3SZYA

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in apo form
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords phosphonoacetate hydrolase
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
total genus 130
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3szyA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3szyA01
1ANJA 1E2SP 1ZEBA 1ANIA 3M7VA 3BDHA 5LRNA 4LREA 5INHA 5TJ3A 4CXUA 4LRCA 5EGHA 3TG0A 1E3CP 4LRBA 4KJGA 1Y7AA 3Q3QA 3WBHA 3MK1A 4UOPA 5DLWA 4ZG7A 1KHNA 1O98A 3UN5A 1E33P 2W8SA 1ED9A 3M8ZA 5IJSA 1KH4A 3IGZB 5GRRA 4QAXA 1URBA 5L0EA 1AJDA 2W5VA 4MY4A 4UPKA 1ALJA 3NKNA 1ALHA 1EJJA 5L0KA 1EW8A 5LQQA 3BDGB 4CYSA 4UPLA 3T00A 2RH6A 4CXSA 3A52A 2D1GA 2W5SA 4UPHA 1HQAA 2W5QA 3CMRA 5DLVA 1P49A 1URAA 4UOOA 1HDHA 4GTWA 3OT9A 1N2LA 3NKOA 1KHLA 3UNYA 4LR7A 4FDIA 1ELXA 1B8JA 1O99A 4LRFA 4CYRA 1EW2A 2GSOA 2IUCB 3NKMA 4KAVA 4UORA 3M8YA 1HJKA 1ALIA 3BDGA 1KHKA 2W5TA 3WAYA 1KH9A 4B56A 3DYCA 4TN0A 3M8WA 1ALKA 4KJDA 4LRDA 3UN3A 5HRTA 4N7TA 1EI6A 1ELYA 1AUKA 4LR2A 5DLTA 2XRGA 3DPCA 2VQRA 3NKRA 1ZEDA 4MHXA 3TX0A 2GA3A 4GTXA 2W5XA 1KH7A 3MK2A 3IDDA 2ZKTA 3MK0A 1ED8A 1EQJA 1EW9A 3BDFA 1ELZA 4GTZA 1AJBA 3UO0A 1SHQA 4UPIA 4LR9A 1N2KA 5KXAA 5L0BA 1KH5A 3T02A 1ZEFA 3UN2A 3WAXA 4ZG6A 5LRMA 4FDJA 5AJ9A 3NKQA 5GOVA 2XR9A 1SHNA 2GLQA 4LR8A 4LRAA 4YR1A 3LXQA 3TWZA 3SZZA 4ZG9A 2ANHA 4CXKA 4KAYA 2G9YA 1K7HA 3NKPA 3NVLA 4NWJA 4LQYA 3WAWA 2W5WA 2W8DA 2W5RA 4GTYA 1KHJA 2GSUA 2IUCA 1E1ZP 3T01A 3KD8A 3E2DA 3IGYB 3SZYA 3ED4A 3B5QA 2QZUA 4MIVA 5C66A 5LIAA 4NWXA 2X98A 1AJAA 5EGEA 5K4PA 1AJCA 5IJQA 3WAVA 4KM4A 4ZGAA 1Y6VA 2GSNA 1FSUA 2IFYA
chains in the Genus database with same CATH superfamily
5C4JC 3AH5A 4Q5SA 1Y1VC 5M3MK 3LPXA 3GTOC 4A3EC 5LRNA 4O2DA 3VA7A 5TJ3A 2Y0SL 1USMA 2P8TA 5JVOA 3S1NC 3CAGA 3WBHA 3MK1A 4BXXK 4ZG7A 3UN5A 1F7VA 5IYDK 2W8SA 4C3HK 4GTLA 1URBA 5L0EA 1AJDA 2W5VA 4YFXA 5CHPA 1J6WA 4LOWA 5L0KA 4A3IC 3FKIC 1EW8A 4CYSA 1DCHA 4BY1C 2RH6A 2NVQK 3S2HC 3GTKA 3LAPA 5IYDC 3TFHA 2JA5K 4Y7NC 2B63K 3M4OC 1O26A 2E2JC 4UPHA 5DLVA 3S1NK 2ZUFA 4A3MC 4NOIA 2WAQD 3NKOA 4A3FK 3GEHA 3FOFA 2E2HA 1J6XA 3GTQA 3NKMA 4UORA 1G51A 2E2IK 1PJ6A 4XSZA 3JSTA 2PPBA 2NVYA 3GTMA 5IP9C 3ERED 4XSXA 1EFWA 1TWCA 3HKZD 4C2MC 1ELYA 1AUKA 5M5WK 5JFEA 1I6VA 1XXAA 3OPFA 2GA3A 4AYBD 3FOEA 3GDZA 2ZFZA 1XZQB 3GTGC 2R93A 3IDDA 