A;  2W5W A;  1KHK A;  1Y7A A;  4FDI A;  4NWJ A;  2W8D A;  5DLW A;  5L0B A;  3TX0 A;  3TG0 A;  5EGH A;  1SHN A;  2GSU A;  1AUK A;  5DLV A;  4GTX A;  1ED8 A;  4TN0 A;  2ANH A;  2XR9 A;  5LRN A;  4QAX A;  2GSN A;  4GTZ A;  3BDG A;  4CXK A;  2W5X A;  4KJG A;  5GRR A;  3WBH A;  5LQQ A;  4MHX A;  3NKO A;  1AJD A;  4LRC A;  4UPK A;  1ELX A;  1HQA A;  3NKR A;  5DLT A;  3BDF A;  3MK1 A;  4LRD A;  1ANJ A;  3M8Z A;  2G9Y A;  1ALJ A;  1E2S P;  4MY4 A;  1ALI A;  3T01 A;  1EI6 A;  4CYS A;  4LR8 A;  4LRE A;  5AJ9 A;  4ZG6 A;  1ANI A;  2W5R A;  3IGY B;  3UN2 A;  1KH5 A;  3IGZ B;  4GTY A;  4NWX A;  1KH4 A;  5L0K A;  4KAY A; 
#chains in the Genus database with same CATH topology
 4OJG A;  2Z4P A;  3IBC B;  3KG4 A;  2AJ1 A;  3I9Z A;  2RQM A;  1A7G E;  3K7R A;  3Q24 A;  4DR2 J;  1QVG R;  4PWD A;  4H4O B;  4PXB A;  2VU5 A;  2ZDO A;  4X62 J;  2V34 A;  1XNR F;  1F2G A;  2A6M A;  2OI2 A;  3DGP B;  4Y65 A;  5L1J A;  2BJD A;  3TAN A;  5KG0 A;  4C8K A;  1CLF A;  3P8B B;  2B9W A;  4ZN3 A;  3SCK E;  3CJQ A;  2KFZ A;  4LFB J;  2JEG A;  3KKF A;  4FPI A;  2L9N A;  5HAT A;  2DRD A;  3R97 A;  1YWX A;  4LF9 J;  2PN6 A;  2EC0 A;  4I69 A;  3ZZP A;  2IIH A;  2OPS B;  3KLG B;  2K1R A;  4EU0 A;  2E9Z A;  1IM4 A;  3SFG A;  3M8S A;  4CI0 B;  2N7Y A;  2YX7 A;  4RW4 A;  5HRO A;  4NA3 A;  2ZZM A;  4G1Q B;  2GA3 A;  2W5Q A;  1F5B A;  4NLY A;  3QO9 A;  3S1T A;  4LIW A;  3W2W A;  2UU9 J;  2PA3 A;  5B0A A;  4G65 A;  4TLQ A;  3QMQ A;  4F50 A;  3OFE A;  4IG0 A;  3ULH A;  3ISZ A;  5B0G A;  3SCJ E;  3WC2 A;  2FYX A;  2MTL A;  3I6P A;  1FK9 B;  1PG5 B;  1U1N A;  3UN3 A;  1RTD A;  2VFS A;  3LP2 A;  3N5B A;  4RWX A;  4WTY A;  3R5J B;  4NCG A;  3AJD A;  2CQ4 A;  2U2F A;  4DL0 C;  5AJ3 J;  4R8U A;  4AL5 A;  1JLA B;  1SC6 A;  3CCM S;  2BR0 A;  1TQL A;  1RTJ A;  1FDB A;  2LXF A;  4KO0 A;  3VAG A;  1NZ8 A;  1ZA1 B;  2G13 A;  2XY7 A;  1PGZ A;  1AJA A;  1TL7 B;  3IWL A;  5L8R C;  1VBX A;  1Q86 T;  4JBC A;  2FJB B;  1RHJ B;  4OX9 F;  2JEJ A;  4LF7 F;  5U47 A;  1Q79 A;  3K5O A;  2PEH A;  3MM7 A;  4DPU A;  2ALY B;  2QE5 A;  4Q45 A;  5DLF A;  3NNC A;  1CS4 B;  5EWE A;  1UWA A;  3OL9 A;  2GZO A;  2WZ1 A;  2DBB A;  3R6G B;  4RPF A;  4K0K J;  4H4O A;  1MLA A;  2W24 A;  3EXC X;  1IKW B;  2O1P A;  3H7H B;  4NZ7 A;  5LT5 A;  4LF5 F;  2VZ9 A;  3K0J A;  4DX6 A;  2Q79 A;  2QFJ A;  4MJK A;  3GV5 B;  1S77 D;  1HYS A;  2HS0 A;  4P72 A;  4DUZ F;  3A52 A;  3SBM A;  3BPS P;  3BN7 A;  4DFK A;  1F3F A;  4NLP A;  2KZZ A;  1BQM B;  4O3O A;  3NY0 A;  3RRK A;  5I42 B;  3HZE A;  1XMO J;  4C8Z A;  2VH7 A;  5J1E B;  2PD1 A;  4RU9 A;  4PPZ A;  4R25 A;  4DFM A;  5L0E A;  5M2U A;  1ZM3 A;  1BLU A;  4O0N A;  3H59 A;  3NOG A;  5KFM A;  2YXL A;  2DNO A;  2J0Q D;  3JTO A;  5EWF A;  6FD1 A;  2EG1 A;  2F8E X;  1M1H A;  3PR5 B;  3CUL A;  1XR6 A;  3TWZ A;  1M5P C;  3AOB A;  2DNN A;  4ECY A;  2VG6 A;  5ETT A;  2JH3 A;  3PVX A;  4I64 A;  4USU A;  4P6Q A;  4ZVG A;  1HMV A;  1Q1K A;  2GMH A;  4OI6 A;  1A0O B;  3DC2 A;  4OYX A;  1S1W A;  4JV0 A;  4DJB A;  4OI0 A;  1TKZ A;  2Y1J A;  1GH8 A;  3I4P A;  2KM8 C;  4N8O A;  3MMC A;  3TA0 A;  1F5C A;  2PMW A;  2ZNZ A;  5AE2 A;  2RAQ A;  4Z7Y A;  2VFV A;  4ED0 A;  4NLT A;  4MHX A;  4J9K A;  1FO1 A;  4G6V B;  4WU3 A;  5IZH A;  1Y5L B;  5C5J A;  1DY3 A;  1LW0 A;  4DLE A;  4C11 A;  3B54 A;  2UVU A;  4O4G B;  2CA9 A;  1FX4 A;  2YNI A;  1LKZ A;  3UDL A;  3HVT B;  4ES2 A;  4O3S A;  3M8Q A;  1DAX A;  4YDX A;  2PDA A;  3WZ0 A;  3PW7 A;  1N34 J;  4A8S A;  4KYZ A;  5A8R B;  2N82 B;  2IRU A;  2JLF A;  1S6Q B;  3MWB A;  3KWM A;  4RW6 B;  2I6W A;  2EK1 A;  1U02 A;  2NUU G;  2VF3 A;  3PKY A;  3PW4 A;  1V5I B;  4ZP9 A;  3I96 A;  3ISN D;  3VR1 A;  2VG7 B;  4LVN P;  4ETZ A;  4U95 A;  5KFO A;  3KK1 B;  3SYZ A;  1D9D A;  4N7T A;  2W7P A;  3RRG A;  2HVD A;  4V1A k;  1WEX A;  3AXM A;  2BJ8 A;  2BUN A;  1HD0 A;  5HP1 A;  2DHH A;  1S48 A;  2KJW A;  2HIQ A;  2XEX A;  1PO6 A;  3C14 A;  2IM0 A;  5C24 B;  1REV B;  2UVR A;  1S1U A;  1PAU B;  4N56 A;  2VG5 B;  3K17 A;  4ENO A;  1ZOT A;  3PYF A;  2C1E B;  3P5B P;  4LRF A;  2BYC A;  4I2P B;  5D4P A;  4ECX A;  5MLC V;  1X4E A;  4DLG A;  4A8Y A;  2Y3Y A;  4B9S A;  2H48 B;  4TY8 B;  3R6L B;  1C4C A;  2RU3 A;  2LDY A;  4QR2 A;  5AXL A;  5FLX Y;  1HWI A;  2MB0 B;  3D0G E;  4UQG A;  2Q43 A;  3MK2 A;  3MEG B;  4LRA A;  2C22 A;  4M95 A;  4KAV A;  3NCQ A;  4EZ9 A;  3QRP A;  1CJV A;  4CM2 A;  4RW9 B;  4LSL A;  3PRV A;  3V4M A;  3K57 A;  1E6Y B;  1D3W A;  1B99 A;  4IDK B;  5AXM A;  1LV5 A;  2J7K A;  5B0F A;  3L95 X;  2BJ3 A;  4AQY F;  2ALZ A;  2HFS A;  1TMM A;  4J9V A;  2CVI A;  4X4O A;  1NK0 A;  1NSQ A;  2JEI A;  4F26 A;  4AL6 A;  1BQM A;  2W2O P;  4U9R A;  1NO8 A;  1X9M A;  5K8N A;  1NJW A;  1WG4 A;  4CLK A;  2W25 A;  4C0O C;  1WNE A;  1RWV B;  4QZV B;  5H1S V;  2V2V A;  3G71 S;  4ES1 A;  2DH7 A;  3N28 A;  3PIP Q;  1D0E A;  4C8O A;  4NAS A;  1KON A;  1TKX B;  3NWG A;  5LOQ A;  4O0I A;  4LF8 J;  4PYD A;  5B0E A;  5D4O A;  4DR7 F;  2BQ3 A;  3HCX A;  2XHW A;  1ZBT A;  3GFH A;  3KXD A;  1RJJ A;  2CQ3 A;  1ELZ A;  3T00 A;  3UD5 A;  4A8M P;  1GT8 A;  3GE9 A;  4WFA Q;  2UXB J;  2CWK A;  2OPP B;  3BKU A;  3CJR A;  3O8W A;  3ZZT A;  5IFM A;  1T0T V;  1VRU B;  3QT7 A;  3LAK A;  3KUG A;  2M70 A;  4U67 Q;  1SH0 A;  2VBX A;  5KFQ A;  2DGS A;  2IAJ B;  2YVS A;  4CLY A;  1EHW A;  1Q95 G;  2O5D A;  3CDA A;  2VQF J;  3KFW X;  3FMB A;  4X4T A;  2XYG B;  1WSV A;  2AD9 A;  4I56 A;  1VQ7 S;  4RO0 A;  1T05 B;  3SZY A;  2QEX S;  2WAQ D;  3KUE A;  4ZVF A;  1Z2Z A;  1MRO A;  5MAO A;  1S0O A;  1ALK A;  3SZZ A;  1V6H A;  4BHQ A;  2CQH A;  2W5S A;  3DPC A;  1XNQ J;  2GIF A;  4JI8 J;  3W64 A;  3PFE A;  1F60 B;  3OT9 A;  1FWP A;  2MQ8 A;  5I3Q A;  5GAG U;  1HBM B;  5EX3 A;  2HIY A;  3G96 A;  2A2D A;  1H73 A;  5CD4 A;  4QOT A;  5HMZ A;  1CVJ A;  3HHL C;  1AT1 B;  4KPC A;  1XER A;  1Y5N B;  2G2Z A;  1V9O A;  3THP A;  5HRT A;  4CO5 A;  1S0N A;  2KDO A;  1FXD A;  2XMK A;  2YY3 A;  3K8V A;  1VRT B;  4H4K A;  4PAA A;  4RLE A;  1P1L A;  5E3P A;  1RT4 A;  1GMW D;  2OEM A;  3BH7 B;  3P4U B;  5HMY A;  2UXC J;  2AJQ A;  5F41 A;  3IS9 A;  2NXU A;  3BO4 A;  2DHG A;  4OJ3 A;  4B9U A;  2R2U A;  3DKD A;  4X4V A;  2DEI A;  2GAG C;  2XTJ P;  3JTP A;  4EBE A;  1WWH A;  1KSP A;  4L72 B;  2QLX A;  4X4Q A;  2MQO A;  4ED2 A;  3RB6 A;  4OX7 A;  2W5X A;  1IBK F;  4U6P A;  3WBH A;  3J81 