4LR8A

Phosphopentomutase s154a variant soaked with ribose 5-phosphate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTAADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 141
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lr8A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lr8A01
1ANJA 1E2SP 1ZEBA 1ANIA 3M7VA 3BDHA 5LRNA 4LREA 5INHA 5TJ3A 4CXUA 4LRCA 5EGHA 3TG0A 1E3CP 4LRBA 4KJGA 1Y7AA 3Q3QA 3WBHA 3MK1A 4UOPA 5DLWA 4ZG7A 1KHNA 3UN5A 1O98A 1E33P 2W8SA 1ED9A 3M8ZA 5IJSA 1KH4A 3IGZB 5GRRA 4QAXA 1URBA 5L0EA 1AJDA 2W5VA 4MY4A 4UPKA 1ALJA 3NKNA 1ALHA 1EJJA 5L0KA 1EW8A 5LQQA 3BDGB 4CYSA 4UPLA 3T00A 2RH6A 4CXSA 3A52A 2D1GA 2W5SA 4UPHA 1HQAA 2W5QA 3CMRA 5DLVA 1P49A 1URAA 4UOOA 1HDHA 4GTWA 3OT9A 1N2LA 3NKOA 1KHLA 3UNYA 4LR7A 4FDIA 1ELXA 1B8JA 1O99A 4LRFA 4CYRA 1EW2A 2GSOA 2IUCB 3NKMA 4KAVA 4UORA 3M8YA 1HJKA 1ALIA 3BDGA 1KHKA 2W5TA 3WAYA 1KH9A 4B56A 3DYCA 4TN0A 3M8WA 1ALKA 4KJDA 4LRDA 3UN3A 5HRTA 4N7TA 1EI6A 1ELYA 1AUKA 4LR2A 5DLTA 2XRGA 3DPCA 2VQRA 3NKRA 3TX0A 1ZEDA 4MHXA 2GA3A 4GTXA 2W5XA 1KH7A 3MK2A 3IDDA 2ZKTA 3MK0A 1ED8A 1EQJA 1EW9A 3BDFA 1ELZA 4GTZA 1AJBA 3UO0A 1SHQA 4UPIA 4LR9A 1N2KA 5KXAA 5L0BA 1KH5A 1ZEFA 3UN2A 3T02A 3WAXA 4ZG6A 5LRMA 4FDJA 5AJ9A 3NKQA 5GOVA 2XR9A 1SHNA 2GLQA 4LR8A 4LRAA 4YR1A 3LXQA 3TWZA 3SZZA 4ZG9A 2ANHA 4CXKA 4KAYA 2G9YA 1K7HA 3NKPA 3NVLA 4NWJA 4LQYA 3WAWA 2W5WA 2W5RA 2W8DA 4GTYA 1KHJA 2GSUA 2IUCA 1E1ZP 3T01A 3KD8A 3E2DA 3IGYB 3ED4A 3SZYA 3B5QA 2QZUA 4MIVA 5C66A 5LIAA 4NWXA 2X98A 1AJAA 5EGEA 5K4PA 1AJCA 5IJQA 3WAVA 4KM4A 4ZGAA 1Y6VA 2GSNA 1FSUA 2IFYA
chains in the Genus database with same CATH superfamily
