3SZZA

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with acetate
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords phosphonoacetate hydrolase
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
total genus 127
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3szzA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3szzA01
5TJ3A 4N7TA 3TWZA 3UN5A 5L0KA 4UOPA 3NKMA 5LRMA 4LRAA 3E2DA 2D1GA 3TX0A 1P49A 1ELZA 1FSUA 4UORA 3WAVA 4UPIA 5L0EA 1EQJA 5DLVA 4NWXA 5GRRA 5L0BA 4KM4A 2RH6A 3NKNA 4NWJA 4MY4A 5IJSA 1O98A 1ANIA 2VQRA 3TG0A 2W8DA 3SZZA 1ELXA 5DLWA 4KJDA 3BDHA 5IJQA 2ANHA 1ALHA 2W8SA 1AJDA 1ZEBA 3WAWA 3IDDA 3M8YA 4UOOA 3M8WA 1HQAA 1AUKA 3NKRA 5KXAA 2ZKTA 3T00A 1ANJA 3A52A 4LQYA 4LR8A 1AJCA 2W5TA 4LREA 2W5SA 3UN2A 4KAVA 1E3CP 1AJBA 2XR9A 3IGYB 1KHJA 3MK0A 2GSNA 1URAA 1B8JA 4CXSA 1ALIA 1EI6A 4ZG9A 5LIAA 1AJAA 1Y7AA 3DYCA 4LR7A 3T02A 5GOVA 4CYRA 1ALKA 4UPHA 1HJKA 2GSUA 3UNYA 5INHA 3M7VA 4LRFA 4CYSA 4KJGA 1ALJA 1EW9A 1HDHA 4LRDA 1EW8A 4UPLA 4GTZA 1URBA 3BDFA 3NKOA 4MIVA 4ZG7A 3B5QA 4FDIA 4GTXA 3ED4A 3DPCA 5DLTA 1ED8A 2GSOA 4CXUA 1EJJA 3BDGA 4GTWA 3OT9A 1ELYA 4B56A 5LRNA 2W5WA 4LRBA 5K4PA 3NVLA 1KHNA 3KD8A 3WAYA 1KHKA 4CXKA 1E2SP 1E33P 3UN3A 3M8ZA 1N2LA 4LR2A 1ED9A 2W5VA 2IFYA 2X98A 3Q3QA 4FDJA 4MHXA 1KH7A 1SHQA 3WBHA 4LR9A 4ZG6A 2W5RA 2G9YA 1SHNA 1Y6VA 1KH5A 3MK2A 1KH9A 3T01A 2IUCA 5LQQA 1KHLA 5C66A 2XRGA 2GA3A 2W5XA 4KAYA 2W5QA 5HRTA 1N2KA 5EGHA 3CMRA 3SZYA 4GTYA 3MK1A 3NKQA 3BDGB 1KH4A 4LRCA 1O99A 4UPKA 4TN0A 1EW2A 3UO0A 1ZEDA 4YR1A 5AJ9A 3NKPA 3LXQA 3IGZB 1E1ZP 1ZEFA 4ZGAA 1K7HA 2GLQA 4QAXA 2IUCB 3WAXA 5EGEA 2QZUA
chains in the Genus database with same CATH superfamily
5IYBC 5TJ3A 1BGWA 4N7TA 1WQHA 3RZDC 2JA5A 5CHPA 4UOPA 5CJ9A 5LRMA 4A3DC 3TX0A 2PMZD 2Y3PA 3HOYC 2V6TA 3WAVA 4A3BC 1ISEA 1EQJA 2VUMC 4NOIA 4OINA 3NKNA 4MY4A 3CQZC 4JK1A 1O25A 5C4XK 3PO3C 4BXXC 2NVYK 3TG0A 2EBBA 1Y1VA 1I50C 1DCHA 1O29A 1ELXA 4KN4A 4A3IK 1J6XA 3WODA 3G4AA 4P5AA 1I3QA 2KWAA 3WAWA 1TWHC 5C4JK 5IYCK 4LJZA 4C3IK 2O5JA 5TMCA 3S17K 3I4NK 4KM8A 4MQ9A 4LR8A 2W5TA 4KMHA 3S14C 5IYDC 4KAVA 4BLBA 4OIQA 2GAHC 4A93K 1KHJA 3GTMC 4Q5SA 5IOTA 3M3YC 3S1MK 1WOSA 3HOWK 4C45A 3HOWC 5LIAA 2WAQL 1B4BA 1VH2A 3T02A 4G7ZA 2W7VA 2GSUA 2PA8D 2R7ZA 1TWAK 3GTLK 1IS1A 1XZQB 3M7VA 5INHA 1WQFA 1HDHA 1ZVUA 4A3FC 3HXAA 1EW8A 