j;  2CIM A;  3JSM A;  1HR0 J;  4C7Q A;  4F2S A;  1AJD A;  3TRG A;  1S10 A;  3PJW A;  1RT7 B;  1XJW B;  1RBO B;  2VBY A;  2W9C A;  5H9F K;  4KKO A;  2BAN B;  1ZS6 A;  5A8K B;  2V5H G;  1SC4 B;  1ITP A;  2J7U A;  4EUV A;  2G9Y A;  1V3S A;  1VQP S;  4JV5 F;  3DRP B;  3M1V B;  3KLV A;  3BPD A;  1NEE A;  4TNO A;  2LU2 A;  4UW2 A;  2QX0 A;  1TKD A;  4C8Y A;  4A8X A;  3CW2 C;  1HWJ A;  3W5Y A;  4CRJ A;  5CYJ A;  5B0B A;  4KAI A;  1UJ4 A;  3HD2 A;  5CD4 H;  2B7B B;  3AD7 C;  2V8V A;  4QCL A;  3ILL A;  4P2S A;  4WFX A;  3DRY A;  5C42 A;  5L1I A;  5H9F J;  2V9K A;  1SB6 A;  2RQK A;  1FKP B;  2SXL A;  5K8O A;  2R2S A;  2D1G A;  5DG9 A;  2BA9 A;  2AGP A;  1PYO B;  3I9V 9;  1X0P A;  3MEG A;  2VPX B;  4QR1 A;  2KT5 A;  4DZD A;  1UAW A;  2DNZ A;  4QYZ K;  2B56 A;  3CCW A;  1BWV A;  2JFD A;  2AZ3 A;  5B0C A;  4WYL A;  1Y6V A;  2UP1 A;  3OTD A;  1G6B A;  1OO0 B;  3GG0 A;  4DL4 A;  1Q4R A;  5L9X A;  3PEH A;  1JLE B;  1MWY A;  4M1K A;  2RKI B;  4K5R A;  5KG5 A;  1T9V A;  4IFV A;  2W8S A;  3R7S B;  4Y2A A;  3X3U A;  4CYU A;  2GJF A;  2ZVI A;  4URG A;  3HVR A;  1M5O C;  4F4K A;  3BQ0 A;  1H2T Z;  3BH6 B;  2QLW A;  5A76 A;  3QGH A;  3EGW B;  2QA4 S;  3HSZ A;  2GJI A;  2R2R A;  4RBV A;  1JLF A;  1KR4 A;  5F8I A;  4TY9 A;  4USW A;  3DOL A;  2CPD A;  5D4N A;  3EPG A;  4MAK A;  1RT6 A;  4C3K A;  2R7X A;  4NEY A;  1DLO A;  1ELY A;  1YI2 S;  3HFK A;  4YY3 F;  3GG1 A;  4JI4 F;  1VYA A;  2V2Q A;  3N9U C;  4IFY B;  1JWW A;  2ASD A;  1NKE A;  2UVV A;  1XK8 A;  5B7W A;  2BJ7 A;  1F9F A;  2ZKU A;  1XR7 A;  1FWK A;  4DPW A;  1URA A;  2EKY A;  5AT1 B;  3SZ2 A;  3DYC A;  4YS2 A;  3HFV A;  2CWX A;  2A18 A;  2RUS A;  3HX9 A;  4K5S A;  4MIW A;  4TN2 A;  4YN3 B;  1IN0 A;  4DBQ A;  1HNI A;  4RUB A;  3MEE B;  4TU7 A;  4LR7 A;  1Z4U A;  2JOQ A;  3RBZ A;  4DV0 F;  1HW8 A;  4ZVT B;  5K4P A;  2HWI A;  3OR2 A;  1YRU A;  2BE7 D;  4HT7 A;  4L3K A;  4KY3 A;  4Q2L A;  3PXG a;  4PG4 A;  7AT1 B;  5LMN J;  2RD5 C;  4NEZ A;  4P2M A;  1JXL A;  3V6H A;  4WII A;  1FVS A;  4F7V A;  1S7I A;  2FB0 A;  2BE9 B;  2BQR A;  2HHP A;  1O8B A;  5BR8 F;  2GJ2 A;  4KQZ A;  4XPE A;  2Z8Q A;  2AU0 A;  1M5V C;  2DHX A;  4HLB A;  5HSP A;  4NL5 A;  3ZC4 A;  1BGX T;  1F6T A;  1XN9 A;  3BBF A;  1JLA A;  1T95 A;  1H7X A;  3T02 A;  4B17 A;  2F65 A;  5AXK A;  1LW0 B;  2O3D A;  2BX6 A;  2OD4 A;  4O4G A;  1X9W A;  4EWT A;  3RRH A;  3QT5 A;  4IG3 B;  3NMR A;  5DO2 A;  2DXF A;  2V8G A;  1H74 A;  4LSN B;  4RX6 A;  3RZA A;  2YQ0 A;  2W5V A;  2QSF A;  1V3R A;  1RP5 A;  2M9K A;  4JUZ A;  2QJ3 A;  1U24 A;  1WF0 A;  2GHP A;  2K3I A;  3D1Q A;  3LAN A;  3HHN B;  4JI3 F;  3W3S A;  3TVY A;  4QU6 A;  2KRR A;  1KHK A;  2BW7 A;  4C8N A;  3TAR A;  2W8D A;  2CJ9 A;  4GO7 X;  2BAN A;  1JXV A;  3E3X A;  2VG6 B;  4LBP A;  4CO0 A;  4QWA A;  2V4Q A;  4KT0 C;  1C0T A;  3SXL A;  3THV A;  4MKB A;  4JI3 J;  2PSZ A;  3IA0 A;  1C0U B;  1FKO B;  4HVZ A;  5C24 A;  2KXN B;  1S57 A;  3F0N A;  1HBN A;  1FWL A;  2QV6 A;  1H2U X;  2XMV A;  3KUH A;  4WWS A;  5D0H A;  4JI0 F;  3KK2 B;  4B3S F;  4LMZ A;  4CXK A;  3NS5 A;  1R43 A;  3R5G A;  2ATL A;  4KJG A;  3ZZR A;  2DNG A;  3DU5 A;  4IG3 A;  4ZVQ B;  3GQC A;  3G9C A;  2FVQ A;  2OH2 A;  2E5G A;  4DFP A;  4UPK A;  3MAA A;  1UEV A;  1MWQ A;  2QZ8 A;  3OHB A;  3TJ8 A;  1XMB A;  4Q0B A;  4A8K A;  4MFB B;  1Q53 A;  4MY4 A;  5ETK A;  2OP5 A;  2EVZ A;  1LK5 A;  1RWN B;  2HGN A;  2Y0B B;  3F44 A;  3FRZ A;  3VGV A;  4CLT A;  1N88 A;  4QWE A;  3Q0A A;  3LP2 B;  1T05 A;  3UE2 A;  5IC4 B;  4F0M A;  1KH5 A;  3BDG B;  2OFH X;  2AJ0 A;  1NSP A;  2ZE2 A;  3ILJ A;  1WD6 A;  2DRA A;  5KOX A;  1T9W A;  3T19 A;  3PX6 A;  5T14 A;  1EET A;  2YH0 A;  3UVJ A;  1S4E A;  1JLG B;  2GVD B;  2XHC A;  3M8W A;  4URS A;  4WZQ A;  1SIZ A;  2ZOM A;  1UVJ A;  3HZG A;  3MMC B;  4ZLN A;  2CNK B;  5CAB A;  2EFP A;  5HRO B;  2KN4 A;  4W92 B;  2E66 A;  2FTR A;  2D9O A;  3MCM A;  4U7C A;  3NGD A;  2W7O A;  4ECW A;  3PW5 A;  3QJP A;  1HMV B;  2V2Z A;  4Q8E A;  4UZC A;  2VJV A;  1R8H A;  3UDE A;  3AHP A;  3N6N A;  3T5J A;  4LBH A;  5IT0 A;  3CCL S;  1RHM B;  1VQO S;  2XYP B;  3OSP A;  2HWT A;  2AKW B;  2FHK A;  3NKY A;  3TA1 A;  4DF4 A;  3DXS X;  4LR2 A;  4LQ3 A;  4ZJL A;  1G2E A;  3J81 U;  1FHT A;  1T9Y A;  4DV4 F;  4ZPB A;  5E5N A;  1YIT S;  5KFL A;  4XDD A;  4YEA A;  4N77 A;  2LEA A;  3P45 B;  3C6T A;  2RIJ A;  1GTE A;  3WX4 A;  3VVT A;  5F8L A;  3MHY A;  2FIU A;  4LSL B;  5D78 A;  1K47 A;  1WOR A;  2WON B;  4DCO B;  3HHE A;  4C48 A;  1L5U A;  3BS9 A;  1IR0 A;  3NCR A;  4NZ0 A;  2H4W B;  1X4G A;  1S9G B;  5B0D A;  2IJR A;  1LFW A;  4ITS A;  2U1A A;  3QFW A;  3D6H B;  4HHH A;  4NLD A;  1WC3 A;  5DDR C;  4Q5V A;  3VWS A;  2MPU A;  2ERR A;  1U1Q A;  1RT6 B;  2WBR A;  1IBK J;  2PI5 A;  1RTH B;  1F1B B;  3FCV A;  4F36 A;  1MMN A;  3WQP A;  2XCA A;  4ZPA A;  2BM0 A;  3RJM B;  2WB1 D;  3KLE B;  3L7P A;  4B3M J;  1RA7 A;  4OIX A;  3MAQ A;  1T94 A;  2LQB A;  1FDD A;  2X98 A;  4R5P A;  4NLQ A;  1EZZ B;  2KYX A;  2DGO A;  3R5B A;  4P52 A;  3SQG A;  3TUI C;  3S8S A;  5EWG A;  2I1R A;  4B3T J;  2Y1R I;  4USH A;  3G87 A;  2ZZN A;  3CCT A;  2LU1 A;  3WIU A;  2FVC A;  2HNY B;  4EO8 A;  2W8L A;  5K8P A;  3TI0 A;  4LF6 J;  2PA8 D;  3DLK A;  4DV5 J;  2ZC3 A;  4LUB A;  2UUB F;  1GNK A;  3MGJ A;  1FNO A;  1HWK A;  2E5J A;  3G2X A;  2ROE A;  4YHH J;  2HMI B;  2EBE A;  1EQ0 A;  2C2O B;  3LGM A;  1QAI A;  1U2C A;  1NK7 A;  4IDK A;  2MST A;  3RR8 A;  3RBD A;  2IPO B;  3NS7 B;  1FRM A;  2HUR A;  3IM8 A;  1JLF B;  3NGT A;  4F25 A;  1IBL F;  1FEE A;  1RT1 B;  2W5T A;  4KJD A;  2R7O A;  4EBC A;  1RWO B;  2C2N A;  4O44 A;  4ZJO A;  2BAC A;  2HQF A;  1L3S A;  1TZ0 A;  1IBM J;  4PKD B;  4ZGA A;  1IBM F;  2B8Q A;  3BGF A;  4CLU A;  2P5V A;  5HLF B;  2ASJ A;  3CC7 S;  5F8J A;  1TK5 A;  5J2M B;  4EYH B;  5DLW A;  4P71 A;  1ZYQ A;  2P8I A;  4PG8 A;  1R8A A;  3OXF A;  4ZCI A;  2E1M C;  2VC1 A;  2XMM A;  2FC9 A;  1N6Q A;  4NRT A;  1ED8 A;  3KLI A;  1OQ3 A;  2G1D A;  2PC6 A;  4KFB A;  4LQ9 A;  2GSN A;  1ZET A;  3W8G A;  2LEC A;  1RAF B;  1KFS A;  1KRP A;  3D2W A;  1RTI A;  3A8J A;  3I5C A;  4N41 A;  1JKH A;  3VV2 B;  4QIE A;  2B5J B;  4J7C A;  4DUZ J;  3UCG A;  5EGY A;  2F4V J;  4WBF A;  1FRJ A;  3W63 A;  2YPY A;  1IJF B;  4WFB Q;  2XNQ A;  5GAD I;  4Q8F A;  2C3P A;  3HHL D;  1C2P A;  3K2Y A;  4W98 A;  2WVF A;  5SUH A;  1U1R