4USHA 4USKA 1ULRA 2NSBA 5K14B 2BVZA 4DUZJ 2NS1B 4KO0B 4NLUA 5A6PA 3NKRA 2I1RA 1U0SA 1YIJS 1SQEA 1N0VC 4IOAQ 1U26A 4KAIA 1LWEB 3MPYA 3GV7B 4KV8A 2I2YA 5KT7A 3MEGA 2X1BA 4U6PA 2GQCA 3SV4A 4FF2A 1T9TA 3HXMA 3DOMB 4LF2A 4HH1A 3KK2A 3R1LA 3DOMA 1X5TA 2HHHF 5A8RB 4KC5A 1GEHA 2CJAA 3BGRB 2QL5B 1NLKL 2ILYA 4DPXA 4ITSA 4HACB 2BBEA 7FD1A 2IMWP 4NXNF 1URBA 2WRMA 3Q8RB 1NKEA 1S6UA 2ZNZA 3DLEA 4GO5X 1CJVA 2PGCA 3IWNC 1AW0A 2W5VA 1C4CA 4C3MA 4J9OA 4IR1A 1EW8A 2MQLA 4CYSA 3T1HJ 1QD1A 4KH1B 3LUYA 5ETVA 1BQMB 2CQGA 2FJBB 2V0NA 5H9FJ 1BQMA 1H2TZ 3AT1B 2B51A 2MSTA 2Y0BB 2MKKA 5DDPC 1J27A 3K5LA 1S6PB 5DLVA 3W2WB 5ETOA 1GFWB 4LF7J 2XBPA 3I82A 4KR0B 1VYAA 2M8HA 1RCOB 1TR0A 4ED1A 1OSCA 5ETRA 2EG2A 4B3MJ 1URNA 1T3OA 2QTWA 5IM0B 2EFOA 2C2NA 1U1QA 1RTZA 2DY9A 2EC0A 1G2EA 5ADZA 3KK2B 4NXNJ 2XQCA 4TQRA 2WBMA 3PW4A 3PV8A 1VQ5S 2XO6A 3RJMB 3CIZA 4ES2A 1XNRF 1LXJA 4E2FB 1LQ9A 3TA2A 3OXLA 4FXWA 3HHLB 1KP6A 1LKZA 4OIXA 1DHMA 2O1PA 2DNPA 3MECA 2ATCB 1FK9A 2CVEA 5K14A 4DU7A 3J7YI 2MZTA 3CCWA 4O0NA 1N88A 1C0TA 2NYIA 2VG7A 4NCGB 1U2RA 2R2TA 2EKNA 4F36A 2FZCB 3IS9B 4N47A 3KLFB 4C0OC 2GHPA 6AT1B 2GA3A 2Y1IA 4AYBD 3HCXA 4DV3F 3AFGA 3C6UB 3KNGA 3DXBA 1N33J 2YY3A 2EI5A 3MM5A 2MYFA 4DSJA 3TAPA 1R7IA 3ET6A 3GMGA 2OELA 2UUCF 1YWXA 1AUDA 2HFUA 3SSQA 1SHQA 4DSKA 5HP1A 4LR9A 1XC9A 1PJ7A 1ZEFA 2HNDB 2A18A 3I87A 1TQLA 4I1TA 2J0SD 2G9YA 4O4RA 5KFWA 1PAUB 4ZVGA 4UZBA 2HYIB 1X4DA 2BKOA 5LT5A 2ZBPA 4UUWA 2XI3A 2JWNA 3I32A 2ZH5A 4NLGA 2M2BA 1T3NA 3TZZA 2XS7A 4C8LA 4FF3A 4J9SA 2MJNA 5D3GB 3OV7A 1JLCB 2J7UA 1UVIA 2LMIA 3OUYB 1VLOA 1Y00A 2V2KA 1QE1B 3R9LA 1N32J 5FLXY 2UU9F 1UJ4A 2GHWA 4JYAJ 1PCAA 3VZIA 1E1ZP 2XLKA 3UR0A 2CPIA 2IM2A 4IG0B 5CYQA 1HR0J 4OHVA 4UT4A 1CS4A 4OYIA 3BN4A 4O4GB 3IGYB 3F44A 4PQAA 1IJEB 1NK4A 5KOWA 5L1IA 1RWWB 2CZ9A 3AB2B 2JDJA 3EXCX 2HHVA 4URSA 1CC8A 1Q7LB 4NLVA 4ZHRA 1KONA 3FUYA 2CWXA 4K59A 2JC0A 3BBFA 1VLYA 2DTJA 3LANA 1TL5A 1HNZF 2FVPA 1YG0A 1F3VA 1MWZA 1RT6A 1ZBTA 4LSZB 4WWSA 2G4BA 1UEUA 2E5HA 3MMBB 3BKFA 2VQFJ 5HAOA 1RBOB 1QDUB 3QZ7A 4ID8A 3CT9A 4USVA 2VU5A 1RYRA 2QSWA 2NLWA 