3M4OC 1USMA 3N0CA 3BDFA 4ZG7A 1K83A 4QIWD 3CAGA 3FHZA 3CQZA 1SFOC 2B63A 2CW0A 3RZOK 2GSOA 4FZBA 4GTAA 1XZPB 1HI9A 2B63C 4C3HC 4B56A 5LRNA 1I3QC 4C3JC 1TWCA 4KM9A 1F9NA 3GTPK 4DDQA 1XXCA 3UN3A 3M8ZA 1N2LA 4BBSK 2IFYA 1WCMK 4MHXA 2JA6K 2JA6C 4OIOA 3S1NC 1SHNA 3FKIC 1Y6VA 3MK2A 3T01A 2R7ZK 4J3NA 1JOEA 3AD8C 1KHLA 2XRGA 2WAQD 3I4MK 2W5XA 4KAYA 4G7OA 1WOPA 4G7HA 4BKWA 1USOA 4A3KK 4LRCA 3NUHA 3L4JA 2E2IA 1EW2A 1ZEDA 4AYBL 4P5BA 3GTQC 4WJ4A 3MMLB 2NVYC 3IGZB 4KAWX 4KB4A 5M3MK 3H3VL 1K7HA 2GLQA 3TTGA 1VGXA 1O27A 4XSXA 5L46A 1ZQ1C 1PJ7A 1PJ5A 3TWZA 5L0KA 1YX2A 4KMUA 4GTFA 4A3MK 3VA7A 3NKMA 4A3MC 3I4NC 2R93A 3GTOC 4OIPA 1J98A 2VUMA 1ELZA 5IYDK 2R93C 4UORA 3GTOA 5L0EA 2ZFZA 3S14K 2Y0SL 4NWXA 5GRRA 5IJSA 2P8TA 2A69A 3HOXC 1ANIA 2VQRA 5TMFA 3M3YK 1WOOA 2YU9K 1KQ4A 5IP9K 1R9TC 3H3VD 4C2MC 1RU0A 1I50A 2ANHA 1ALHA 4KN7A 3S1NK 2W8SA 1AB4A 4RMFA 3GSIA 3OEPA 4UOOA 3M8WA 1HQAA 1AUKA 2FQOA 2A6EA 4GTEA 4A3GK 3T00A 2ZUEA 4LK1A 4LQYA 3S2DC 3A52A 4PABA 4A3BK 3HOVK 4LREA 3HOYK 3IGYB 3MK0A 4YFNA 2B63K 2GSNA 4C3HK 1URAA 2E2HA 3PO3K 4CXSA 3GTMA 1DCPA 3GTJA 3GTPC 4X6AC 1ALKA 5M3FK 3GTPA 5C44K 4CYSA 3BP8C 5FLMC 2NVTK 3GEIA 1VLOA 3S1QC 3NKOA 4KMAA 4MIVA 3B5QA 4GTXA 2PHCB 1WIHA 1XPPA 3GTKC 3HOUC 4MEYA 1VJEA 3HKZD 4QIWL 1SFOA 1Y1VC 2O5IA 3PO2C 4BBRK 4FM9A 1EJJA 3GTJK 3BDGA 1WCMA 2FQTA 3HKZL 3N0BA 3GTMK 1G51A 5JVOA 2BE5A 1KHNA 3A8IA 3AD7C 1J6WA 2YU9A 2JA8C 2W5VA 2X98A 3FKIA 3HOZC 1O2AA 4LR9A 4ZG6A 1VRQC 1KH5A 3ERED 5LQQA 1L0WA 5C66A 2GA3A 4A3GC 1TWFC 5IYCC 4KB2A 1UV7A 5HRTA 5EGHA 1SFOK 3CMRA 5JFEA 4KDDA 3BDGB 1KH4A 3L4KA 1IE0A 4UPKA 3OREA 1TWGK 3DXJA 3UO0A 4YR1A 3GDZA 5AJ9A 3NKPA 4G0VA 5C3EK 3AH5A 1DCOA 1F7VA 1WSRA 4A3CK 1X31C 4X6AK 3GTQA 3TFIA 4WJ3M 4QAXA 3WAXA 4A3EC 1TWAC 3GTLC 4XLNA 5IYBK 4A3JC 1EK8A 3UN5A 1J6VA 3K7AK 3LPXA 3N3YA 3RZDK 1O26A 4LRAA 3E2DA 2D1GA 4ILDA 2PMZL 4LLGA 1P49A 1XXBA 3GEHA 2JA5K 2A68A 4YG2A 4GFQA 5DLVA 5L0BA 1WORA 2E2JK 4Y52K 3FOEA 4A3IC 2W8DA 3SZZA 1I50K 1YCLA 4BBSC 3LAJA 3HOZK 3S16C 1TWHA 3S16K 2NVQK 4Y7NC 1AJDA 2NVQC 4KC6A 4BY7K 3M8YA 2NVXC 3S0XA 5IOQA 2GAGC 2NVXK 1IQ0A 3S1QK 1IBAA 5IP7K 3NKRA 3ADAC 5IORA 1JVIA 2ZKTA 2PA8L 3GTKK 5M5YK 3HOUK 3GTOK 1ANJA 1Y1VK 2A6HA 2R92A 1JQWA 2PPBA 1ZXOA 1E3CP 1AJBA 4GTDA 2XR9A 1Y1WA 2R92C 1TWGC 4A93C 4WILA 4KATA 3HOXK 3GTGK 1XZPA 3GIRA 1ALIA 3GTGC 4ZG9A 5FJ8K 1R9TK 