A;  2R7Q A;  2W5R A;  5HJY A;  2B4O A;  1UZD A;  4DX8 H;  5KFY A;  2LA6 A;  3OFF A;  1SIW B;  2XYH B;  5KFS A;  3VGU A;  5KFD A;  2R9L A;  3T1H J;  2M8H A;  3R9L A;  3H4B A;  2Y8Y A;  5GOV A;  3OR1 A;  4HHJ A;  1RAC B;  1TR0 A;  1YJT A;  3DDI A;  4HYK A;  3KHH A;  3RYL A;  2Z30 B;  3RTV A;  3V6D A;  1VI7 A;  3M6W A;  1WF2 A;  2IA6 A;  1AXQ A;  1YHQ S;  1OYE A;  2DNY A;  1D1U A;  4PZV A;  1T9U A;  4YR3 A;  4IR9 A;  1YBU A;  1RT5 B;  2XLK A;  4DG1 B;  2W4P A;  4TU8 A;  1HBO B;  2K2P A;  1KWM A;  4FN5 A;  1U6Z A;  4MIB A;  1RTJ B;  4KO0 B;  4HT5 A;  1GQE A;  2WB4 A;  1RCX B;  4OI3 A;  2UZA A;  3DDK A;  4NI2 B;  3MZI A;  1TK0 A;  1HI1 A;  1NB2 A;  1WC1 A;  3PYG A;  2RRB A;  1W7W A;  2BM1 A;  1UPP A;  3D5M A;  5F9N A;  2VOO A;  2DNL A;  4LFA J;  2IY5 B;  4L73 A;  2AHO B;  2IVF B;  1Q82 T;  5I3U B;  3I56 S;  2ZD1 B;  1VQ4 S;  2POK A;  1U2F A;  1X5T A;  2MKS A;  2QC3 A;  1TUV A;  2GGP B;  1WC4 A;  1XR5 A;  2YNH A;  4O23 A;  2IRY A;  2QL9 B;  3UNY A;  1RZM A;  2WVB A;  3W61 A;  5GAE I;  2UUC F;  1N2L A;  2ZOG A;  3IN5 A;  5D0R A;  5DDQ C;  4CXU A;  1C1C B;  2KKH A;  2EPI A;  3AJ1 A;  1Y7P A;  3HKW A;  1GXL A;  3T9N A;  4CT9 A;  4RNN A;  1SC3 B;  3CD5 A;  3W9J A;  1ZTT A;  1NPK A;  2EEY A;  4AQY J;  1FJG J;  2FUG 9;  1NPP A;  3D67 A;  2YQ3 A;  1WI6 A;  3MED A;  4A4J A;  3MCN A;  4ZP7 A;  3KDO A;  2IYI A;  5AXN A;  2CVE A;  4DQR A;  3JSY A;  4NLW A;  4ZVS B;  4B9V A;  3VAM A;  3DRX A;  3I87 A;  4RU2 A;  1QUP A;  3T5K A;  3LPE A;  2R2T A;  1DRZ A;  1J27 A;  1ZEB A;  1SJF A;  3T6B A;  1W25 A;  4KRW A;  3TX8 A;  5E41 A;  2G9O A;  3NKP A;  3V6J A;  2CNN B;  2MQQ A;  1RAH B;  4WKR A;  4OYB A;  3T1A A;  1NUE A;  2MY7 A;  4WP9 A;  5HI7 A;  4Y2C A;  1I6J A;  1X4D A;  3BDE A;  4K4S A;  2DB1 A;  4Y3C A;  1GX5 A;  2BVZ A;  2CQ0 A;  4TXS A;  3DLK B;  5IV3 A;  1HQ2 A;  2XNR A;  2GML A;  3PYE A;  4K59 A;  1FER A;  1D8Z A;  3FSI A;  2Z0G A;  3WAX A;  3KLF B;  1X5O A;  5LXY A;  5F8N A;  2B6A B;  3J7Z 5;  4DV1 F;  2QFI A;  5KG1 A;  4HH0 A;  4NLV A;  2HQG A;  4KFB B;  4G1Q A;  5C2G A;  2UUA J;  5KFW A;  2WVE A;  4J90 A;  1P1T A;  4J9Q A;  2WHO A;  3LOU A;  1HBU A;  3IRX B;  4USV A;  3W8P A;  1PC4 A;  2JZ5 A;  4MK9 A;  4RZR A;  2VQE J;  2MKH A;  1NK8 A;  2RRA A;  3FBB A;  3FCW A;  2PFF B;  3N79 A;  2YNI B;  3TG0 A;  3TX0 A;  1CSJ A;  4UQT A;  5KT3 A;  2CPZ A;  1FE4 A;  2HAI A;  4U8V A;  1FKA F;  4BCA A;  4LT6 A;  3GV8 B;  1C1C A;  1VJQ A;  2WW4 A;  4RBT A;  2R8I A;  4CDI A;  3UD3 P;  5DGA A;  2Q1L A;  3GWC A;  4H4M B;  4B9N A;  4LF8 F;  1VQL S;  1KOH A;  4LVO P;  1KQF B;  4WE1 A;  4GTZ A;  2FHJ D;  3TZW A;  2YKM A;  4DSK A;  1LWE A;  3DMJ B;  3CMA S;  1IQZ A;  2GIR A;  3KK3 B;  3ITH B;  3DDN A;  1OY8 A;  4QYR A;  4LRC A;  4BWM A;  2L41 A;  2DIU A;  4BBY A;  4NMX A;  1TL3 B;  1U8W A;  2AEJ A;  5DG7 A;  1ROF A;  3PV8 A;  2XLJ A;  3MMJ A;  3BDF A;  3R1H A;  2EFN A;  1ANJ A;  5IM0 A;  1AUS L;  3I31 A;  1ALJ A;  2ZM6 F;  2OGU A;  3HFZ B;  5EHH A;  1NK6 A;  1NCL A;  2HZA A;  2DKO B;  4B08 A;  5I4M A;  2RIL A;  4WFN Q;  4GC6 A;  4V19 J;  2JLE A;  3P49 B;  2RNE A;  1WC0 A;  2C3U A;  1S99 A;  2DO4 A;  4OYA A;  2GC8 A;  2XS7 A;  1X4F A;  1NDP A;  1DTT A;  2MKY A;  4DZ6 A;  4KAY A;  4KHR A;  2HBY B;  1B7F A;  4CZC A;  1VK3 A;  2B43 A;  2KVI A;  3OFG A;  2BOP A;  3W60 A;  4LR9 A;  4JV1 A;  3TQE A;  1U09 A;  1HKA A;  4FKX A;  3K89 A;  5CXT A;  1S4F A;  1I1G A;  1ZPV A;  1WKK A;  2HK3 A;  2ILY A;  1P49 A;  1RLC L;  1TL1 B;  1ZM9 A;  3MPV A;  1VBZ A;  2ZJP Q;  1M90 T;  4XAK A;  1SJ3 P;  4ZLJ A;  2RF2 A;  4OX8 A;  4ZHR A;  5IWA F;  1FSU A;  5F8G A;  2IA0 A;  4KHP F;  3MM8 B;  3GSI A;  2BMB A;  1HQE A;  4FNH A;  5KFJ A;  5CCM A;  3QZ7 A;  2FD2 A;  3MTJ A;  3DRR A;  2K06 A;  2ZJQ Q;  3PJ9 A;  1YJV A;  5EDW A;  2XBP A;  4OYM A;  4HAC B;  1T3O A;  2YNG B;  1CS4 A;  2VV5 A;  4DL5 A;  4Y34 A;  3NVL A;  4UTG A;  4LQY A;  2M3D A;  5E3C A;  3CCE S;  3R3T A;  4KV8 B;  3O1L A;  2MKC A;  4A48 A;  1OY6 A;  2XG8 A;  4OYO A;  3CD7 A;  1GX6 A;  1Y3J A;  2H4Y B;  3Q8Q B;  1ZZN A;  3H40 A;  4F02 A;  3TYT A;  3JTN A;  1YJ9 S;  1HAR A;  2OEL A;  2PII A;  4CO2 A;  2ZKT A;  1JNZ B;  4TY8 A;  4UZB A;  1LFP A;  2NUH A;  2HBR B;  3A8I A;  3L7O A;  3MPY A;  3MM8 A;  5D77 A;  4PRF A;  4HR2 A;  4C11 B;  4DR1 J;  4A8Q A;  1R0A A;  3NLC A;  4YHH F;  2IC3 A;  3LA0 A;  2J6U A;  2IYG A;  2J7W A;  2B8P A;  5DET A;  1ICE B;  3EGV A;  3GB0 A;  3KDN A;  2G0C A;  3AQP A;  5K14 B;  5RUB A;  1BE4 A;  3J7Z T;  2MJU A;  4OHV A;  3UN5 A;  1S72 S;  3QBC A;  2WW8 A;  4KGX B;  4BC7 A;  5C25 B;  1JK9 B;  1Q8B A;  4CTA B;  2ZH3 A;  1RXO B;  1N36 F;  2NPF A;  1XBW A;  4FZV A;  2D9P A;  3BBC A;  3G86 A;  3D3C J;  2ADC A;  5DDO C;  3R2C J;  3BBB A;  4I67 A;  2HAF A;  3MPW A;  4OZ5 A;  2N7C A;  4ICL A;  4LF1 A;  4U7U K;  4UOC A;  2K7K A;  3M2U A;  3PO5 A;  4B9T A;  5ITH A;  4M5G A;  3OBI A;  2B7C B;  5GMK a;  3R27 A;  4MK7 A;  3U7J A;  1KHW A;  4MIV A;  1X60 A;  4WF9 Q;  5T7L A;  1NJY A;  4F4W A;  1LWC A;  1X9S A;  2DHS A;  4ZLP A;  2ZJR Q;  1KLM B;  3RU0 A;  4QYZ J;  1VOM A;  2LP4 A;  1BQX A;  1RIS A;  1ZAV A;  2BRK A;  1GTH A;  2DNK A;  2AIR B;  2KI2 A;  4J5O A;  4M8L A;  1VLO A;  4WFZ A;  5BJR A;  4PUO A;  3CJT A;  1GAO A;  5JUM A;  4M5H A;  3IR7 B;  4EK2 A;  5IT4 A;  2B3T B;  3HUL A;  1GMV A;  2YKM B;  3J7Y U;  2WOM B;  2DNH A;  1BHN A;  4OI1 A;  1U25 A;  4ED4 A;  1NH7 A;  3FSX A;  3X1L B;  4S0M A;  1Y7A A;  4JYA J;  2RDI A;  3BKF A;  2DR5 A;  4JP8 A;  4J9N A;  4E98 A;  2WVC A;  3ZTO A;  2IFX A;  1S6Q A;  1VDH A;  4N47 A;  5HMX A;  3CTR A;  3DFE A;  5DLV A;  2HVI A;  4DR7 J;  3KJN B;  4TN0 A;  2JC0 A;  3NGU A;  5LRN A;  1Y10 A;  2YX4 A;  1X7V A;  2YH1 A;  2MYF A;  3LGN A;  5J2N B;  3ENV A;  4K2X A;  1NHU A;  4RKU C;  2XY6 A;  2C2R A;  4W90 B;  2MZQ A;  1KHV A;  1FF2 A;  5F8M A;  3CCQ S;  1UW9 A;  2ZUA A;  1PJ5 A;  1DBD A;  4M5J A;  3GU0 A;  3AA8 A;  2F3J A;  1JKH B;  1U7L A;  1GMU A;  1LOU A;  4ILM A;  2HVH A;  3DLG B;  3SQO P;  2ACY A;  3NBP B;  2RU9 A;  3M8Z A;  2LFV A;  3MPU B;  3FQK A;  5HAO A;  1UJ6 A;  3GMG A;  1ALI A;  3Q8U A;  2Q6B A;  1JLC A;  3CUN A;  2BE2 A;  2XMU A;  2PMZ D;  3BQ1 A;  3DRS A;  1X4B A;  2RJZ A;  4Y0F A;  4IH5 A;  1U47 A;  4ES3 A;  2ZH6 A;  1NJZ A;  3CIM A;  5CYQ B;  2UV8 A;  3RAQ A;  4DQP A;  2X3D A;  2CQI A;  3OXG A;  5BXI A;  4DR6 J;  5KT4 A;  