3MK2A 4MQ9A 4A93K 3GTKK 1R9TA 4XLNA 2GAHC 2JA7K 1AJBA 5C3EC 4WJ4A 5HL8A 3GTJK 1SHQA 2O5JA 4UPIA 4LR9A 1O29A 5L0BA 1PJ7A 1ZEFA 2A69A 3I4NK 5LRMA 4FDJA 2JA6A 3PO2C 2GLQA 4A3IK 4KAWX 5TMCA 2V6SA 4KMHA 3HOWC 3S0XA 1O27A 3H0GK 3GEIA 4A3DK 1VLOA 1IW7A 1R9TC 2W5WA 4GT9A 2GSUA 2IUCA 1E1ZP 4LJZA 4G7OA 2NVYK 3T01A 3E2DA 2E2HK 3IGYB 3SZYA 5C66A 1TWFC 1V5VA 3H0GA 4ILDA 1F93A 1AJAA 4A3EK 4A3BC 4LK1A 1PJ5A 5FJ8K 5CJ9A 2R92K 4C3IC 3HOXK 2GSNA 3GTLK 3GTMC 1ZEBA 4P9SA 1ANIA 2R93K 3M7VA 4DDQA 4A3BK 1DCOA 5INHA 1WQHA 1ZYRA 1IL2A 3S2DC 2NVTK 4KMDA 4GTBA 1E3CP 3Q3QA 1Y7AA 5IP9K 3OREA 4Y52K 1KHNA 3IPJA 3M8ZA 2WB1L 1DD5A 1JOEA 1DCPA 2XCRB 2E2IC 2YU9A 1KH4A 4YFNA 3HXAA 1USOA 1XXBA 2YU9C 2E2IA 1SFOC 5LQQA 5IOSA 3BDGB 4WJ3M 4P5BA 4CXSA 1XXCA 3A52A 3I4NC 2R7ZK 1EQRA 4OIPA 4A3MK 1HQAA 3GTPK 3CMRA 2JA8K 5M3FK 3HOVC 1URAA 2WB1D 2E2JK 3OT9A 1I50A 3S1RC 1KHLA 3PO3K 4LR7A 2NVQC 1ELXA 1YX2A 2CW0A 3FKIK 1BS2A 3GTGK 1O99A 4LRFA 2GSOA 4AH6A 1YNJA 3M8YA 3L4KA 4BBRK 1O2AA 4A3JC 2BE5A 1K83A 3TFIA 3I4MC 1KHKA 3AQOA 2PHCB 2W5TA 3H3VL 1UV7A 4OIRA 1VRQC 4TN0A 3M8WA 2R7ZC 1ALKA 4QJVB 4KJDA 2D6FC 1TWCK 4ZH4A 1K83C 1VJEA 2EBBA 1Y1VK 3NKRA 2FQOA 4GTXA 4C3IK 4YG2A 4JK1A 3S16K 2ZKTA 1X31C 3S17K 1EW9A 1I50C 1YCLA 1F9NA 4KATA 5TMFA 4KDDA 3M3YK 1N2KA 3BP8C 3WAXA 3T02A 3RZOK 3UN2A 4ZG6A 5IOTA 3NKQA 4QIWD 2XR9A 4PABA 2JA7A 1R9TK 4LR8A 1I3QK 3A8KA 3CQZK 3TWZA 3S16C 2JA6K 4G0VA 4C3HC 3HOWK 5IYBK 3WAWA 2W5RA 4GTYA 5IOQA 3AD7C 3S15C 4KARA 4BXXC 4GTDA 4X6AC 4AYBL 4YFKA 1TWCC 3KD8A 1IQ0A 3B5QA 5L46A 5C3EK 2NVYC 4MEYA 4A3CC 4G0WA 3S1MC 3GTOK 5K4PA 4GTAA 4A93C 5IYBC 5IJQA 4G7HA 4OIOA 4KM4A 3WAVA 1Y6VA 1J6VA 1O98A 1JVIA 3CQZC 1ANJA 4OINA 4KB2A 1WOPA 3PO2K 4MEXA 4CXUA 4GTFA 3S1RK 4LRCA 1VGXA 1TWFA 4A3GC 3TG0A 1O24A 4KJGA 4LRBA 1WQFA 2V6TA 3AQPA 5DLWA 1AB4A 1WORA 2WAQL 1E33P 4KB4A 3S17C 3GTKC 1ED9A 4BKWA 5IP7K 4QAXA 1HQMA 1XPPA 4FZBA 5C4XK 4MY4A 4UPKA 1WQGA 4KMUA 1ALHA 1SMYA 2PMZL 3S14K 3BP3A 2D1GA 3OEPA 2W5QA 1EK8A 4GTCA 1P49A 4UOOA 1HDHA 4GTWA 3HOZK 2PA8L 3S2DK 1IE0A 3UNYA 3S2HK 4FDIA 1Y1WK 1WOOA 4GFQA 1B8JA 4KM8A 3GTPA 3GTGA 2R93C 1C0AA 3NUHA 2R7ZA 2IUCB 3GTMK 4KAVA 2FQTA 1WCMC 3HKZL 1I6HK 4FM9A 1BGWA 1HI9A 3HOYK 1O2FB 3PO3C 1BJTA 3DXJA 3G4CA 5IYCC 3GTQK 3WAYA 1KH9A 4A3LC 3EQLA 2O5IA 5HRTA 4LK0A 4Y7NK 4PAAA 1EI6A 4WILA 4LR2A 4BY1K 3LAJA 1INNA 4GZYA 