5GOVA 4CYRA 1O28A 3UNYA 3G4CA 2CFAA 1F93A 4LRFA 1K83K 4BLAA 2JA7C 4KJGA 1GE9A 1EW9A 4LRDA 1ALJA 4A3JK 4GTLA 3BUEA 4GTZA 4M1XA 3GTKA 3S2HK 4FDIA 4PAAA 1EH1A 3S2DK 3DPCA 3QX3A 5DLTA 1ED8A 1I6VA 1O2BA 1BDFA 1R9TA 4GTWA 3OT9A 1TWCC 1ELYA 3BP3A 1I3QK 2W5WA 4LRBA 5K4PA 4AH6A 4Y52C 3WAYA 3AQPA 1KHKA 4CXKA 1O2FB 4A3LC 4ZH4A 4LR2A 3EQLA 3OPFA 2JA6A 3Q3QA 5IP9C 2WB1L 4KMDA 4C2MK 1SHQA 3WBHA 3LAPA 2W5RA 1KH9A 5FLMK 1EFWA 2IUCA 3I4MC 4QJVB 3K7AC 3FOFA 4A3DK 3GTGA 3AQOA 3V4GA 3GTJC 4Q4ZA 1B4AA 3MK1A 3PO2K 1I6HC 4LK0A 2VUMK 3S1MC 4TN0A 2NVYA 4LOWA 1SMYA 4GT9A 1C0AA 3IPJA 3GTQK 3S1RK 2E2HK 1E1ZP 1TWAA 3GTLA 3H0GA 3A8KA 2IUCB 1K83C 4G0WA 3H0GC 3AD9C 3H0GK 2QZUA 1TWHK 5M5WK 5C4JC 2NVTC 1TWFK 2Y0SD 3S17C 4GTCA 5IOSA 4C3IC 2JA7A 2R93K 1EQRA 1FSUA 4UPIA 4YFXA 1BJTA 4KM4A 2RH6A 4NWJA 5M5XK 1O98A 1IL2A 1XXAA 2V6UA 1INNA 3JSTA 4OIRA 1WCMC 1V5VA 5DLWA 4KJDA 3A8JA 4A3EK 3BDHA 5IJQA 4XSZA 4GTBA 1ZEBA 2JH3A 3IDDA 2JA7K 1BS2A 2ZUFA 2CFAB 2XCRB 4G0UA 5KXAA 4MEXA 3M4OK 1YNNA 2XCOA 1AJCA 1TWGA 4A3KC 1YNJA 5HL8A 2W5SA 3UN2A 3TFJA 3CQZK 5C4XC 2E2JC 1B8JA 1EI6A 4BXXK 1WSVA 4A3LK 2RGRA 2E2HC 1AJAA 1Y7AA 4GZYA 3DYCA 2E2IK 4LR7A 4A3CC 3GEEA 4BY1K 4UPHA 1HJKA 1ZBSA 4XLPA 4BY1C 4Y7NK 4BY7C 2R7ZC 3FKIK 4XCHA 4UPLA 1URBA 2D6FC 5IP7C 4QJVA 3TFHA 3ED4A 1O24A 4BBRC 4CXUA 1I6HK 2R92K 2JA5C 2P5MA 1WQGA 2XCQA 2V6SA 3NVLA 2YU9C 3KD8A 1F7UA 1E2SP 1E33P 2JA8K 2NVXA 1PJ6A 3S1RC 1ED9A 4FDJA 1ZYRA 1KH7A 2G9YA 4A3FK 1DD5A 3S2HC 2W5QA 4YFKA 4P9SA 1N2KA 1TWFA 3SZYA 5D4DA 3HOVC 5E68A 4GTYA 1IW7A 3NKQA 1TWCK 3RZOC 4AYBD 1O99A 2WB1D 4KARA 4O2DA 1XZQA 4C3JK 2E2IC 5C3EC 3LXQA 1HQMA 4KASA 1Y1WC 3S15K 1ZEFA 1Y1WK 3S15C 4ZGAA 5C44C 5EGEA
chains in the Genus database with same CATH topology
5TJ3A 4N7TA 3TWZA 3UN5A 5L0KA 4UOPA 3NKMA 5LRMA 4LRAA 3E2DA 2D1GA 3TX0A 1P49A 1ELZA 1FSUA 4UORA 3WAVA 4UPIA 5L0EA 1EQJA 5DLVA 4NWXA 5GRRA 5L0BA 4KM4A 2RH6A 3NKNA 4NWJA 4MY4A 5IJSA 1O98A 1ANIA 2VQRA 3TG0A 2W8DA 3SZZA 1ELXA 5DLWA 4KJDA 3BDHA 5IJQA 2ANHA 1ALHA 2W8SA 1AJDA 1ZEBA 3WAWA 3IDDA 3M8YA 4UOOA 3M8WA 1HQAA 1AUKA 3NKRA 5KXAA 2ZKTA 3T00A 1ANJA 3A52A 4LQYA 4LR8A 1AJCA 2W5TA 4LREA 2W5SA 3UN2A 4KAVA 1E3CP 1AJBA 2XR9A 3IGYB 1KHJA 3MK0A 2GSNA 1URAA 1B8JA 4CXSA 1ALIA 1EI6A 4ZG9A 5LIAA 1AJAA 1Y7AA 3DYCA 4LR7A 3T02A 5GOVA 4CYRA 1ALKA 4UPHA 1HJKA 2GSUA 3UNYA 5INHA 3M7VA 4LRFA 