3TAP A;  2E1A A;  1SBR A;  5K20 B;  3KLF A;  1WOP A;  1ZZF A;  2W01 A;  2W7A A;  1WKJ A;  3GJQ B;  3N4W A;  4LF2 A;  4UOF A;  5E0O A;  3VAL A;  4ECU A;  4G3I A;  3TNV A;  3BR9 A;  1RDR A;  3GYG A;  2WVD A;  3GSD A;  4JI5 J;  4B56 A;  1TL5 A;  3OFH A;  3VAK A;  4IUF A;  5BYR A;  4KM4 A;  2R7S A;  2CZ4 A;  4GMK A;  5AE1 A;  1KHJ A;  4C98 A;  2JLG A;  4Y2M A;  5ETO A;  4C3M A;  5BR8 J;  2CQ2 A;  4B3S J;  2AEM A;  3QAU A;  3PY8 A;  2OAU A;  2J8S A;  2RB7 A;  5CYM B;  4CM0 A;  4CLS A;  3RGI A;  3HSG A;  1PC5 A;  3ELH A;  2E5L F;  1IWG A;  1R7I A;  4DR2 F;  3CNQ P;  3MR5 A;  3G8T A;  1RHQ B;  1UVM A;  1YRX A;  2LQ8 A;  2VDH A;  3HHL A;  3LW5 C;  4MFB A;  4P10 A;  3DHX A;  3KHG A;  3PW2 A;  2OPR B;  2MHN A;  3CJ3 A;  3U02 A;  3W2V B;  1RKJ A;  1T11 A;  3GCX P;  3L9Z A;  4KIA A;  1VQ8 S;  4HI2 A;  1WAC A;  4B3T F;  3DLJ A;  2HND A;  2GS8 A;  1TKT B;  3ET6 A;  3H8Y A;  1RE1 B;  4JI2 F;  3D4J A;  2R7R A;  3OQ2 A;  4DQI A;  1R8P A;  2RE1 A;  4I6A A;  4LF9 F;  2DK2 A;  1HBN B;  1JLE A;  4TYA A;  1SUQ B;  1S1T B;  3A3O B;  3FEZ A;  1YQH A;  5B08 A;  4XK8 C;  1IR1 A;  1CJT B;  1Q5V A;  2OO4 A;  3AB2 B;  5J2P A;  2I8E A;  2CG4 A;  2VDI A;  3W5X A;  2DPI A;  2MZR A;  1L3K A;  2KTQ A;  3RUB L;  1HBU B;  1YVF A;  2DY1 A;  2D74 B;  2UXC F;  3V6D B;  1KBR A;  1R0B G;  1JLQ A;  2CJK A;  1HNZ J;  2NQP A;  1Q78 A;  4X65 F;  3E51 A;  3MAH A;  1EP4 A;  2OPQ A;  4KHM A;  4AXJ A;  3WAV A;  2WSC C;  4I6W A;  5KFZ A;  2XUL A;  3CC4 S;  2W8K A;  5C66 A;  2CPF A;  4OZL A;  2CQB A;  2HG4 A;  5KFA A;  4XPC A;  4JI8 F;  4FF1 A;  1KDN A;  2UUW A;  3TP2 A;  7FDR A;  1MU2 A;  3RAM A;  1QE1 B;  1VBY A;  4X2B A;  4KKO B;  5A8K A;  3BSN A;  3M2U B;  2W4D A;  4RR5 A;  3NL0 A;  2ZD1 A;  1AJC A;  2NXJ A;  3S6E A;  4NX9 A;  3OTO J;  5EX0 A;  2PE8 A;  2J5A A;  4CH0 S;  2RS8 A;  4FBT A;  5D0E A;  1YZ6 A;  2MQN A;  1G1X A;  1RWP B;  2HFZ A;  3OTB A;  3QNW B;  4DSF A;  1HD1 A;  2OPR A;  4ID8 A;  4CYR A;  1EB0 A;  2ZBQ A;  3S7R A;  3J81 Y;  5IOL A;  2VJU A;  2CAD A;  3FC9 A;  3DI6 B;  3FVY A;  2FGO A;  2W9B A;  1X5P A;  1HNZ F;  3C8Y A;  3N6L A;  5L0B A;  1CJU B;  2C42 A;  3RG6 A;  3U1L A;  2BQU A;  2G4B A;  2VG5 A;  2AJ4 A;  1YG0 A;  3L4B C;  2VKZ G;  1CC8 A;  3GLJ A;  4IH7 A;  3SSR A;  5HN0 A;  4DQQ A;  4TVA B;  1R6Y A;  4C0B A;  4B3M F;  3IR6 B;  4QAX A;  3FK4 A;  3RBX A;  5C25 A;  5G0R A;  5T41 A;  1HWL A;  1FTR A;  1N33 F;  1IKV A;  1JLB A;  2ABY A;  3TAM A;  3V2U C;  3VZI A;  3I82 A;  3VAJ A;  3MM9 B;  2Y1I A;  4JI1 F;  2QLJ B;  1UZH A;  3D9B A;  2W1B A;  1UL3 A;  3CDE A;  3CJ2 A;  3V81 B;  1WOS A;  2KVQ E;  1YIJ S;  3MXH P;  4YR2 A;  4KTQ A;  1SQG A;  2BJ9 A;  1HPZ B;  4F0K A;  1Z2L A;  1KOO A;  2LA4 A;  3NMA A;  4EEY A;  3FJ2 A;  3ZZO A;  2JWN A;  1C0U A;  1FKO A;  5KFF A;  1Q7Y T;  2ZDP A;  1RBL A;  3GON A;  4I4B A;  2RSQ A;  1HI8 A;  3UR3 C;  8ATC B;  1K73 T;  3QGG A;  1IWA A;  4X4R A;  2V8D A;  2KXF A;  2H1Y A;  5DQH A;  3CDB A;  1XTZ A;  5SZT A;  1OMS A;  1YKW A;  2QYC A;  2B0G A;  3L7U A;  3L09 A;  3VF0 B;  3PFO A;  1EAY C;  3PCO B;  6FDR A;  2ZM6 J;  4J9U E;  4B3R F;  4DHV A;  1KC8 T;  1MN9 A;  3SV4 A;  4C3L A;  3IRW P;  4C8L A;  1FJC A;  2AX1 A;  5CZX A;  4ZVO B;  6AT1 B;  4N5S A;  2RT3 A;  3CSK A;  2HHX A;  4ILR A;  2CQC A;  5D8H B;  5HQM A;  2E29 A;  2XO6 A;  1QAJ A;  1F0X A;  5C42 B;  2ZHB A;  1EW8 A;  3R1L A;  2YWH A;  3KNG A;  3FEX B;  4YQW A;  3KMS A;  5L1L A;  4IFY A;  4KR0 B;  3VQT A;  3G6X A;  1Y0H A;  1WDT A;  4ID5 A;  5HVH A;  1JJ2 R;  2OEJ A;  1E33 P;  2LQ9 A;  1ACM B;  1WG1 A;  3AXK A;  4PCQ A;  3T9Z A;  2OIH A;  3H4D A;  1TEL A;  2FZK B;  3EDR B;  1N0V C;  3D28 A;  1TTH B;  2R7W A;  2N3L A;  4MTP A;  4X66 F;  3UCU P;  1U1L A;  4IQX A;  4CO4 A;  3QLH B;  4V19 X;  3P96 A;  5J2Q B;  2HFO A;  4DPT A;  1TU0 B;  3EZU A;  4G1P A;  1K7H A;  1TL7 A;  2GLQ A;  2MZS A;  1PBU A;  1KLM A;  2I5J B;  2O66 A;  3VTI A;  4AT1 B;  2MLX A;  4RW4 B;  5KT6 A;  3MR6 A;  4ED5 A;  1AFI A;  1SV5 B;  1OYD A;  1TL4 A;  3I0R A;  5CZV A;  2GO8 A;  3MR7 A;  1SH2 A;  4D3G A;  1Y3K A;  2NPI A;  1YSJ A;  2YKO A;  1L3V A;  5KXA A;  4DR5 F;  3J7A 1;  4UOR A;  1W26 A;  4DI6 A;  4NLG A;  2X1G A;  2AYM A;  4C4W A;  2DHA A;  3C6T B;  3AOC A;  3O2I A;  3PJX A;  2UUC J;  3OTC A;  2H5I B;  3J7Y I;  2EWH A;  3CXC R;  2VKR A;  1S12 A;  3FBC A;  2GX8 A;  4FYV B;  4K4Y A;  3H5Y A;  3Q86 A;  4XIU A;  1O0P A;  3ETO A;  4CLW A;  5LSO A;  5DQG A;  3N0V A;  3UVJ B;  2ZWP A;  2MHE A;  4YB5 A;  3MUT P;  3EZO A;  2VQE F;  1QM9 A;  1RT4 B;  2HQ3 A;  3QJJ A;  1N5Y A;  2OMO A;  3E01 A;  5I42 A;  2CG8 A;  4DL6 A;  4ZG9 A;  4YP3 A;  5CQG A;  4JB8 B;  4TKT A;  4UUW A;  1YTY A;  3I0R B;  2XMA A;  3CCR S;  5L9N A;  1N32 J;  2NZC A;  2RQ4 A;  1K9M T;  1ALH A;  5IM0 B;  4ER8 A;  3LF0 A;  2E1C A;  2AJ2 A;  2CPY A;  2Y9H A;  3M8P A;  5E3R A;  4PWD B;  3NBP A;  1FRI A;  4OV1 A;  4C6A A;  4CO1 A;  3NNH A;  1JB0 C;  3PKM A;  3RB4 A;  3JS9 A;  4NZ6 A;  3ZNJ 1;  3KK1 A;  1EQJ A;  2KFY A;  3VAI A;  1J5O A;  1DJ0 A;  3C2P A;  4GKJ J;  3OW2 R;  4J91 A;  4CWB A;  1AW0 A;  2VFU A;  1GXU A;  2FLO A;  1S1W B;  3BN4 A;  4KGZ B;  1AJB A;  4UUX A;  2OPS A;  1FTC A;  4HHU A;  5KG6 A;  2R42 A;  4NWJ A;  3E01 B;  1RAO A;  4OI2 A;  1B7Y B;  2ZH2 A;  4OLO A;  1U8S A;  5EGH A;  1X4A A;  2MLY A;  3A8K A;  1OQ6 A;  1WTF A;  1FNM A;  2YWW A;  5JVG Q;  3QFH A;  1E6V A;  1HNW F;  3GP9 A;  3UW1 A;  2V8H A;  3W66 A;  1XNQ F;  1IKX B;  1UFL A;  2BV3 A;  1P9Q C;  4URQ U;  2X3G A;  3BDP A;  3H2L A;  1FK9 A;  2DR9 A;  3VCD A;  3QGP A;  4GKK J;  5J1E A;  4PYA A;  4PUO B;  3V4I B;  5D3G B;  1NZA A;  4LF6 F;  1Z1Z A;  5KG7 A;  5L1K A;  1DAR A;  2ZFH A;  3BB5 A;  1LWC B;  3O6Q A;  5BYQ A;  3KK2 A;  4OJ1 A;  3K5M A;  1IJE B;  2RHS B;  3MMB A;  4AND A;  5THW A;  1Y00 A;  2WK4 A;  3HLU A;  3FSY A;  2E5L J;  1I51 B;  4Y28 C;  3QLH A;  1CJK B;  2E7W A;  1QTN B;  3IXQ A;  2J9D E;  4NLX A;  1VJW A;  4TQR A;  1NDL A;  2XO7 A;  1L3U A;  4FF2 A;  3US5 A;  1WC5 A;  1VFJ A;  4DL7 A;  1YJN S;  1B8J A;  1UEK A;  3GFY A;  3KMQ A;  3P3D A;  1LXJ A;  1NHK L;  3NCP A;  2LCW A;  5AJ3 F;  2P9E A;  3BR8 A;  4NLS A;  4H4M A;  2MZ1 A;  1C0T B;  3LWL A;  3QSY B;  1CQN A;  3CB4 A;  4I1T A;  2YKN B;  1H98 A;  1NK5 A;  1N33 J;  3H0P A;  1CJU A;  4DV5 F;  4CIO A;  2UUB J;  4O3R A;  2HHU A;  3EMT A;  1NKB A;  1RAD B;  4ECS A;  