4NEZA 3QJJA 4GKJF 5INHA 3QIDA 4WZQA 1CJTA 1OWXA 1WKJA 3C6UA 5J1EA 3SCJE 5HJXA 3EGVA 2SXLA 2YKMB 3JQKA 2B43A 4OZJA 2XY5A 2XYGB 3LPEA 1WEZA 2RIJA 2RRAA 4J37A 3NLCA 3OXGA 5A6WA 1I3OB 2DT9A 2HWTA 3EZUA 3JS9A 4ENOA 5KFBA 4K50A 2VB6A 2PO4A 3NAHA 3QPIA 4ZA1A 2R8HA 4A47A 5KFDA 3ISNC 1Q16B 2HWIA 4LFCF 2UXCF 3CJ2A 3BDGB 1UVJA 3DOKB 3G82A 1BLUA 3VAFA 5DS7A 3V6KA 4MYUA 3M9MB 3TAQA 3C19A 1WF2A 2AF6A 3ZTOA 5E33A 4K4VA 2VUGA 4H4KC 4OZ3A 4ZCKA 3ELHA 3ZZRA 3NGKA 5KAKA 3MDFA 3K59A 5GAEI 4ZP8A 4WP3A 2AIRB 1V3ZA 1KHLA 2Z0GA 1UW4A 5B0EA 1YX2A 3P49B 2AWZA 1R89A 2DIVA 5I3UA 4CQ1A 5KG6A 3PO5A 5F8HA 1LFPA 2PIIA 2X3DA 3H20A 2RKIB 3VQSA 3H5SA 2GSOA 3N0VA 2GMLA 1I51B 1RTIB 1C1CA 1A7GE 2QIFA 4L73A 3LP1A 4JI7F 3QMQA 2XR9A 2VASA 4WKRA 4ZJQA 3P5TL 3AQOA 1HNVA 2OEKA 4I64A 4TLRA 3D3BJ 2R2SA 3GYXB 4WKYA 3JB9k 3ZO7A 3K7RA 4DV1J 2WCXA 2G1DA 3KJQB 3OR1A 4H4OA 3W60A 3K0JA 3FNNA 2FHKA 4GO7X 4KJDA 3G8QA 2ZKUA 2MLZA 1WI8A 5F3ZA 1CJUA 3V81B 3SI8A 2NXNA 4UY8T 4G1QB 4B3TF 1P1LA 2OMOA 2UUTA 3DDIA 3SEOA 2HAIA 5D0EA 2VQEF 3KTQA 1I5OB 2GVDA 2Q6CA 2V69A 4OJGA 3HHDA 2OHDA 2BM0A 4DZ6A 5A8KA 1FDNA 3N6LA 1CJKB 2AZ3A 2NZCA 2NREA 2HZAA 4N77A 4UQTA 2B4UA 2YNHA 5B7WA 2KTQA 3UNGC 2CWKA 4N8NA 5GMEA 1N2KA 4ECYA 2H5EA 3UN2A 3T02A 1IWGA 1M5SA 2BEFA 2WSCC 3I9V9 2YX1A 1C0UB 1RAOA 1ZA1B 2OSRA 3N6MA 1RHUB 5DDOC 1TL7A 3SZ2A 2M8DB 1NEEA 2W8LA 1KRPA 1PGZA 1HL6A 1T9VA 3PNIA 2GV1A 3QWPA 1X4HA 3PRDA 5HROB 3K8WA 1G3OA 5KG1A 1EAYC 1RAFB 3AB4B 4EYHB 2LQ8A 2YQ3A 3MAQA 3UCZP 5B0DA 4ELUA 4O44B 3I5BA 5EN1A 2EFNA 2WSEC 2YKMA 3AD7C 1HI0P 1RWMB 1JWWA 3KLIA 1SJ3P 5K8PA 2HBRB 2E5LJ 3KD8A 2VHGA 1MSWD 1LWFA 5J2PB 4PWDB 3B5QA 4V19X 2KG1A 4D3GA 5BXIA 3FBEA 2XC9A 1U0HA 2V67A 2IIHA 1JLAB 1U0HB 1ZOTA 3AH6A 3LA0A 4TY9A 2KG0A 3CJ8A 1VC6A 2DO0A 1F9HA 4C0HA 1D09B 3T5HA 2LXUA 2OFHX 4NLOA 5IJQA 1KQKA 1Y4ZB 3Q8SB 4DV6F 4EMDA 3Q8PB 2BKNA 