4CYSA 4KJGA 1ALJA 1EW9A 1HDHA 4LRDA 1EW8A 4UPLA 4GTZA 1URBA 3BDFA 3NKOA 4MIVA 4ZG7A 3B5QA 4FDIA 4GTXA 3ED4A 3DPCA 5DLTA 1ED8A 2GSOA 4CXUA 1EJJA 3BDGA 4GTWA 3OT9A 1ELYA 4B56A 5LRNA 2W5WA 4LRBA 5K4PA 3NVLA 1KHNA 3KD8A 3WAYA 1KHKA 4CXKA 1E2SP 1E33P 3UN3A 3M8ZA 1N2LA 4LR2A 1ED9A 2W5VA 2IFYA 2X98A 3Q3QA 4FDJA 4MHXA 1KH7A 1SHQA 3WBHA 4LR9A 4ZG6A 2W5RA 2G9YA 1SHNA 1Y6VA 1KH5A 3MK2A 1KH9A 3T01A 2IUCA 5LQQA 1KHLA 5C66A 2XRGA 2GA3A 2W5XA 4KAYA 2W5QA 5HRTA 1N2KA 5EGHA 3CMRA 3SZYA 4GTYA 3MK1A 3NKQA 3BDGB 1KH4A 4LRCA 1O99A 4UPKA 4TN0A 1EW2A 3UO0A 1ZEDA 4YR1A 5AJ9A 3NKPA 3LXQA 3IGZB 1E1ZP 1ZEFA 4ZGAA 1K7HA 2GLQA 4QAXA 2IUCB 3WAXA 5EGEA 2QZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TJ3 A;  4N7T A;  3TWZ A;  3UN5 A;  5L0K A;  4UOP A;  3NKM A;  5LRM A;  4LRA A;  3E2D A;  2D1G A;  3TX0 A;  1P49 A;  1ELZ A;  1FSU A;  4UOR A;  3WAV A;  4UPI A;  5L0E A;  1EQJ A;  5DLV A;  4NWX A;  5GRR A;  5L0B A;  4KM4 A;  2RH6 A;  3NKN A;  4NWJ A;  4MY4 A;  5IJS A;  1O98 A;  1ANI A;  2VQR A;  3TG0 A;  2W8D A;  3SZZ A;  1ELX A;  5DLW A;  4KJD A;  3BDH A;  5IJQ A;  2ANH A;  1ALH A;  2W8S A;  1AJD A;  1ZEB A;  3WAW A;  3IDD A;  3M8Y A;  4UOO A;  3M8W A;  1HQA A;  1AUK A;  3NKR A;  5KXA A;  2ZKT A;  3T00 A;  1ANJ A;  3A52 A;  4LQY A;  4LR8 A;  1AJC A;  2W5T A;  4LRE A;  2W5S A;  3UN2 A;  4KAV A;  1E3C P;  1AJB A;  2XR9 A;  3IGY B;  1KHJ A;  3MK0 A;  2GSN A;  1URA A;  1B8J A;  4CXS A;  1ALI A;  1EI6 A;  4ZG9 A;  5LIA A;  1AJA A;  1Y7A A;  3DYC A;  4LR7 A;  3T02 A;  5GOV A;  4CYR A;  1ALK A;  4UPH A;  1HJK A;  2GSU A;  3UNY A;  5INH A;  3M7V A;  4LRF A;  4CYS A;  4KJG A;  1ALJ A;  1EW9 A;  1HDH A;  4LRD A;  1EW8 A;  4UPL A;  4GTZ A;  1URB A;  3BDF A;  3NKO A;  4MIV A;  4ZG7 A;  3B5Q A;  4FDI A;  4GTX A;  3ED4 A;  3DPC A;  5DLT A;  1ED8 A;  2GSO A;  4CXU A;  1EJJ A;  3BDG A;  4GTW A;  3OT9 A;  1ELY A;  4B56 A;  5LRN A;  2W5W A;  4LRB A;  5K4P A;  3NVL A;  1KHN A;  3KD8 A;  3WAY A;  1KHK A;  4CXK A;  1E2S P;  1E33 P;  3UN3 A;  3M8Z A;  1N2L A;  4LR2 A;  1ED9 A;  2W5V A;  2IFY A;  2X98 A;  3Q3Q A;  4FDJ A;  4MHX A;  1KH7 A;  1SHQ A;  3WBH A;  4LR9 A;  4ZG6 A;  2W5R A;  2G9Y A;  1SHN A;  1Y6V A;  1KH5 A;  3MK2 A;  1KH9 A;  3T01 A;  2IUC A;  5LQQ A;  1KHL A;  5C66 A;  2XRG A;  2GA3 A;  2W5X A;  4KAY A;  2W5Q A;  5HRT A;  1N2K A;  5EGH A;  3CMR A;  3SZY A;  4GTY A;  3MK1 A;  3NKQ A;  3BDG B;  1KH4 A;  4LRC A;  1O99 A;  4UPK A;  4TN0 A;  1EW2 A;  3UO0 A;  1ZED A;  4YR1 A;  5AJ9 A;  3NKP A;  3LXQ A;  3IGZ B;  1E1Z P;  1ZEF A;  4ZGA A;  1K7H A;  2GLQ A;  4QAX A;  2IUC B;  3WAX A;  5EGE A;  2QZU A; 