1ZM2 A;  3KG0 A;  5IXU A;  3OLA A;  5HVF A;  4IR1 A;  1TAU A;  4OYZ A;  1HFE L;  2UXB F;  2OTJ S;  2R4F A;  4ELT A;  4JOU A;  5HP1 B;  2E1P A;  2EFQ A;  3DLB A;  1H38 A;  4B3O B;  4L6V 3;  3D6M B;  4FYY B;  4EI2 A;  2M88 A;  4Q0B B;  3BYR A;  3EWG A;  1DQ9 A;  2DGV A;  3CO9 A;  4MK8 A;  3EYZ A;  4AL7 A;  3U1M A;  3GCW P;  1CUL A;  3BRE A;  1MWZ A;  4YB1 P;  1O98 A;  2GVZ A;  1S9F A;  4NRU A;  2KU7 A;  2V68 A;  4NXN J;  3OJS A;  2GSO A;  2DXD A;  3N01 A;  3M9O B;  2RS2 A;  1HBO A;  3AB4 B;  3GR0 A;  4P9S A;  4WXW A;  5ETL A;  3SSS A;  2W4C A;  3DM2 A;  1HDH A;  1RLD A;  4PXD A;  5F0W A;  1HQE B;  5J1N A;  2GIQ A;  2DGT A;  5J1P A;  2PT0 A;  5GAD U;  1KTQ A;  1MN7 A;  5HBM B;  4DV2 F;  4ED8 A;  2ROP A;  2AYB A;  3B5Q A;  2I0X A;  2DO0 A;  4O3P A;  2PI4 A;  3DI6 A;  1O6X A;  4ZVP B;  5LMU J;  3W2W B;  4LSZ B;  3T5L A;  3TJA A;  1TK8 A;  4ZJQ A;  1O99 A;  1Q7L B;  5D15 A;  2DH9 A;  5FDL B;  2F9J A;  3TO8 A;  1S9E B;  2L9W A;  3D3B J;  3KJF B;  2AYG A;  3J7A N;  2R7T A;  4CXS A;  4RW9 A;  4BLG A;  2Q66 A;  2RUG A;  3KG1 A;  1DTT B;  2DCL A;  2HSE B;  3D0I E;  4FPR A;  4RNF A;  1RHR B;  3A4T A;  1VQS A;  2VB6 A;  4M5M A;  4K50 A;  1IBL J;  1OJ4 A;  3EVO A;  4IQM A;  3PTW A;  2AYE A;  3C15 B;  1EX8 A;  1RAE B;  2MSS A;  3CT9 A;  4ZK7 M;  3PEJ A;  3JSM B;  4ED1 A;  1XMO F;  3MPD A;  4U8Y A;  3TJ9 A;  2QA2 A;  1TL1 A;  1VQ9 S;  2E9T A;  1YK9 A;  4FP9 A;  2AZ1 A;  1NSK L;  2BBE A;  2MMY A;  4QPX A;  1FJ7 A;  1QLN A;  1TP7 A;  1C4A A;  2AF6 A;  1ZTW A;  1HQU A;  3GZ7 A;  5DZ6 A;  1TFY A;  3G8S A;  1RAI B;  1CBK A;  3FKB A;  1D09 B;  2ZBC A;  4OL8 A;  1KQG B;  1EJ7 L;  1KNZ A;  4L76 A;  2WSF C;  4RW6 A;  4U96 A;  1B64 A;  2GSU A;  2ZH8 A;  3IBF B;  2L3M A;  3BF4 A;  2GW8 A;  2Z2M A;  4DWI A;  1FFW B;  2H9Z A;  2ATC B;  2NXE A;  3O5T B;  4K4X A;  4PG5 A;  4Q44 A;  5E3A A;  3ENA A;  1A9N B;  2YX1 A;  1H2V Z;  3GPA A;  4NA1 A;  3OJU A;  3BSC A;  2RQC A;  4ECV A;  3LP0 A;  1V3Z A;  1I3O B;  3M6X A;  3SV3 A;  2Y8W A;  1CJK A;  1OY9 A;  2BJ1 A;  2D41 A;  3CMQ A;  3AT1 B;  5CA5 A;  5FD1 A;  2BDP A;  1DUR A;  3P5T L;  1WJ9 A;  4HEA 9;  1NK4 A;  4B9L A;  4A8W A;  2J6S A;  1CG2 A;  1NPR A;  1RK8 A;  2LQ5 A;  2XWX A;  3C3L A;  3GFX A;  3MR2 A;  1S76 D;  2J76 E;  1U2R A;  3MTK A;  1NJX A;  4DV3 F;  2BKP A;  1Q0N A;  2EG2 A;  2FJE B;  2KYZ A;  2NCK L;  2D1C A;  4C2M A;  2C2K B;  2E44 A;  3SIP B;  3J80 Y;  2BEF A;  4OHW A;  1DZ5 A;  2GGP A;  4USI A;  4IRK A;  3CED A;  1Q8I A;  1FRL A;  2QA4 G;  1VRT A;  2B4P A;  2XI3 A;  4ZP6 A;  8RUC A;  3KK3 A;  2CJB A;  2CJA A;  4OZ3 A;  5HK4 A;  4G1I A;  3SCL E;  2FJW A;  5F9L A;  3C6U A;  3BGU A;  3FFI B;  3CF5 Q;  3OXL A;  3DYA B;  4DV7 J;  3CIZ A;  2EW9 A;  4OMF G;  3CJS A;  3IBW A;  4DR3 F;  2FJV A;  1UW4 A;  3IO1 A;  1EAR A;  3Q8V A;  3H2U B;  1SJ4 P;  2QA1 A;  3ZZU A;  2FVR A;  3W65 A;  5HVG A;  2K7J A;  1M5K C;  4LF4 J;  1IVZ A;  1LEO A;  1S97 A;  2J8A A;  2W2M P;  3CWJ A;  3DRS B;  4B3R J;  4YME A;  4X64 J;  5G4D A;  2Q3P A;  3R5C A;  2OML A;  5ETM A;  2FHO B;  4ZIT A;  1OPI A;  1BC6 A;  2HK2 A;  4NYZ A;  1XEZ A;  2WOM A;  2JC1 A;  3TVK A;  3M05 A;  2CQD A;  2GAH C;  3G6V A;  3JYT A;  1D9A A;  4PQA A;  4YUD A;  2K8G A;  1CC7 A;  4DV3 J;  2FDN A;  3UDV A;  2B9Y A;  4FXD A;  1HHQ A;  3LP0 B;  5DJB A;  1GMW A;  4UPL A;  1YJU A;  2IBO A;  4ZCL A;  4DL3 A;  1T3N A;  3FZB A;  1ULR A;  4RUH A;  3J80 U;  2F9D A;  3BZQ A;  4F3M A;  4J9S A;  2G0I A;  1S6O A;  4J37 A;  3IAM 9;  3A12 A;  1UA1 A;  4DV7 F;  2MJN A;  4MT1 A;  3ED4 A;  1Y11 A;  2F40 A;  4DSE A;  2H5E A;  4AFF A;  2UUA F;  3GJT B;  2XSJ B;  1ZA2 B;  4F8R A;  2YPZ A;  2GO9 A;  4FVM A;  1U49 A;  3PR4 A;  2V6A A;  4NXM J;  3QAT A;  1FFG B;  2J9C A;  1HBM A;  3KLI B;  5IS2 A;  3QZ8 A;  3VAH A;  2HND B;  3EXY A;  4UOP A;  4AXI A;  3DLE B;  1VQN S;  3IC1 A;  5HQ8 A;  1IUJ A;  1HW9 A;  2H5J B;  3MUR P;  4J9R A;  1BY9 A;  1T8E A;  5ETV A;  1NJI T;  5LIA A;  3H5S A;  2UU9 F;  4B9M A;  5ETS A;  4WP8 A;  2ZH7 A;  3LWM A;  4GVB A;  2AGQ A;  3GIK A;  3MMA B;  1R0A B;  2V0N A;  4NI2 A;  2D3Z A;  5IJS A;  1HR0 F;  2JRS A;  2V63 A;  4NCB A;  3LGH A;  4QR0 A;  5FLX U;  4CCH A;  2D3U A;  1FJG F;  1SH3 A;  1YZ7 A;  3B4D A;  3G82 A;  2C2D A;  4OYI A;  4K4W A;  3BM7 A;  1ZPW X;  3W1Y C;  3H98 A;  1UVN A;  1Q8L A;  3IWX A;  3NGS A;  2KH9 A;  4QIV A;  4ZPV R;  1KQK A;  5HJX A;  2BOA A;  5ETP A;  1FE0 A;  3NAI A;  1LW2 B;  2LQJ A;  4JI2 J;  3VZH A;  1WKL A;  1NXI A;  5A8R A;  3GV7 B;  3OVB A;  1H3D A;  4JI7 J;  2BJE A;  3JAM U;  3DRP A;  2XWY A;  1RU2 A;  1XIQ A;  2X1B A;  2G0J A;  3D68 A;  3WHI A;  4A8O A;  4GVB B;  4QWC A;  3CCV S;  4GC7 A;  2NR0 A;  4K0K F;  2CKW A;  4C97 A;  4RUA A;  2HRT A;  3CDU A;  2HWH A;  2I2Y A;  2R7V A;  1EP4 B;  2OPQ B;  1DTQ B;  4LFC F;  4K4Z A;  2VOP A;  3IP0 A;  1WHW A;  2L9D A;  3CO0 P;  3E8O A;  1B0P A;  3ZNU A;  3NOC A;  3W7B A;  4A46 A;  4ILL A;  4LBI A;  3JSB A;  5LQQ A;  2WCX A;  2Z57 B;  1UKU A;  2VBZ A;  2XMW A;  2VG7 A;  2FY8 A;  1FCA A;  3AOA A;  3W62 A;  4ECZ A;  4YFU A;  2JFK A;  2Y0S D;  2UUT A;  3C66 A;  4ZPT R;  4P7T A;  3RW6 A;  1VS3 A;  3PRD A;  3NWR A;  2XS5 A;  1RT3 B;  3H2V E;  2V4J A;  2XC9 A;  4HAC A;  2G1H A;  1ZAW A;  2ZE2 B;  3BKT A;  4XTT A;  3CPW R;  3KJV B;  4P74 A;  3HM9 A;  2IBK A;  2JNJ A;  4UT4 A;  3Q8S B;  4BDP A;  4FF3 A;  5AJ9 A;  3UD4 P;  1YX2 A;  3QGI A;  1SJQ A;  2RKI A;  2IM2 A;  4QW9 A;  3IGZ B;  3HDS A;  2DNP A;  1DQ8 A;  5KFE A;  2V94 A;  4ICL B;  1EIY B;  2J0X A;  4I2P A;  3BEG B;  1ELO A;  3AD8 C;  4ZIV A;  4Q7A A;  3Q3Q A;  1ED9 A;  3C19 A;  3MAA B;  2C2M B;  3OR2 B;  2A6O A;  1BQN A;  4RW8 A;  2AJF E;  2EFG A;  2HS4 A;  4UOH A;  1IKX A;  3SDE A;  1KHN A;  1Y4Z B;  2KT3 A;  2M7S A;  4O3Q A;  4DUY F;  1N6Q B;  4K4U A;  1VIO A;  4GTW A;  4DCJ B;  4I0W A;  3VGS A;  4ZA1 A;  4DU7 A;  5KFP A;  4EGL A;  2XGP A;  3QRQ A;  3NKM A;  4FYX B;  4WTO B;  4NXN F;  3D7S B;  2HRY A;  5LRM A;  3AJ2 A;  3AOD A;  1NKC A;  4E2F B;  2C2E A;  3NKQ A;  3A1Y G;  2NSB A;  5KFT A;  1SUQ A;  2H65 B;  4LJM A;  4A8F A;  4Y2K A;  1ZH5 A;  3T1H F;  2PMH A;  1RBA A;  4WU2 A;  5KG3 A;  4DV0 J;  1G4C A;  3V5R A;  4LSN A;  4OYP A;  5LMU F;  4DU8 A;  1Q81 T;  4H54 A;  5LMN F;  3PNI A;  4YDD B;  4IG0 B;  3M8P B;  3LQV A;  4ETX A;  1JLQ B;  4DR1 F;  1I5O B;  1VK8 A;  5ADZ A;  2F4V F;  3CD6 S;  