1ZQ1C 1I6HC 1IBAA 2YU9K 2XRGA 2VQRA 1WCMK 2PA8D 4MHXA 3TX0A 1KH7A 1ZBSA 2VUMA 1Y1WC 3FHZA 4J3NA 3MK0A 3BDFA 2A6HA 1SFOA 3GTJA 3UO0A 4BLAA 2PMZD 1KH5A 2P5MA 3RZOC 3GTLA 4KN7A 5FLMC 3M3YC 4BLBA 4QJVA 4QIWL 4A3KK 2NVXC 1XZPA 2A6EA 4Q4ZA 1B4BA 3FKIA 3L4JA 1WIHA 4LRAA 1WOSA 2RGRA 3GTLC 3LXQA 3SZZA 5C4XC 3HOXC 4KAYA 5IP7C 3GSIA 5C44K 2W7VA 1EH1A 2Y0SD 2CFAB 1GE9A 1TWFK 3K7AC 2CFAA 2QZUA 5LIAA 5EGEA 1JQWA 4C3JK 5M5YK 1F7UA 3GTOA 1AJCA 1Y1VA 1J98A 4A3JK 3I4MK 3H0GC 3A8IA 3V4GA 3H3VD 4A3DC 5IORA 4ZGAA 1FSUA 2IFYA 5M5XK 1E2SP 2VUMK 4LLGA 2GAGC 1TWHA 4C3JC 3S1MK 3BDHA 3AD9C 4LREA 1TWGC 3GEEA 4A3FC 5EGHA 1WCMA 3K7AK 4C45A 1XZQA 2JA8C 3HOVK 3RZDK 4UOPA 3GTPC 5IYCK 4M1XA 3S15K 3WODA 2JA5C 3BUEA 5IJSA 4KASA 5E68A 3IGZB 4XCHA 2JA6C 5GRRA 3N0BA 1I3QA 1O28A 1I3QC 1ALJA 3S1QK 4BBSC 1BDFA 3NKNA 1EJJA 3HOUK 2JH3A 4UPLA 2NVXK 3T00A 1TWAK 4A3KC 5FLMK 3MMLB 2A68A 4Y52C 2W5SA 3QX3A 1WSVA 1KQ4A 2V6UA 1WSRA 2ZUEA 2NVTC 1N2LA 4P5AA 3TFJA 1TWAC 4CYRA 4KC6A 1EW2A 3S1QC 4KN4A 4BBSK 5C4JK 1ZVUA 3GIRA 1K83K 1HJKA 1ALIA 3BDGA 1TWHK 1ZXOA 1L0WA 2B63A 2XCQA 2Y3PA 3CQZA 4B56A 4A3LK 1ISEA 3DYCA 3GTQC 1RU0A 4A3GK 2E2HC 1YNNA 4G7ZA 4G0UA 3M4OK 4LRDA 4N7TA 2B63C 3UN3A 3HOYC 4BBRC 5DLTA 1B4AA 2XCOA 3DPCA 3HOUC 1ZEDA 2W5XA 1VH2A 3N3YA 3AD8C 4BY7K 1TWAA 1ED8A 2NVXA 1EQJA 1IS1A 4A3CK 1ELZA 3HOZC 4GTZA 3ADAC 2KWAA 3RZDC 5KXAA 4RMFA 4X6AK 5AJ9A 3GTJC 1TWGK 5GOVA 1SHNA 2JA7C 1SFOK 3S14C 4KMAA 1Y1WA 3A8JA 2VUMC 4BY7C 4YR1A 5C44C 4ZG9A 2ANHA 4CXKA 2G9YA 1K7HA 3NKPA 3NVLA 4NWJA 4LQYA 3TTGA 1O2BA 2W8DA 1KHJA 3N0CA 2JA5A 4GTEA 4C2MK 2R92A 3ED4A 4MIVA 1O25A 4XLPA 4NWXA 2X98A 1TWGA 1I50K 1TWHC 5D4DA 1XZPB 4KM9A 4OIQA 2R92C 3G4AA
chains in the Genus database with same CATH topology
1ANJA 1E2SP 1ZEBA 1ANIA 3M7VA 3BDHA 5LRNA 4LREA 5INHA 5TJ3A 4CXUA 4LRCA 5EGHA 3TG0A 1E3CP 4LRBA 4KJGA 1Y7AA 3Q3QA 3WBHA 3MK1A 4UOPA 5DLWA 4ZG7A 1KHNA 1O98A 3UN5A 1E33P 2W8SA 1ED9A 3M8ZA 5IJSA 1KH4A 3IGZB 5GRRA 4QAXA 1URBA 5L0EA 1AJDA 2W5VA 4MY4A 4UPKA 1ALJA 3NKNA 1ALHA 1EJJA 5L0KA 1EW8A 5LQQA 3BDGB 4CYSA 4UPLA 3T00A 2RH6A 4CXSA 3A52A 2D1GA 2W5SA 4UPHA 1HQAA 2W5QA 3CMRA 5DLVA 1P49A 1URAA 4UOOA 1HDHA 4GTWA 3OT9A 1N2LA 3NKOA 1KHLA 3UNYA 4LR7A 4FDIA 1ELXA 1B8JA 1O99A 4LRFA 4CYRA 1EW2A 2GSOA 2IUCB 3NKMA 4KAVA 4UORA 3M8YA 1HJKA 1ALIA 3BDGA 1KHKA 2W5TA 3WAYA 1KH9A 4B56A 3DYCA 