#chains in the Genus database with same CATH topology
 5IYB C;  5TJ3 A;  1BGW A;  4N7T A;  1WQH A;  3RZD C;  2JA5 A;  5CHP A;  4UOP A;  5CJ9 A;  5LRM A;  4A3D C;  3TX0 A;  2PMZ D;  2Y3P A;  3HOY C;  2V6T A;  3WAV A;  4A3B C;  1ISE A;  1EQJ A;  2VUM C;  4NOI A;  4OIN A;  3NKN A;  4MY4 A;  3CQZ C;  4JK1 A;  1O25 A;  5C4X K;  3PO3 C;  4BXX C;  2NVY K;  3TG0 A;  2EBB A;  1Y1V A;  1I50 C;  1DCH A;  1O29 A;  1ELX A;  4KN4 A;  4A3I K;  1J6X A;  3WOD A;  3G4A A;  4P5A A;  1I3Q A;  2KWA A;  3WAW A;  1TWH C;  5C4J K;  5IYC K;  4LJZ A;  4C3I K;  2O5J A;  5TMC A;  3S17 K;  3I4N K;  4KM8 A;  4MQ9 A;  4LR8 A;  2W5T A;  4KMH A;  3S14 C;  5IYD C;  4KAV A;  4BLB A;  4OIQ A;  2GAH C;  4A93 K;  1KHJ A;  3GTM C;  4Q5S A;  5IOT A;  3M3Y C;  3S1M K;  1WOS A;  3HOW K;  4C45 A;  3HOW C;  5LIA A;  2WAQ L;  1B4B A;  1VH2 A;  3T02 A;  4G7Z A;  2W7V A;  2GSU A;  2PA8 D;  2R7Z A;  1TWA K;  3GTL K;  1IS1 A;  1XZQ B;  3M7V A;  5INH A;  1WQF A;  1HDH A;  1ZVU A;  4A3F C;  3HXA A;  1EW8 A;  3M4O C;  1USM A;  3N0C A;  3BDF A;  4ZG7 A;  1K83 A;  4QIW D;  3CAG A;  3FHZ A;  3CQZ A;  1SFO C;  2B63 A;  2CW0 A;  3RZO K;  2GSO A;  4FZB A;  4GTA A;  1XZP B;  1HI9 A;  2B63 C;  4C3H C;  4B56 A;  5LRN A;  1I3Q C;  4C3J C;  1TWC A;  4KM9 A;  1F9N A;  3GTP K;  4DDQ A;  1XXC A;  3UN3 A;  3M8Z A;  1N2L A;  4BBS K;  2IFY A;  1WCM K;  4MHX A;  2JA6 K;  2JA6 C;  4OIO A;  3S1N C;  1SHN A;  3FKI C;  1Y6V A;  3MK2 A;  3T01 A;  2R7Z K;  4J3N A;  1JOE A;  3AD8 C;  1KHL A;  2XRG A;  2WAQ D;  3I4M K;  2W5X A;  4KAY A;  4G7O A;  1WOP A;  4G7H A;  4BKW A;  1USO A;  4A3K K;  4LRC A;  3NUH A;  3L4J A;  2E2I A;  1EW2 A;  1ZED A;  4AYB L;  4P5B A;  3GTQ C;  4WJ4 A;  3MML B;  2NVY C;  3IGZ B;  4KAW X;  4KB4 A;  5M3M K;  3H3V L;  1K7H A;  2GLQ A;  3TTG A;  1VGX A;  1O27 A;  4XSX A;  5L46 A;  1ZQ1 C;  1PJ7 A;  1PJ5 A;  3TWZ A;  5L0K A;  1YX2 A;  4KMU A;  4GTF A;  4A3M K;  3VA7 A;  3NKM A;  4A3M C;  3I4N C;  2R93 A;  3GTO C;  4OIP A;  1J98 A;  2VUM A;  1ELZ A;  5IYD K;  2R93 C;  4UOR A;  3GTO