3K5P A;  3Q89 A;  1VIX A;  1WC6 A;  3K58 A;  2CAJ A;  2WRM A;  3JQJ A;  5KFK A;  4AUK A;  1WTB A;  2CJY B;  3B78 A;  2NRE A;  1IR2 A;  1SKU B;  5LJ5 Y;  4A47 A;  4DR3 J;  2OJ3 A;  3DLG A;  2IAJ A;  1R27 B;  1YLX A;  4Y2I A;  3F73 A;  1RYR A;  3Q22 A;  2VFT A;  4ZIW A;  3HP6 A;  4F67 A;  5A6P A;  2RML A;  3C6U B;  2QSW A;  3FFI A;  3NEK A;  1UVK A;  3S01 A;  3DYA A;  1AUD A;  2KFN A;  4FDJ A;  3D1H A;  1FKP A;  4TYB A;  2HVE A;  2NYI A;  2V67 A;  4FDF A;  1BQN B;  4MYT A;  4P75 A;  4PAB A;  5A2Q Y;  2KG1 A;  4F4Y A;  1NAQ A;  2QLB B;  3R2D J;  3NAH A;  3QT8 A;  3H25 A;  1TV6 B;  3FGV A;  1LWF B;  3ZTR A;  4KH0 B;  1N48 A;  1P27 B;  3KLH B;  4M5I A;  4RW7 A;  4DN0 A;  4FXV A;  3QYY A;  1DQA A;  1VRQ C;  4PWW A;  3C16 B;  3K5L A;  1WEZ A;  3RR7 A;  2ASY A;  4M5L A;  1ZEF A;  3OR1 B;  4UF4 A;  1E6Y A;  2XZW A;  3T3F A;  2P9G A;  5CHC B;  3HKZ D;  4HTJ A;  4YR0 A;  3KHR A;  2CPE A;  1VQK S;  3JSR A;  3M9M B;  1RU1 A;  4J9P A;  3OUY A;  1S0V A;  3LAM A;  4CNZ A;  4NCA A;  5T7L B;  3IG1 A;  3HI9 A;  4USJ C;  5KFG A;  4ID5 B;  3IR5 B;  4EO6 A;  5H9E K;  3HK2 A;  1URB A;  2QZU A;  1NH8 A;  1BMQ B;  3H20 A;  4UY8 5;  3UCZ P;  2XMJ A;  1H0H B;  2ZH1 A;  4KE5 A;  2WTF A;  2NSC A;  3TZX A;  2XB2 D;  2D3O R;  4OJH A;  3DOK A;  3CVK A;  1SHN A;  3TA2 A;  2ZIT A;  2VD3 A;  4AYB D;  2XY5 A;  4H4K C;  2YKN A;  3BSA A;  3HF5 A;  4ANE A;  2HZV A;  3AH6 A;  3M2R A;  1S1U B;  5FJ4 A;  3R7B B;  3OPK A;  2QRR A;  5H9E J;  3H90 A;  1D8Y A;  2EI5 A;  2GMJ A;  5CH7 B;  5GRR A;  2A0F B;  2OKQ A;  3QIP B;  5DLG A;  2CJQ A;  3GR1 A;  1TL3 A;  2ZHA A;  4DPX A;  1U4B A;  1K0T A;  5I3U A;  1HNW J;  4I7F A;  3IWN C;  1KQS R;  1NDK A;  1N5V A;  1B70 B;  1RWX B;  2JHE A;  1PJ7 A;  4X84 A;  4IOA Q;  2V8P A;  4LRE A;  4LFA F;  1ANI A;  5DQI A;  1U1K A;  4NXM F;  3UN2 A;  3EUN A;  1FA0 A;  2B4V A;  1FES A;  1RT3 A;  1UET A;  3L3C A;  4NWX A;  2CNL B;  3I32 A;  2XCP A;  2M8D B;  2R3V A;  1FXL A;  2R8H A;  4MYU A;  2B5J A;  2B9X A;  5LM7 E;  1NHV A;  2WSE C;  3ILO A;  1T9T A;  2LXI A;  1PAE X;  2OSQ A;  1P8G A;  4XDC A;  1MML A;  1YJW S;  3M7V A;  5D0G A;  2VA3 A;  1RA6 A;  2IDL A;  3QIP A;  4RNO A;  1QE1 A;  4RNH A;  5B09 A;  1CPZ A;  3AA9 A;  1S6P B;  4CLZ A;  3I55 S;  1H7W A;  2AT1 B;  4MKY A;  4N76 A;  4KGK A;  1N5T A;  3B82 A;  2RHQ B;  1R8B A;  1U26 A;  3H42 A;  1FD2 A;  5KG4 A;  1U6B A;  3EVM A;  3G6E S;  2DNM A;  4DXL A;  1QAX A;  1X8D A;  2H51 B;  4NWB A;  2VPY B;  4RL1 A;  3ZTQ A;  3NNA A;  2UVW A;  1F2H A;  1N32 F;  1KVI A;  1H6K X;  1VQY A;  3M4X A;  1OPZ A;  2EFV A;  3EE3 A;  4QIW D;  4R5P B;  1HNV B;  1RT1 A;  4BS2 A;  3Q2S C;  2D7S A;  2IM3 A;  1QAY A;  3Q8R B;  2DIT A;  3CCJ S;  2J9D A;  1IXK A;  2Z2Y B;  3MOZ A;  2PO4 A;  2B6A A;  3ADA C;  2OLW A;  4LF4 F;  2RH6 A;  1T9X A;  3M2V A;  3EX7 B;  4GKJ F;  3I4H X;  4QPT A;  5G0R B;  3GIL A;  1E1Z P;  2CQG A;  2ZVS A;  2ADB A;  3BGR A;  2FLL A;  3BO3 A;  1IM6 A;  3FZ2 A;  3CJ4 A;  1IBC B;  4DUY J;  2IC3 B;  2FHM A;  3WC0 A;  1K1Q A;  3ENQ A;  2JL9 A;  3DNC A;  3MCO A;  5DRK A;  1FRH A;  4OZ2 A;  4LFC J;  3B4M A;  5K8M A;  3FEY B;  3DXB A;  1KVK A;  4HI1 A;  5KFB A;  2H54 B;  3G8Q A;  2Z56 B;  2AWZ A;  2BRL A;  2FC8 A;  3H5U A;  4ZPC A;  3IG1 B;  3TZZ A;  3BV8 A;  1R0C B;  3MM6 B;  4LRB A;  1JIH A;  1LXN A;  2K3K A;  3IMQ J;  5D4L A;  3ZTP A;  1NU4 A;  5HQL A;  3UR0 A;  3U1N A;  1GXT A;  1DFD A;  2IRX A;  5KOW A;  4ZPD A;  5L38 A;  3CCS S;  1B0V A;  3FUY A;  3DOK B;  1BUX A;  1UVL A;  2YNG A;  3UI3 A;  2MQL A;  3GJS B;  4IKA A;  3G4S S;  1UVI A;  3QID A;  2IFY A;  3DM2 B;  3UPF A;  4I2Q A;  1RGV A;  1WI8 A;  3EVW A;  4IO1 A;  3TQ1 A;  2DY9 A;  2GFF A;  4ALZ A;  4ED3 A;  4DQS A;  4HKQ A;  3HVT A;  5IJQ A;  4MKV A;  3DGP A;  1MMD A;  2GVZ B;  1RAA B;  1R89 A;  2RH3 A;  4JI6 J;  2HYI B;  3TUZ C;  4JI6 F;  2YNF A;  2YKA A;  1ZAX A;  2HHV A;  1YJ7 A;  1HJK A;  1U48 A;  1RTI B;  1SKS A;  3SSQ A;  5GAH I;  4C8M A;  1X4H A;  2VQF F;  2KT2 A;  3C16 A;  3PG9 A;  3SQG B;  3PX4 A;  1FFS B;  1RB0 A;  3C46 A;  1S59 A;  2M5Y A;  2Q6C A;  3PHT A;  5DM7 Q;  2CDQ A;  1IKY B;  2ZH4 A;  4ELU A;  2XMT A;  1JLC B;  2HPU A;  2A3J A;  2XZD B;  3WX8 A;  3BGO P;  3LAL A;  2F63 A;  3IFE A;  1KTV A;  5JXS A;  2RF2 B;  3AFG A;  4EMD A;  1PYT A;  1FRK A;  1WHX A;  2YWE A;  4ZHR B;  4P2X A;  5DGB A;  3OLB A;  4J9O A;  2FZG B;  4KPY A;  3THT A;  5JJB A;  3MMB B;  3Q8P B;  2ZBP A;  2MLZ A;  2ANH A;  2HQC A;  1HHT P;  2DT9 A;  1FJE B;  2OFG X;  3BDG A;  2GA7 A;  4KB7 A;  4YB6 A;  2KM8 B;  1X0F A;  1J5O B;  3HT0 A;  4JI4 J;  3EGZ A;  2AEF A;  3TZY A;  3HJF A;  2ROG A;  1EET B;  1OSD A;  1N52 B;  3JQM A;  3KJQ B;  4DSI A;  1JLG A;  2GVD A;  4OHZ A;  1KFD A;  2VON A;  4DSJ A;  1B0T A;  1LWX A;  1SL0 A;  1M1K T;  3MK1 A;  4FNI A;  1XC9 A;  2OD6 A;  4WKY A;  4ZCM A;  5HL7 Q;  2J9E A;  3KNA A;  2KO1 A;  2CZ9 A;  3NXZ A;  5F3T A;  1E2S P;  2IMO A;  4DR4 J;  5F8H A;  3KLH A;  3ZTS A;  1RQ0 A;  1WDD A;  2QTW A;  1SL1 A;  4I2Q B;  1MW7 A;  1U1P A;  1TAQ A;  1SKW A;  1AA1 B;  4YOE A;  5KT7 A;  1G3O A;  2NS1 B;  2V50 A;  3HJV A;  4KH1 B;  1UPM B;  3QWU A;  2M2B A;  2Y1L B;  1WF1 A;  1MNE A;  1XMQ F;  1N34 F;  3QO9 B;  1J5E F;  1JXE A;  3LP1 B;  4HTI A;  5KT5 A;  3OUY B;  1VGY A;  4CTA A;  3Q23 A;  1I94 J;  3DLL Q;  4UY8 T;  3SDE B;  2BZ2 A;  3K5N A;  3KD8 A;  3T1Y J;  4EFA C;  1LK7 A;  1Q16 B;  2FZC B;  3PYD A;  3T1Y F;  2BKN A;  2DJW A;  1EW2 A;  4J9M A;  2LMI A;  3M6V A;  4D3H A;  4AD6 A;  5GAG I;  4WIQ A;  1U0H A;  1P9Y A;  3R8Y A;  3CCU S;  2GV1 A;  1KD1 T;  1SV5 A;  3PO4 A;  4DMZ A;  4M94 A;  2JJ4 D;  1S0M A;  2DPJ A;  1S9G A;  1FXR A;  4MIA A;  2DGU A;  3IDD A;  4DEZ A;  3Q83 A;  3GIM A;  2XZT B;  3GYN A;  4ANC A;  3VVU A;  3DCA A;  2CQP A;  1OIA A;  4PG7 A;  4YB7 A;  1TV6 A;  3M6U A;  2A10 A;  2LDI A;  4N8N A;  5IQQ A;  3D54 A;  3UNG C;  2ZHO A;  4QW8 A;  4NML A;  2NLW A;  4E8U A;  2QT7 A;  3IM9 A;  3NS6 A;  4W4M A;  4X64 F;  3NP5 A;  3VHQ A;  1S1V B;  1RCO B;  4X4S A;  3OSN A;  2IJF A;  3MF5 A;  1HNV A;  1ZM4 A;  2L48 A;  4P73 A;  4HL9 A;  4OZJ A;  5AE3 A;  3MFI A;  2JSX A;  2C3Y A;  2NYH A;  5A0Y B;  5IT9 U;  3OTE A;  2VQR A;  1JJC B;  2HQD A;  3KLG A;  1UFK A;  3DRR B;  4ED6 A;  4DV1 J;  4X4P A;  2ZNY A;  2B9E A;  1I94 F;  1RT5 A;  2DIS A;  2CNO B;  3MCS A;  4M5K A;  1T7P A;  1SQE A;  3E2D A;  3QPI