4TN0A 3M8WA 1ALKA 4KJDA 4LRDA 3UN3A 5HRTA 4N7TA 1EI6A 1ELYA 1AUKA 4LR2A 5DLTA 2XRGA 3DPCA 2VQRA 3NKRA 1ZEDA 4MHXA 3TX0A 2GA3A 4GTXA 2W5XA 1KH7A 3MK2A 3IDDA 2ZKTA 3MK0A 1ED8A 1EQJA 1EW9A 3BDFA 1ELZA 4GTZA 1AJBA 3UO0A 1SHQA 4UPIA 4LR9A 1N2KA 5KXAA 5L0BA 1KH5A 3T02A 1ZEFA 3UN2A 3WAXA 4ZG6A 5LRMA 4FDJA 5AJ9A 3NKQA 5GOVA 2XR9A 1SHNA 2GLQA 4LR8A 4LRAA 4YR1A 3LXQA 3TWZA 3SZZA 4ZG9A 2ANHA 4CXKA 4KAYA 2G9YA 1K7HA 3NKPA 3NVLA 4NWJA 4LQYA 3WAWA 2W5WA 2W8DA 2W5RA 4GTYA 1KHJA 2GSUA 2IUCA 1E1ZP 3T01A 3KD8A 3E2DA 3IGYB 3SZYA 3ED4A 3B5QA 2QZUA 4MIVA 5C66A 5LIAA 4NWXA 2X98A 1AJAA 5EGEA 5K4PA 1AJCA 5IJQA 3WAVA 4KM4A 4ZGAA 1Y6VA 2GSNA 1FSUA 2IFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ANJ A;  1E2S P;  1ZEB A;  1ANI A;  3M7V A;  3BDH A;  5LRN A;  4LRE A;  5INH A;  5TJ3 A;  4CXU A;  4LRC A;  5EGH A;  3TG0 A;  1E3C P;  4LRB A;  4KJG A;  1Y7A A;  3Q3Q A;  3WBH A;  3MK1 A;  4UOP A;  5DLW A;  4ZG7 A;  1KHN A;  1O98 A;  3UN5 A;  1E33 P;  2W8S A;  1ED9 A;  3M8Z A;  5IJS A;  1KH4 A;  3IGZ B;  5GRR A;  4QAX A;  1URB A;  5L0E A;  1AJD A;  2W5V A;  4MY4 A;  4UPK A;  1ALJ A;  3NKN A;  1ALH A;  1EJJ A;  5L0K A;  1EW8 A;  5LQQ A;  3BDG B;  4CYS A;  4UPL A;  3T00 A;  2RH6 A;  4CXS A;  3A52 A;  2D1G A;  2W5S A;  4UPH A;  1HQA A;  2W5Q A;  3CMR A;  5DLV A;  1P49 A;  1URA A;  4UOO A;  1HDH A;  4GTW A;  3OT9 A;  1N2L A;  3NKO A;  1KHL A;  3UNY A;  4LR7 A;  4FDI A;  1ELX A;  1B8J A;  1O99 A;  4LRF A;  4CYR A;  1EW2 A;  2GSO A;  2IUC B;  3NKM A;  4KAV A;  4UOR A;  3M8Y A;  1HJK A;  1ALI A;  3BDG A;  1KHK A;  2W5T A;  3WAY A;  1KH9 A;  4B56 A;  3DYC A;  4TN0 A;  3M8W A;  1ALK A;  4KJD A;  4LRD A;  3UN3 A;  5HRT A;  4N7T A;  1EI6 A;  1ELY A;  1AUK A;  4LR2 A;  5DLT A;  2XRG A;  3DPC A;  2VQR A;  3NKR A;  1ZED A;  4MHX A;  3TX0 A;  2GA3 A;  4GTX A;  2W5X A;  1KH7 A;  3MK2 A;  3IDD A;  2ZKT A;  3MK0 A;  1ED8 A;  1EQJ A;  1EW9 A;  3BDF A;  1ELZ A;  4GTZ A;  1AJB A;  3UO0 A;  1SHQ A;  4UPI A;  4LR9 A;  1N2K A;  5KXA A;  5L0B A;  1KH5 A;  3T02 A;  1ZEF A;  3UN2 A;  3WAX A;  4ZG6 A;  5LRM A;  4FDJ A;  5AJ9 A;  3NKQ A;  5GOV A;  2XR9 A;  1SHN A;  2GLQ A;  4LR8 A;  4LRA A;  4YR1 A;  3LXQ A;  3TWZ A;  3SZZ A;  4ZG9 A;  2ANH A;  4CXK A;  4KAY A;  2G9Y A;  1K7H A;  3NKP A;  3NVL A;  4NWJ A;  4LQY A;  3WAW A;  2W5W A;  2W8D A;  2W5R A;  4GTY A;  1KHJ A;  2GSU A;  2IUC A;  1E1Z P;  3T01 A;  3KD8 A;  3E2D A;  3IGY B;  3SZY A;  3ED4 A;  3B5Q A;  2QZU A;  4MIV A;  5C66 A;  5LIA A;  4NWX A;  2X98 A;  1AJA A;  5EGE A;  5K4P A;  1AJC A;  5IJQ A;  3WAV A;  4KM4 A;  4ZGA A;  1Y6V A;  2GSN A;  1FSU A;  2IFY A; 