A;  5L0E A;  2ZFZ A;  3S14 K;  2Y0S L;  4NWX A;  5GRR A;  5IJS A;  2P8T A;  2A69 A;  3HOX C;  1ANI A;  2VQR A;  5TMF A;  3M3Y K;  1WOO A;  2YU9 K;  1KQ4 A;  5IP9 K;  1R9T C;  3H3V D;  4C2M C;  1RU0 A;  1I50 A;  2ANH A;  1ALH A;  4KN7 A;  3S1N K;  2W8S A;  1AB4 A;  4RMF A;  3GSI A;  3OEP A;  4UOO A;  3M8W A;  1HQA A;  1AUK A;  2FQO A;  2A6E A;  4GTE A;  4A3G K;  3T00 A;  2ZUE A;  4LK1 A;  4LQY A;  3S2D C;  3A52 A;  4PAB A;  4A3B K;  3HOV K;  4LRE A;  3HOY K;  3IGY B;  3MK0 A;  4YFN A;  2B63 K;  2GSN A;  4C3H K;  1URA A;  2E2H A;  3PO3 K;  4CXS A;  3GTM A;  1DCP A;  3GTJ A;  3GTP C;  4X6A C;  1ALK A;  5M3F K;  3GTP A;  5C44 K;  4CYS A;  3BP8 C;  5FLM C;  2NVT K;  3GEI A;  1VLO A;  3S1Q C;  3NKO A;  4KMA A;  4MIV A;  3B5Q A;  4GTX A;  2PHC B;  1WIH A;  1XPP A;  3GTK C;  3HOU C;  4MEY A;  1VJE A;  3HKZ D;  4QIW L;  1SFO A;  1Y1V C;  2O5I A;  3PO2 C;  4BBR K;  4FM9 A;  1EJJ A;  3GTJ K;  3BDG A;  1WCM A;  2FQT A;  3HKZ L;  3N0B A;  3GTM K;  1G51 A;  5JVO A;  2BE5 A;  1KHN A;  3A8I A;  3AD7 C;  1J6W A;  2YU9 A;  2JA8 C;  2W5V A;  2X98 A;  3FKI A;  3HOZ C;  1O2A A;  4LR9 A;  4ZG6 A;  1VRQ C;  1KH5 A;  3ERE D;  5LQQ A;  1L0W A;  5C66 A;  2GA3 A;  4A3G C;  1TWF C;  5IYC C;  4KB2 A;  1UV7 A;  5HRT A;  5EGH A;  1SFO K;  3CMR A;  5JFE A;  4KDD A;  3BDG B;  1KH4 A;  3L4K A;  1IE0 A;  4UPK A;  3ORE A;  1TWG K;  3DXJ A;  3UO0 A;  4YR1 A;  3GDZ A;  5AJ9 A;  3NKP A;  4G0V A;  5C3E K;  3AH5 A;  1DCO A;  1F7V A;  1WSR A;  4A3C K;  1X31 C;  4X6A K;  3GTQ A;  3TFI A;  4WJ3 M;  4QAX A;  3WAX A;  4A3E C;  1TWA C;  3GTL C;  4XLN A;  5IYB K;  4A3J C;  1EK8 A;  3UN5 A;  1J6V A;  3K7A K;  3LPX A;  3N3Y A;  3RZD K;  1O26 A;  4LRA A;  3E2D A;  2D1G A;  4ILD A;  2PMZ L;  4LLG A;  1P49 A;  1XXB A;  3GEH A;  2JA5 K;  2A68 A;  4YG2 A;  4GFQ A;  5DLV A;  5L0B A;  1WOR A;  2E2J K;  4Y52 K;  3FOE A;  4A3I C;  2W8D A;  3SZZ A;  1I50 K;  1YCL A;  4BBS C;  3LAJ A;  3HOZ K;  3S16 C;  1TWH A;  3S16 K;  2NVQ K;  4Y7N C;  1AJD A;  2NVQ C;  4KC6 A;  4BY7 K;  3M8Y A;  2NVX C;  3S0X A;  5IOQ A;  2GAG C;  2NVX K;  1IQ0 A;  3S1Q K;  1IBA A;  5IP7 K;  3NKR A;  3ADA C;  5IOR A;  1JVI A;  2ZKT A;  2PA8 L;  3GTK K;  5M5Y K;  3HOU K;  3GTO K;  1ANJ A;  1Y1V K;  2A6H A;  2R92 A;  1JQW A;  2PPB A;  1ZXO A;  1E3C P;  1AJB A;  4GTD A;  2XR9 A;  