A;  2D69 A;  1F9E B;  2HQI A;  3T5H A;  4KV8 A;  4K4V A;  2FJD B;  1BXN A;  5ETN A;  2YQ1 A;  4NOH A;  2KHC A;  2YKP A;  4JYA F;  3MEE A;  1RWU A;  2G2O A;  2IMW P;  1DTQ A;  4OV6 A;  3PDN A;  5LL6 d;  1W2I A;  1QY7 A;  5A8W B;  3SEO A;  3KHL A;  2R7U A;  3HO1 A;  3WAW A;  2BAB A;  2F8M A;  2ZH9 A;  4MH8 A;  4JI7 F;  1R3N A;  3M30 A;  5JMN A;  1KH7 A;  2A2C A;  1EJJ A;  1GK8 A;  2HKE A;  4EYI B;  3HD1 A;  2VC0 A;  3PX0 A;  4GKK F;  3BSO A;  1U45 A;  4IOC Q;  1HPZ A;  2OUG A;  2MZJ A;  4DG1 A;  3RB0 A;  3KJV A;  3HT3 A;  2P9C A;  1UJ5 A;  3CJ0 A;  3GJR B;  4WP3 A;  2ZH5 A;  3M32 A;  4DPO A;  3MUM P;  4JI0 J;  1SQF A;  3FBF A;  3DU6 A;  2IUC B;  3QT6 A;  3F41 A;  1KS2 A;  1S9E A;  2RDJ A;  3AY0 A;  5IT9 Y;  5INH A;  4WPA A;  2KL8 A;  2VA2 A;  3CJ5 A;  1MSW D;  4ZPW R;  3AD9 C;  2J0W A;  3K8W A;  4OZN A;  3TAQ A;  4GRS A;  5DG8 A;  2BKO A;  2ZWO A;  2QGF B;  4ZS6 A;  4IO9 Q;  2N4C A;  1AYE A;  3MMA A;  3QAE A;  2W5W A;  4FDI A;  2KXH A;  4WXO A;  3UQS A;  5K9F A;  2CZV C;  2HFU A;  3FRY A;  2KRB A;  2MZT A;  4USM A;  3JB9 k;  1NBE B;  2CJX B;  2FGC A;  4ZLL A;  1HA1 A;  3D1O A;  2JVR A;  2VPZ B;  1VC0 A;  3U27 A;  5HLF A;  1S6P A;  4OX6 A;  2QYG A;  1OWX A;  4ZMM A;  2FVP A;  5DDP C;  2EFO A;  4NPO A;  1VC6 A;  2DGX A;  1HWU A;  2QG9 B;  5ETR A;  4PR6 A;  5IWA J;  2LXU A;  1JX4 A;  3HVA A;  2NZ4 A;  2CUY A;  3O44 A;  3WBZ A;  3MUV P;  5D6G A;  2RDD A;  3V81 A;  1IQT A;  2DGQ A;  1KKH A;  2GHW A;  1HQA A;  2W2Q P;  4FKY A;  1REG X;  2AQ4 A;  2CPX A;  3G82 B;  5IQ6 A;  4B3O A;  1RAG B;  1C1B A;  1FDN A;  5CYQ A;  3R5A A;  2X1A A;  2HHH F;  4FBU A;  3AAW B;  3TVZ A;  2HHS A;  8AT1 B;  4X62 F;  1RYS A;  1XNR J;  2L08 A;  2F7V A;  2IHR 1;  1TKZ B;  2YWK A;  3CJ8 A;  3FNN A;  2E9R X;  3IGY B;  2KHD A;  4OZ0 A;  4B02 A;  5CAA A;  2MKI A;  1VIS A;  2KZM A;  2WON A;  3V4I A;  5D3G A;  3NGK A;  2EC2 A;  4DV4 J;  4ECQ A;  4AE5 A;  4JV5 J;  1KHL A;  1RT2 A;  3CJK A;  1TVR A;  2N4D A;  2QMX A;  3A8E A;  5DZ7 A;  1LWE B;  1X4C A;  3DMJ A;  3HSJ A;  1RAB B;  4O44 B;  4RJV A;  5KFH A;  4RNM A;  4CYU B;  4K8R A;  1HI0 P;  2HFN A;  5J2N A;  2DR8 A;  5L0K A;  2XLI A;  4DL2 A;  2FVS A;  1U6F A;  4MMO A;  2W2N P;  1WEY A;  1NME B;  3KLE A;  1HIY A;  4DUT A;  5HAN A;  2DXE A;  1ARO P;  4L74 A;  4Z2X A;  3ZO7 A;  2EXU A;  2X7I A;  3CGI A;  4NE9 C;  4YR1 A;  1RHK B;  1RWM B;  3NRB A;  4OZ1 A;  1NK9 A;  1OS5 A;  3QWP A;  2OTL S;  3MR3 A;  5EGE A;  1APS A;  2CRL A;  4ZN1 A;  3P6Y C;  4ZVR B;  1SCJ B;  3IGV A;  3D0H E;  4WYW A;  1TKT A;  3ET6 B;  2EK6 A;  3JAM Y;  2UXD J;  4RUC A;  1UCN A;  1U1O A;  2HGM A;  2YTC A;  1FDA A;  3MM5 B;  4PXE A;  1WHV A;  3SFU A;  5J2Q A;  3RB3 A;  3MED B;  2DRB A;  2R8G A;  4UPH A;  4CLF A;  2CYY A;  2CXE A;  4DV2 J;  1ZED A;  2FHJ A;  3EJM A;  2FJX A;  1T03 B;  4PXC A;  4FS2 A;  2R8K A;  1L3T A;  1CQM A;  1U0S A;  1VLY A;  2PEB A;  3LTO A;  4WJB A;  1RTZ A;  5CYM A;  2XM3 A;  1VC5 A;  2MQM A;  1N54 B;  2DEJ A;  2H3E B;  1C1B B;  2ZEJ A;  3VAF A;  3N5F A;  3TEG A;  2VIH A;  4DSL A;  2QO3 A;  3RAX A;  2R8J A;  4UPI A;  3K59 A;  1FD8 A;  2DIV A;  4FYD A;  4NCG B;  1RWK B;  3SMZ A;  2E1R A;  3LP1 A;  3TR5 A;  3QSI A;  4CNY A;  4CP5 A;  3EZ5 A;  4R0J A;  2HNZ B;  5GAH U;  3MM6 A;  2QL5 B;  2B51 A;  2GCF A;  2QN6 B;  1TVR B;  2DNQ A;  3DOL B;  5I3P A;  5GAE U;  4CH1 A;  4OQJ A;  1JNR B;  2KJV A;  3AQO A;  3BGL A;  2LYV A;  2Z2L A;  2VUG A;  3CCZ A;  3MEK A;  1WUU A;  4Q2M A;  2AW0 A;  3W2V A;  3GIJ A;  1QSL A;  1UA0 A;  2AP6 A;  2GQQ A;  5M2P A;  1QD1 A;  1UMJ A;  4ZG7 A;  2IJN A;  2FLN A;  4OHY A;  4DFJ A;  4GO5 X;  1JQG A;  5KFX A;  4FF4 A;  3G6Y A;  1VMB A;  2J6T A;  3PW0 A;  1VHF A;  1J2V A;  1S5Z A;  3HSD A;  3MEC B;  4QIF A;  1DLO B;  3ZZY A;  1SL2 A;  2LEB A;  3BQ2 A;  3OL7 A;  5DS7 A;  5EUH A;  2HHW A;  3M2V B;  1S49 A;  2QMU B;  4OLP A;  1RWW B;  2YNF B;  4WK1 A;  1TUW A;  1RI7 A;  4YY3 J;  3LUY A;  4BWJ A;  2W9A A;  2F1F A;  1QSS A;  2CPJ A;  3DLH A;  1PJ6 A;  3O3L A;  2MXY A;  1G7C B;  1WOO A;  2M4M A;  2LLZ A;  5E2Q A;  1YJR A;  1Q5Y A;  3NG8 A;  1H72 C;  3V6K A;  1M0S A;  3M8Q B;  3DN9 A;  9ATC B;  1VBK A;  1UFW A;  5KFU A;  2V4J B;  3TW0 A;  2GNK A;  3QQC D;  3LO3 A;  1N36 J;  5KT2 A;  4I7F B;  1PSD A;  4UOG A;  2X51 A;  3IRX A;  3JQK A;  1REV A;  1SVD A;  2V2K A;  3MM9 A;  5C2C A;  4R0E A;  4QU7 A;  2XR9 A;  1HQU B;  3F56 A;  4DX5 A;  4F4X A;  1PYS B;  2ASL A;  5F3Z A;  3D66 A;  3T6J A;  3T41 A;  3GII A;  4KBI A;  4ERD A;  3OVA A;  1S79 A;  4P7V A;  3NKO A;  2QLF B;  3IAS 9;  1VQ6 S;  4KGM A;  1WSR A;  1PCA A;  1RAJ A;  2VHG A;  3HVW A;  2IM1 A;  3UFC X;  4DN9 A;  3NKR A;  5DLT A;  4F3Q A;  1EQM A;  3ICL A;  5LXR A;  4LRD A;  3LH2 S;  2DR6 A;  3B8H A;  3C15 A;  4K2J A;  1VQ5 S;  2HMI A;  4ZG6 A;  3ILI A;  1EI6 A;  1SC1 B;  4LR8 A;  1QJH A;  4NYO A;  4X66 J;  4CYS A;  5KFN A;  4CLP A;  5A2Q U;  4Y00 A;  5GME A;  2XQC A;  1F5A A;  1JMT A;  5GVQ A;  2P2C B;  4CT8 A;  1P6T A;  1S1V A;  4P2F A;  1URN A;  4DR6 F;  1KH4 A;  2AMC B;  1R31 A;  5JVH Q;  1VR6 A;  2N3O A;  3SI8 A;  2IUC A;  1NLK L;  2HBZ B;  3POT A;  4FXW A;  2MGZ A;  1S7H A;  1CJV B;  1IKY A;  2M52 A;  2MKJ A;  4DV6 J;  1TFW A;  1KH9 A;  5HMW A;  1FEH A;  2Z58 B;  4PEO A;  4RW7 B;  2C28 A;  1TKX A;  2CQ1 A;  4LIR A;  3W9I A;  4ZVE A;  3M2R B;  2XSJ A;  4ED7 A;  4ELV A;  3KOA A;  1PBA A;  4Z37 A;  2DNR A;  4WCE Q;  3I5A A;  1XWL A;  2BW2 A;  1N0U A;  4QWB A;  1N5Y B;  1R6V A;  3ISN C;  4KC5 A;  4O4R A;  3FMW A;  1K8A T;  1M5S A;  1YGY A;  1XMQ J;  3GIR A;  3MDF A;  4IOB A;  3B6B A;  3DLE A;  3HPO A;  5GMD A;  1YDL A;  5A8W A;  2HZC A;  1WG5 A;  3C14 B;  2KB2 A;  4RWW A;  1V5V A;  3H5X A;  4PQU A;  1NSA A;  5C7P A;  2GHV C;  3OD2 A;  5LSL A;  3CDW A;  1AB8 A;  2CFX A;  3POT B;  2MGZ B;  3A13 A;  3PRB A;  1CUL B;  3R5D A;  2RRN A;  2ZBR A;  5K5M A;  4ZDN A;  2OPP A;  7FD1 A;  4OX9 J;  4BC9 A;  3UO0 A;  1NND A;  3A3P B;  3I5B A;  1N4L A;  1FNX H;  3PAC A;  1YBT A;  2JVO A;  2BXJ A;  1E3C P;  3OTO F;  2P6S A;  5A0Y A;  1JJH A;  2HHQ A;  3MK0 A;  5HBM A;  2C3M A;  1GFW B;  1LWF A;  1SI9 A;  2W9C B;  2ZZT A;  1U0H B;  4DV6 F;  2D3O 1;  4ZVU B;  1S1X B;  1WEL A;  1SKR A;  2HNY A;  4KJI A;  2QMW A;  4ZOS A;  5J2M A;  2P6T A;  1FI4 A;  3FDS A;  3Q8Y A;  4U7U D;  1CEZ A;  3VGT A;  3TEH B;  3ZZZ A;  1O5J A;  5F0U A;  4M63 