#chains in the Genus database with same CATH topology
 5C4J C;  3AH5 A;  4Q5S A;  1Y1V C;  5M3M K;  3LPX A;  3GTO C;  4A3E C;  5LRN A;  4O2D A;  3VA7 A;  5TJ3 A;  2Y0S L;  1USM A;  2P8T A;  5JVO A;  3S1N C;  3CAG A;  3WBH A;  3MK1 A;  4BXX K;  4ZG7 A;  3UN5 A;  1F7V A;  5IYD K;  2W8S A;  4C3H K;  4GTL A;  1URB A;  5L0E A;  1AJD A;  2W5V A;  4YFX A;  5CHP A;  1J6W A;  4LOW A;  5L0K A;  4A3I C;  3FKI C;  1EW8 A;  4CYS A;  1DCH A;  4BY1 C;  2RH6 A;  2NVQ K;  3S2H C;  3GTK A;  3LAP A;  5IYD C;  3TFH A;  2JA5 K;  4Y7N C;  2B63 K;  3M4O C;  1O26 A;  2E2J C;  4UPH A;  5DLV A;  3S1N K;  2ZUF A;  4A3M C;  4NOI A;  2WAQ D;  3NKO A;  4A3F K;  3GEH A;  3FOF A;  2E2H A;  1J6X A;  3GTQ A;  3NKM A;  4UOR A;  1G51 A;  2E2I K;  1PJ6 A;  4XSZ A;  3JST A;  2PPB A;  2NVY A;  3GTM A;  5IP9 C;  3ERE D;  4XSX A;  1EFW A;  1TWC A;  3HKZ D;  4C2M C;  1ELY A;  1AUK A;  5M5W K;  5JFE A;  1I6V A;  1XXA A;  3OPF A;  2GA3 A;  4AYB D;  3FOE A;  3GDZ A;  2ZFZ A;  1XZQ B;  3GTG C;  2R93 A;  3IDD A;  3MK2 A;  4MQ9 A;  4A93 K;  3GTK K;  1R9T A;  4XLN A;  2GAH C;  2JA7 K;  1AJB A;  5C3E C;  4WJ4 A;  5HL8 A;  3GTJ K;  1SHQ A;  2O5J A;  4UPI A;  4LR9 A;  1O29 A;  5L0B A;  1PJ7 A;  1ZEF A;  2A69 A;  3I4N K;  5LRM A;  4FDJ A;  2JA6 A;  3PO2 C;  2GLQ A;  4A3I K;  4KAW X;  5TMC A;  2V6S A;  4KMH A;  3HOW C;  3S0X A;  1O27 A;  3H0G K;  3GEI A;  4A3D K;  1VLO A;  1IW7 A;  1R9T C;  2W5W A;  4GT9 A;  2GSU A;  2IUC A;  1E1Z P;  4LJZ A;  4G7O A;  2NVY K;  3T01 A;  3E2D A;  2E2H K;  3IGY B;  3SZY A;  5C66 A;  1TWF C;  1V5V A;  3H0G A;  4ILD A;  1F93 A;  1AJA A;  4A3E K;  4A3B C;  4LK1 A;  1PJ5 A;  5FJ8 K;  5CJ9 A;  2R92 K;  4C3I C;  3HOX K;  2GSN A;  3GTL K;  3GTM C;  1ZEB A;  4P9S A;  1ANI A;  2R93 K;  3M7V A;  4DDQ A;  4A3B K;  1DCO A;  5INH A;  1WQH A;  1ZYR A;  1IL2 A;  3S2D C;  2NVT K;  4KMD A;  4GTB A;  1E3C P;  3Q3Q A;  1Y7A A;  5IP9 K;  3ORE A;  4Y52 K;  1KHN A;  3IPJ A;  3M8Z A;  2WB1 L;  1DD5 A;  1JOE A;  1DCP A;  2XCR B;  2E2I C;  2YU9 A;  1KH4 A;  4YFN A;  3HXA