1Y1W A;  2R92 C;  1TWG C;  4A93 C;  4WIL A;  4KAT A;  3HOX K;  3GTG K;  1XZP A;  3GIR A;  1ALI A;  3GTG C;  4ZG9 A;  5FJ8 K;  1R9T K;  5GOV A;  4CYR A;  1O28 A;  3UNY A;  3G4C A;  2CFA A;  1F93 A;  4LRF A;  1K83 K;  4BLA A;  2JA7 C;  4KJG A;  1GE9 A;  1EW9 A;  4LRD A;  1ALJ A;  4A3J K;  4GTL A;  3BUE A;  4GTZ A;  4M1X A;  3GTK A;  3S2H K;  4FDI A;  4PAA A;  1EH1 A;  3S2D K;  3DPC A;  3QX3 A;  5DLT A;  1ED8 A;  1I6V A;  1O2B A;  1BDF A;  1R9T A;  4GTW A;  3OT9 A;  1TWC C;  1ELY A;  3BP3 A;  1I3Q K;  2W5W A;  4LRB A;  5K4P A;  4AH6 A;  4Y52 C;  3WAY A;  3AQP A;  1KHK A;  4CXK A;  1O2F B;  4A3L C;  4ZH4 A;  4LR2 A;  3EQL A;  3OPF A;  2JA6 A;  3Q3Q A;  5IP9 C;  2WB1 L;  4KMD A;  4C2M K;  1SHQ A;  3WBH A;  3LAP A;  2W5R A;  1KH9 A;  5FLM K;  1EFW A;  2IUC A;  3I4M C;  4QJV B;  3K7A C;  3FOF A;  4A3D K;  3GTG A;  3AQO A;  3V4G A;  3GTJ C;  4Q4Z A;  1B4A A;  3MK1 A;  3PO2 K;  1I6H C;  4LK0 A;  2VUM K;  3S1M C;  4TN0 A;  2NVY A;  4LOW A;  1SMY A;  4GT9 A;  1C0A A;  3IPJ A;  3GTQ K;  3S1R K;  2E2H K;  1E1Z P;  1TWA A;  3GTL A;  3H0G A;  3A8K A;  2IUC B;  1K83 C;  4G0W A;  3H0G C;  3AD9 C;  3H0G K;  2QZU A;  1TWH K;  5M5W K;  5C4J C;  2NVT C;  1TWF K;  2Y0S D;  3S17 C;  4GTC A;  5IOS A;  4C3I C;  2JA7 A;  2R93 K;  1EQR A;  1FSU A;  4UPI A;  4YFX A;  1BJT A;  4KM4 A;  2RH6 A;  4NWJ A;  5M5X K;  1O98 A;  1IL2 A;  1XXA A;  2V6U A;  1INN A;  3JST A;  4OIR A;  1WCM C;  1V5V A;  5DLW A;  4KJD A;  3A8J A;  4A3E K;  3BDH A;  5IJQ A;  4XSZ A;  4GTB A;  1ZEB A;  2JH3 A;  3IDD A;  2JA7 K;  1BS2 A;  2ZUF A;  2CFA B;  2XCR B;  4G0U A;  5KXA A;  4MEX A;  3M4O K;  1YNN A;  2XCO A;  1AJC A;  1TWG A;  4A3K C;  1YNJ A;  5HL8 A;  2W5S A;  3UN2 A;  3TFJ A;  3CQZ K;  5C4X C;  2E2J C;  1B8J A;  1EI6 A;  4BXX K;  1WSV A;  4A3L K;  2RGR A;  2E2H C;  1AJA A;  1Y7A A;  4GZY A;  3DYC A;  2E2I K;  4LR7 A;  4A3C C;  3GEE A;  4BY1 K;  4UPH A;  1HJK A;  1ZBS A;  4XLP A;  4BY1 C;  4Y7N K;  4BY7 C;  2R7Z C;  3FKI K;  4XCH A;  4UPL A;  1URB A;  2D6F C;  5IP7 C;  4QJV A;  3TFH A;  3ED4 A;  1O24 A;  4BBR C;  4CXU A;  1I6H K;  2R92 K;  2JA5 C;  2P5M A;  1WQG A;  2XCQ A;  2V6S A;  3NVL A;  2YU9 C;  3KD8 A;  1F7U A;  1E2S P;  1E33 P;  2JA8 K;  2NVX A;  1PJ6 A;  3S1R C;  1ED9 A;  4FDJ A;  1ZYR A;  1KH7 A;  2G9Y A;  4A3F K;  1DD5 A;  3S2H C;  2W5Q A;  4YFK A;  4P9S A;  1N2K A;  1TWF A;  3SZY A;  5D4D A;  3HOV C;  5E68 A;  4GTY A;  1IW7 A;  3NKQ A;  1TWC K;  3RZO C;  4AYB D;  1O99 A;  2WB1 D;  4KAR A;  4O2D A;  1XZQ A;  4C3J K;  2E2I C;  5C3E C;  3LXQ A;  1HQM A;  4KAS A;  1Y1W C;  3S15 K;  1ZEF A;  1Y1W K;  3S15 C;  4ZGA A;  5C44 C;  5EGE A; 