A;  5KAK A;  1QUV A;  3W5Z A;  3PIO Q;  4CLL A;  4FS1 A;  2AV5 A;  1TMJ A;  4NLR A;  1Y5I B;  2DYA A;  1HHS A;  2E7V A;  4X65 J;  2HS3 A;  2VFR A;  3M8R A;  1QSY A;  1UWB A;  3HHD A;  4QWD A;  2HBQ B;  4F2R A;  3DOM A;  4M5D B;  4K4T A;  2UXD F;  4I68 A;  1FVQ A;  4DDF A;  3OL6 A;  1M5H A;  2ACM A;  4NYP A;  4JI1 J;  3DHW C;  4LF7 J;  2FJA B;  2DGW A;  4ATN A;  1JJ4 A;  2I5J A;  3UDC A;  4HDH A;  4QBU A;  2JX2 A;  1LNQ A;  1K0V A;  5FII A;  2HFV A;  4NLO A;  2ZOF A;  4K7Q A;  3EM1 A;  1F3V A;  1SXL A;  4UST A;  4X4N A;  2DVI A;  4C0H A;  3I0S B;  4CH7 A;  3DGV A;  1VHI A;  3KYL A;  4IRD A;  3RW7 A;  4CO3 A;  4QJV A;  4ZKA A;  5TJ3 A;  4LF5 J;  2F5G A;  2BE2 B;  4USK A;  2YKQ A;  4Y6I A;  2WBM A;  5IV4 A;  2XRG A;  1E6V B;  1YBA A;  4OFZ A;  2I9S A;  3A3N B;  1EKR A;  4MKA A;  4WK3 A;  4Q43 A;  2VIC A;  1B4S A;  2HHH J;  2DCU B;  4QIG A;  4XO0 A;  1N5S A;  5KTQ A;  1GEH A;  4KGV B;  1URR A;  3WIV A;  5KFI A;  1AUK A;  1IKW A;  1S1T A;  4ECT A;  2JEF A;  4C9D A;  3MI7 X;  1NM2 A;  2F8H A;  2AX0 A;  4ZVH A;  4ZCK A;  1KN6 A;  2ZBI A;  3E2E A;  1HLW A;  1XQI A;  2OHD A;  2G2Y A;  4RW8 B;  3I0S A;  3VQS A;  2FPH X;  4F04 B;  3ITH A;  4F4Z A;  5M2R A;  3JYT B;  1NRK A;  1W2B R;  2YWG A;  3CMR A;  3FQL A;  4TQS A;  2XI2 A;  4L75 A;  4DF8 A;  2QIF A;  1D9F A;  3MOJ B;  1K1S A;  1MRO B;  2DTJ A;  2W9B B;  2E7X A;  4R8U B;  1HNX J;  1OSC A;  2FQQ B;  4IYQ A;  1B3T A;  3GYX B;  1T02 A;  2YNH B;  1U1M A;  3TOQ A;  3TUP A;  1LQ9 A;  1MG7 A;  1YRT A;  4WFY A;  4KSE B;  1RT7 A;  1KP6 A;  2VAS A;  2EBG A;  3LPY A;  2B4U A;  2A1B A;  2O01 C;  3BO2 A;  4EBD A;  1QVF R;  3GFZ A;  4TU9 A;  4DX7 A;  4I6Y A;  2AGO A;  2UV8 G;  3IGN A;  2V69 A;  1IKV B;  1JLB B;  2CDR B;  5L46 A;  4PQU B;  1AZS A;  2C2Z B;  5E3Q A;  1HYS B;  1ELX A;  4OYW A;  4FVC A;  2LEP A;  1KEK A;  3IS9 B;  3M8Y A;  3HMJ G;  2MEW A;  5K14 A;  1CJT A;  5J2P B;  3OVS A;  1S1X A;  3ENW A;  3KTQ A;  4ECR A;  2M0G B;  1J5E J;  4NLU A;  5LSR A;  1QTM A;  3LXQ A;  2LVW A;  2HVZ A;  1O51 A;  2GQ2 A;  3CE8 A;  1PKU A;  2MQP A;  1N2K A;  5IC6 B;  2VOD A;  3UWT A;  1HNI B;  3D6F B;  1UWB B;  5BYS A;  1HNX F;  3CME S;  1VRU A;  2HRU A;  3BYP A;  3SCI E;  3MM5 A;  4DR4 F;  1VCT A;  4KHP J;  2OEK A;  4GTX A;  2OSR A;  2YBV A;  3MD3 A;  2FY1 A;  3TAM B;  4PPD A;  3PZP A;  3OV7 A;  2VL1 A;  3NKN A;  2HLU A;  2MY8 A;  3MEC A;  3RBE A;  5L39 A;  3OL8 A;  2J0S D;  1MU2 B;  2YWF A;  4CQ1 A;  3EIC A;  3FCH A;  1PIL A;  3MM7 B;  4IRC A;  2F4F A;  2GQC A;  4JI5 F;  3EPI A;  3DOM B;  2IVM A;  3ONQ A;  2ZUG A;  4M5D A;  3CC2 S;  1BWE A;  1EW9 A;  4OHX A;  5CCL A;  1N56 A;  1N5Q A;  3GTY X;  2COL A;  2EKN A;  3M30 B;  5DM6 Q;  2XGQ A;  4OI4 A;  1SJR A;  5FDL A;  3R7N B;  2XS2 A;  3Q2T C;  3QJL A;  2HLT A;  2Z2Z A;  3EGN A;  3FBE A;  4NA2 A;  2ZC4 A;  2DH8 A;  4O3N A;  3ZXW A;  1LW2 A;  1RTD B;  5KFC A;  2O67 A;  5LJ3 Y;  1FT8 A;  4PG6 A;  1NB7 A;  2PGC A;  4F4A A;  1SHQ A;  1SPB P;  2W2P P;  4PWU A;  2V4R A;  5ETQ A;  4J9L A;  1EKS A;  2NXN A;  3M32 B;  1N8R T;  1TUG B;  3WAY A;  3N6M A;  2E5I A;  2XSF A;  2NXC A;  1RTH A;  1UP1 A;  4F0H A;  1HL6 A;  3BJY A;  1FX2 A;  2HHT A;  4ZP8 A;  2CPH A;  1M1G A;  3ETM A;  4X4U A;  1Q8K A;  2APO A;  3PM9 A;  3NGR A;  3M1V A;  2V9W A;  1SJ1 A;  4DR5 J;  1DHM A;  3OHA A;  3BDH A;  2PFD A;  2QL7 B;  5KFR A;  2MDA A;  3D6T B;  3ZZ0 A;  5EN1 A;  5HO4 A;  3EDQ B;  4DS4 A;  4DOZ A;  1Y9O A;  1X31 C;  1PIE A;  1R8C A;  2DR7 A;  4L3N A;  2HEK A;  1RHU B;  4GVL A;  5KFV A;  2KG0 A;  1RUS A;  4WE1 B;  5KG2 A;  1RT2 B;  2RVJ A;  2LKZ A;  2VPW B;  3CJK B;  1KLN A;  4JV2 A;  4UOO A;  2I38 A;  4E0D A;  5A6W A;  2K1R B;  2HGL A;  2C3O A;  1RKI A;  1K44 A;  2E5H A;  4TLR A;  4QQB A;  4Z7C A;  2MKK A;  3PHE A;  4DCP B;  3M9N B;  1BD6 A;  1UTA A;  3JXO A;  5E33 A;  3BGR B;  1WHY A;  1AZS B;  2HNZ A;  3W9H A;  1S6U A;  4HDG A;  2FLP A;  4HH1 A;  1AFJ A;  1VQM S;  3QRR A;  4F3O A;  4LFB F;  4RBU A;  3MD1 A;  4FYW B;  3HHK A;  2IDE A;  2IVY A;  2ILZ A;  3ZFV A;  5E7O B;  1RSC A;  4IH6 A;  3WDO A;  1NDC A;  1X5S A;  1KVJ A;  3HHL B;  1QDU B;  4M5N A;  3HXM A;  3MFH A;  4WZM A;  2JDJ A;  4IFV B;  3T01 A;  3TUJ C;  2CPI A;  4DS5 A;  1T03 A;  4GTY A;  2X1F A;  1A6L A;  1F9H A;  2DD8 S;  4DPY A;  9RUB A;  3CD0 A;  4EZ6 A;  2VBW A;  1UEU A;  2HW3 A;  1FRX A; 
#chains in the Genus database with same CATH homology
 3Q3Q A;  1ED9 A;  5GOV A;  2IUC A;  2GSO A;  4N7T A;  4LR9 A;  1KHL A;  3M8W A;  2D1G A;  3M7V A;  4B56 A;  1KHN A;  1B8J A;  3KD8 A;  4GTW A;  1P49 A;  4KM4 A;  3M8Y A;  1Y6V A;  1EW2 A;  1KHJ A;  3NKM A;  1EW8 A;  4LRF A;  1FSU A;  5LRM A;  4YR1 A;  3LXQ A;  3NKQ A;  5EGE A;  1N2K A;  4LR2 A;  1E33 P;  2W8S A;  3IDD A;  1KH9 A;  2GA3 A;  2W5Q A;  3MK2 A;  4LRA A;  4KAV A;  3NVL A;  4LQY A;  4UPH A;  2RH6 A;  1O98 A;  3ED4 A;  3UO0 A;  1ZED A;  3UN3 A;  1K7H A;  4UPL A;  2GLQ A;  1ELY A;  3BDG B;  3NKN A;  3UNY A;  1E1Z P;  2VQR A;  1E3C P;  1N2L A;  2ZKT A;  1HDH A;  3MK0 A;  4CXU A;  1AJA A;  5KXA A;  1EW9 A;  3CMR A;  4UOR A;  3E2D A;  1URA A;  3DYC A;  4UPI A;  3B5Q A;  2X98 A;  3UN5 A;  4LR7 A;  4FDJ A;  4LRB A;  1ELZ A;  3T00 A;  4UOP A;  5K4P A;  1O99 A;  1SHQ A;  3WAV A;  4CXS A;  3WAW A;  5LIA A;  1ZEB A;  5C66 A;  1KH7 A;  3WAY A;  3NKP A;  2IFY A;  1EJJ A;  4ZG9 A;  5IJS A;  3A52 A;  4MIV A;  1ALH A;  3SZY A;  5IJQ A;  3T02 A;  1ALK A;  3SZZ A;  3BDH A;  2W5S A;  1ZEF A;  1AJC A;  3DPC A;  1EQJ A;  3WAX A;  1HJK A;  2IUC B;  5L0E A;  2W5T A;  4KJD A;  5INH A;  3OT9 A;  2W5V A;  4CYR A;  5TJ3 A;  1URB A;  4ZG7 A;  1AJB A;  4UOO A;  4ZGA A;  3TWZ A;  2QZU A;  5HRT A;  2XRG A;  2W5W A;  1KHK A;  1Y7A A;  4FDI A;  4NWJ A;  2W8D A;  5DLW A;  5L0B A;  3TX0 A;  3TG0 A;  5EGH A;  1SHN A;  2GSU A;  1AUK A;  5DLV A;  4GTX A;  1ED8 A;  4TN0 A;  2ANH A;  2XR9 A;  5LRN A;  4QAX A;  2GSN A;  4GTZ A;  3BDG A;  4CXK A;  2W5X A;  4KJG A;  5GRR A;  3WBH A;  5LQQ A;  4MHX A;  3NKO A;  1AJD A;  4LRC A;  4UPK A;  1ELX A;  1HQA A;  3NKR A;  5DLT A;  3BDF A;  3MK1 A;  4LRD A;  1ANJ A;  3M8Z A;  2G9Y A;  1ALJ A;  1E2S P;  4MY4 A;  1ALI A;  3T01 A;  1EI6 A;  4CYS A;  4LR8 A;  4LRE A;  5AJ9 A;  4ZG6 A;  1ANI A;  2W5R A;  3IGY B;  3UN2 A;  1KH5 A;  3IGZ B;  4GTY A;  4NWX A;  1KH4 A;  5L0K A;  4KAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...