A;  1USO A;  1XXB A;  2YU9 C;  2E2I A;  1SFO C;  5LQQ A;  5IOS A;  3BDG B;  4WJ3 M;  4P5B A;  4CXS A;  1XXC A;  3A52 A;  3I4N C;  2R7Z K;  1EQR A;  4OIP A;  4A3M K;  1HQA A;  3GTP K;  3CMR A;  2JA8 K;  5M3F K;  3HOV C;  1URA A;  2WB1 D;  2E2J K;  3OT9 A;  1I50 A;  3S1R C;  1KHL A;  3PO3 K;  4LR7 A;  2NVQ C;  1ELX A;  1YX2 A;  2CW0 A;  3FKI K;  1BS2 A;  3GTG K;  1O99 A;  4LRF A;  2GSO A;  4AH6 A;  1YNJ A;  3M8Y A;  3L4K A;  4BBR K;  1O2A A;  4A3J C;  2BE5 A;  1K83 A;  3TFI A;  3I4M C;  1KHK A;  3AQO A;  2PHC B;  2W5T A;  3H3V L;  1UV7 A;  4OIR A;  1VRQ C;  4TN0 A;  3M8W A;  2R7Z C;  1ALK A;  4QJV B;  4KJD A;  2D6F C;  1TWC K;  4ZH4 A;  1K83 C;  1VJE A;  2EBB A;  1Y1V K;  3NKR A;  2FQO A;  4GTX A;  4C3I K;  4YG2 A;  4JK1 A;  3S16 K;  2ZKT A;  1X31 C;  3S17 K;  1EW9 A;  1I50 C;  1YCL A;  1F9N A;  4KAT A;  5TMF A;  4KDD A;  3M3Y K;  1N2K A;  3BP8 C;  3WAX A;  3T02 A;  3RZO K;  3UN2 A;  4ZG6 A;  5IOT A;  3NKQ A;  4QIW D;  2XR9 A;  4PAB A;  2JA7 A;  1R9T K;  4LR8 A;  1I3Q K;  3A8K A;  3CQZ K;  3TWZ A;  3S16 C;  2JA6 K;  4G0V A;  4C3H C;  3HOW K;  5IYB K;  3WAW A;  2W5R A;  4GTY A;  5IOQ A;  3AD7 C;  3S15 C;  4KAR A;  4BXX C;  4GTD A;  4X6A C;  4AYB L;  4YFK A;  1TWC C;  3KD8 A;  1IQ0 A;  3B5Q A;  5L46 A;  5C3E K;  2NVY C;  4MEY A;  4A3C C;  4G0W A;  3S1M C;  3GTO K;  5K4P A;  4GTA A;  4A93 C;  5IYB C;  5IJQ A;  4G7H A;  4OIO A;  4KM4 A;  3WAV A;  1Y6V A;  1J6V A;  1O98 A;  1JVI A;  3CQZ C;  1ANJ A;  4OIN A;  4KB2 A;  1WOP A;  3PO2 K;  4MEX A;  4CXU A;  4GTF A;  3S1R K;  4LRC A;  1VGX A;  1TWF A;  4A3G C;  3TG0 A;  1O24 A;  4KJG A;  4LRB A;  1WQF A;  2V6T A;  3AQP A;  5DLW A;  1AB4 A;  1WOR A;  2WAQ L;  1E33 P;  4KB4 A;  3S17 C;  3GTK C;  1ED9 A;  4BKW A;  5IP7 K;  4QAX A;  1HQM A;  1XPP A;  4FZB A;  5C4X K;  4MY4 A;  4UPK A;  1WQG A;  4KMU A;  1ALH A;  1SMY A;  2PMZ L;  3S14 K;  3BP3 A;  2D1G A;  3OEP A;  2W5Q A;  1EK8 A;  4GTC A;  1P49 A;  4UOO A;  1HDH A;  4GTW A;  3HOZ K;  2PA8 L;  3S2D K;  1IE0 A;  3UNY A;  3S2H K;  4FDI A;  1Y1W K;  1WOO A;  4GFQ A;  1B8J A;  4KM8 A;  3GTP A;  3GTG A;  2R93 C;  1C0A A;  3NUH A;  2R7Z A;  2IUC B;  3GTM K;  4KAV A;  2FQT A;  1WCM C;  3HKZ L;  1I6H K;  4FM9 A;  1BGW A;  1HI9 A;  3HOY K;  1O2F B;  3PO3 C;  1BJT A;  3DXJ A;  3G4C A;  5IYC C;  3GTQ K;  3WAY A;  