#chains in the Genus database with same CATH homology
 5TJ3 A;  4N7T A;  3TWZ A;  3UN5 A;  5L0K A;  4UOP A;  3NKM A;  5LRM A;  4LRA A;  3E2D A;  2D1G A;  3TX0 A;  1P49 A;  1ELZ A;  1FSU A;  4UOR A;  3WAV A;  4UPI A;  5L0E A;  1EQJ A;  5DLV A;  4NWX A;  5GRR A;  5L0B A;  4KM4 A;  2RH6 A;  3NKN A;  4NWJ A;  4MY4 A;  5IJS A;  1O98 A;  1ANI A;  2VQR A;  3TG0 A;  2W8D A;  3SZZ A;  1ELX A;  5DLW A;  4KJD A;  3BDH A;  5IJQ A;  2ANH A;  1ALH A;  2W8S A;  1AJD A;  1ZEB A;  3WAW A;  3IDD A;  3M8Y A;  4UOO A;  3M8W A;  1HQA A;  1AUK A;  3NKR A;  5KXA A;  2ZKT A;  3T00 A;  1ANJ A;  3A52 A;  4LQY A;  4LR8 A;  1AJC A;  2W5T A;  4LRE A;  2W5S A;  3UN2 A;  4KAV A;  1E3C P;  1AJB A;  2XR9 A;  3IGY B;  1KHJ A;  3MK0 A;  2GSN A;  1URA A;  1B8J A;  4CXS A;  1ALI A;  1EI6 A;  4ZG9 A;  5LIA A;  1AJA A;  1Y7A A;  3DYC A;  4LR7 A;  3T02 A;  5GOV A;  4CYR A;  1ALK A;  4UPH A;  1HJK A;  2GSU A;  3UNY A;  5INH A;  3M7V A;  4LRF A;  4CYS A;  4KJG A;  1ALJ A;  1EW9 A;  1HDH A;  4LRD A;  1EW8 A;  4UPL A;  4GTZ A;  1URB A;  3BDF A;  3NKO A;  4MIV A;  4ZG7 A;  3B5Q A;  4FDI A;  4GTX A;  3ED4 A;  3DPC A;  5DLT A;  1ED8 A;  2GSO A;  4CXU A;  1EJJ A;  3BDG A;  4GTW A;  3OT9 A;  1ELY A;  4B56 A;  5LRN A;  2W5W A;  4LRB A;  5K4P A;  3NVL A;  1KHN A;  3KD8 A;  3WAY A;  1KHK A;  4CXK A;  1E2S P;  1E33 P;  3UN3 A;  3M8Z A;  1N2L A;  4LR2 A;  1ED9 A;  2W5V A;  2IFY A;  2X98 A;  3Q3Q A;  4FDJ A;  4MHX A;  1KH7 A;  1SHQ A;  3WBH A;  4LR9 A;  4ZG6 A;  2W5R A;  2G9Y A;  1SHN A;  1Y6V A;  1KH5 A;  3MK2 A;  1KH9 A;  3T01 A;  2IUC A;  5LQQ A;  1KHL A;  5C66 A;  2XRG A;  2GA3 A;  2W5X A;  4KAY A;  2W5Q A;  5HRT A;  1N2K A;  5EGH A;  3CMR A;  3SZY A;  4GTY A;  3MK1 A;  3NKQ A;  3BDG B;  1KH4 A;  4LRC A;  1O99 A;  4UPK A;  4TN0 A;  1EW2 A;  3UO0 A;  1ZED A;  4YR1 A;  5AJ9 A;  3NKP A;  3LXQ A;  3IGZ B;  1E1Z P;  1ZEF A;  4ZGA A;  1K7H A;  2GLQ A;  4QAX A;  2IUC B;  3WAX A;  5EGE A;  2QZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...