1KH9 A;  4A3L C;  3EQL A;  2O5I A;  5HRT A;  4LK0 A;  4Y7N K;  4PAA A;  1EI6 A;  4WIL A;  4LR2 A;  4BY1 K;  3LAJ A;  1INN A;  4GZY A;  1ZQ1 C;  1I6H C;  1IBA A;  2YU9 K;  2XRG A;  2VQR A;  1WCM K;  2PA8 D;  4MHX A;  3TX0 A;  1KH7 A;  1ZBS A;  2VUM A;  1Y1W C;  3FHZ A;  4J3N A;  3MK0 A;  3BDF A;  2A6H A;  1SFO A;  3GTJ A;  3UO0 A;  4BLA A;  2PMZ D;  1KH5 A;  2P5M A;  3RZO C;  3GTL A;  4KN7 A;  5FLM C;  3M3Y C;  4BLB A;  4QJV A;  4QIW L;  4A3K K;  2NVX C;  1XZP A;  2A6E A;  4Q4Z A;  1B4B A;  3FKI A;  3L4J A;  1WIH A;  4LRA A;  1WOS A;  2RGR A;  3GTL C;  3LXQ A;  3SZZ A;  5C4X C;  3HOX C;  4KAY A;  5IP7 C;  3GSI A;  5C44 K;  2W7V A;  1EH1 A;  2Y0S D;  2CFA B;  1GE9 A;  1TWF K;  3K7A C;  2CFA A;  2QZU A;  5LIA A;  5EGE A;  1JQW A;  4C3J K;  5M5Y K;  1F7U A;  3GTO A;  1AJC A;  1Y1V A;  1J98 A;  4A3J K;  3I4M K;  3H0G C;  3A8I A;  3V4G A;  3H3V D;  4A3D C;  5IOR A;  4ZGA A;  1FSU A;  2IFY A;  5M5X K;  1E2S P;  2VUM K;  4LLG A;  2GAG C;  1TWH A;  4C3J C;  3S1M K;  3BDH A;  3AD9 C;  4LRE A;  1TWG C;  3GEE A;  4A3F C;  5EGH A;  1WCM A;  3K7A K;  4C45 A;  1XZQ A;  2JA8 C;  3HOV K;  3RZD K;  4UOP A;  3GTP C;  5IYC K;  4M1X A;  3S15 K;  3WOD A;  2JA5 C;  3BUE A;  5IJS A;  4KAS A;  5E68 A;  3IGZ B;  4XCH A;  2JA6 C;  5GRR A;  3N0B A;  1I3Q A;  1O28 A;  1I3Q C;  1ALJ A;  3S1Q K;  4BBS C;  1BDF A;  3NKN A;  1EJJ A;  3HOU K;  2JH3 A;  4UPL A;  2NVX K;  3T00 A;  1TWA K;  4A3K C;  5FLM K;  3MML B;  2A68 A;  4Y52 C;  2W5S A;  3QX3 A;  1WSV A;  1KQ4 A;  2V6U A;  1WSR A;  2ZUE A;  2NVT C;  1N2L A;  4P5A A;  3TFJ A;  1TWA C;  4CYR A;  4KC6 A;  1EW2 A;  3S1Q C;  4KN4 A;  4BBS K;  5C4J K;  1ZVU A;  3GIR A;  1K83 K;  1HJK A;  1ALI A;  3BDG A;  1TWH K;  1ZXO A;  1L0W A;  2B63 A;  2XCQ A;  2Y3P A;  3CQZ A;  4B56 A;  4A3L K;  1ISE A;  3DYC A;  3GTQ C;  1RU0 A;  4A3G K;  2E2H C;  1YNN A;  4G7Z A;  4G0U A;  3M4O K;  4LRD A;  4N7T A;  2B63 C;  3UN3 A;  3HOY C;  4BBR C;  5DLT A;  1B4A A;  2XCO A;  3DPC A;  3HOU C;  1ZED A;  2W5X A;  1VH2 A;  3N3Y A;  3AD8 C;  4BY7 K;  1TWA A;  1ED8 A;  2NVX A;  1EQJ A;  1IS1 A;  4A3C K;  1ELZ A;  3HOZ C;  4GTZ A;  3ADA C;  2KWA A;  3RZD C;  5KXA A;  4RMF A;  4X6A K;  5AJ9 A;  3GTJ C;  1TWG K;  5GOV A;  1SHN A;  2JA7 C;  1SFO K;  3S14 C;  4KMA A;  1Y1W A;  3A8J A;  2VUM C;  4BY7 C;  4YR1 A;  5C44 C;  4ZG9 A;  2ANH A;  4CXK A;  2G9Y A;  1K7H A;  3NKP A;  3NVL A;  4NWJ A;  4LQY A;  3TTG A;  1O2B A;  2W8D A;  1KHJ A;  3N0C A;  2JA5 A;  4GTE A;  4C2M K;  2R92 A;  3ED4 A;  4MIV A;  1O25 A;  4XLP A;  4NWX A;  2X98 A;  1TWG A;  1I50 K;  1TWH C;  5D4D A;  1XZP B;  4KM9 A;  4OIQ A;  2R92 C;  3G4A A; 
#chains in the Genus database with same CATH homology
 1ANJ A;  1E2S P;  1ZEB A;  1ANI A;  3M7V A;  3BDH A;  5LRN A;  4LRE A;  5INH A;  5TJ3 A;  4CXU A;  4LRC A;  5EGH A;  3TG0 A;  1E3C P;  4LRB A;  4KJG A;  1Y7A A;  3Q3Q A;  3WBH A;  3MK1 A;  4UOP A;  5DLW A;  4ZG7 A;  1KHN A;  1O98 A;  3UN5 A;  1E33 P;  2W8S A;  1ED9 A;  3M8Z A;  5IJS A;  1KH4 A;  3IGZ B;  5GRR A;  4QAX A;  1URB A;  5L0E A;  1AJD A;  2W5V A;  4MY4 A;  4UPK A;  1ALJ A;  3NKN A;  1ALH A;  1EJJ A;  5L0K A;  1EW8 A;  5LQQ A;  3BDG B;  4CYS A;  4UPL A;  3T00 A;  2RH6 A;  4CXS A;  3A52 A;  2D1G A;  2W5S A;  4UPH A;  1HQA A;  2W5Q A;  3CMR A;  5DLV A;  1P49 A;  1URA A;  4UOO A;  1HDH A;  4GTW A;  3OT9 A;  1N2L A;  3NKO A;  1KHL A;  3UNY A;  4LR7 A;  4FDI A;  1ELX A;  1B8J A;  1O99 A;  4LRF A;  4CYR A;  1EW2 A;  2GSO A;  2IUC B;  3NKM A;  4KAV A;  4UOR A;  3M8Y A;  1HJK A;  1ALI A;  3BDG A;  1KHK A;  2W5T A;  3WAY A;  1KH9 A;  4B56 A;  3DYC A;  4TN0 A;  3M8W A;  1ALK A;  4KJD A;  4LRD A;  3UN3 A;  5HRT A;  4N7T A;  1EI6 A;  1ELY A;  1AUK A;  4LR2 A;  5DLT A;  2XRG A;  3DPC A;  2VQR A;  3NKR A;  1ZED A;  4MHX A;  3TX0 A;  2GA3 A;  4GTX A;  2W5X A;  1KH7 A;  3MK2 A;  3IDD A;  2ZKT A;  3MK0 A;  1ED8 A;  1EQJ A;  1EW9 A;  3BDF A;  1ELZ A;  4GTZ A;  1AJB A;  3UO0 A;  1SHQ A;  4UPI A;  4LR9 A;  1N2K A;  5KXA A;  5L0B A;  1KH5 A;  3T02 A;  1ZEF A;  3UN2 A;  3WAX A;  4ZG6 A;  5LRM A;  4FDJ A;  5AJ9 A;  3NKQ A;  5GOV A;  2XR9 A;  1SHN A;  2GLQ A;  4LR8 A;  4LRA A;  4YR1 A;  3LXQ A;  3TWZ A;  3SZZ A;  4ZG9 A;  2ANH A;  4CXK A;  4KAY A;  2G9Y A;  1K7H A;  3NKP A;  3NVL A;  4NWJ A;  4LQY A;  3WAW A;  2W5W A;  2W8D A;  2W5R A;  4GTY A;  1KHJ A;  2GSU A;  2IUC A;  1E1Z P;  3T01 A;  3KD8 A;  3E2D A;  3IGY B;  3SZY A;  3ED4 A;  3B5Q A;  2QZU A;  4MIV A;  5C66 A;  5LIA A;  4NWX A;  2X98 A;  1AJA A;  5EGE A;  5K4P A;  1AJC A;  5IJQ A;  3WAV A;  4KM4 A;  4ZGA A;  1Y6V A;  2GSN A;  1FSU A;  2IFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...