1O6XA 1VHIA 2DYAA 2VBYA 2EWHA 1D9AA 3S7RA 4HHUA 3TVKA 1JQGA 1FVSA 4O3SA 5HVGA 3MGJA 1WOPA 1S1UB 3MEGB 2D3ZA 3KDNA 2ILZA 5ETLA 5BYQA 2MKCA 4I56A 4J9PA 2OI2A 4LFBF 1HHSA 4DV5J 3TG0A 1S72S 4BCAA 3FCWA 2VV5A 4NZ6A 3D6HB 3K89A 2ASDA 1S0NA 2UUAF 3I6PA 2RF2A 2GCFA 3AQPA 3MM8B 3HHKA 2VODA 4ZJLA 4Z2XA 1CVJA 2DHHA 2AJFE 2GJ2A 3NS7B 2CQBA 5E3QA 5KFLA 4BC7A 1IKYB 3HJVA 1WC5A 3CTRA 2F8EX 1ICEB 4IH5A 1SC6A 3VWSA 1GMVA 2HWHA 2QV6A 3MM7B 4Q7AA 4DZDA 2KFNA 1O51A 2P6SA 1JLAA 1ALHA 4Y0FA 3F41A 3I55S 1S0OA 2BE2B 1R31A 3D28A 3JSBA 2BE9B 5F0WA 3M8SA 1IBKF 4ZLLA 1DFDA 3EJMA 2QG9B 1S1WA 2CG4A 3BQ0A 4DV2J 2HRYA 5H9EK 3MMAA 3KUGA 2HHXA 1P49A 1TFWA 4O44A 4C8KA 3DGPA 3CC7S 3M30A 4RNHA 4CT9A 1SL1A 1G1XA 1RWOB 3D7SB 1TELA 4YDXA 3UNYA 1I6JA 2E29A 1WOOA 4NE9C 4O3PA 4OV6A 5JMNA 4ZVOB 4ZVSB 1KN6A 4R8UA 3Q22A 4IG0A 3CDUA 3BM7A 5CYQB 1X5OA 3I4HX 3B78A 2BV3A 5T41A 1S6OA 3B8HA 1MROB 5G0RB 2B9YA 1MN7A 4P2FA 1ZTWA 4Q2LA 5F8LA 1P6TA 3WBZA 4N5SA 4DF8A 4F50A 4YEAA 1QY7A 5KFNA 3AA9A 2AP6A 3WAYA 1S12A 4ZCLA 2MQPA 3IBCB 2XO7A 2L3MA 5LMNJ 2FVRA 3W8GA 1FKPA 3QWUA 3W5YA 2R2RA 4LF5J 3WZ0A 2FHJA 4LR2A 1QUPA 3CJ0A 4IYQA 4DR4J 2XRGA 3IG1A 3QATA 2CJXB 2DNYA 3QLHA 3GIIA 2VQRA 5B0FA 2PA8D 3W1YC 6FDRA 4HVZA 1H2UX 5L39A 4DR6J 1DBDA 4W90B 5D4PA 4U9RA 4BWJA 2IFXA 5KT2A 2XCPA 1SIWB 3K57A 1GNKA 1ZYQA 3BDFA 2Q1LA 3OL7A 3PZPA 3CD7A 5D78A 2NXCA 4ILMA 3PYGA 2IVMA 2DNGA 2LQBA 2HQFA 2PC6A 2QL7B 2YWWA 3FBBA 1GMWD 1SXLA 1RHQB 1XWLA 2ZWPA 3NRBA 3WX8A 2WVBA 3H4BA 5LMNF 3QGIA 4DR4F 5KFRA 3OR1B 3W63A 2YQ0A 4G1PA 2ASLA 2CJYB 1NZAA 4Y2MA 5EWEA 4UUXA 3B6BA 4DX5A 2P5VA 3KOAA 1YJTA 4L74A 3UW1A 4P7VA 3POTB 4B08A 4OLOA 3H40A 2XULA 4DX7A 3BQ1A 2V63A 2LA6A 2HLTA 1GQEA 2ZOMA 1LNQA 1TAUA 2G13A 2J6SA 2YWEA 3GLJA 1FRXA 3S1TA 1SJ1A 4URQU 3GILA 1ZAVA 2UV8G 4ZHRB 1RT2A 2CJQA 4DSIA 3BKUA 4MKAA 4QPXA 1RACB 4NA2A 2HHSA 1NDKA 4WFBQ 4DQPA 2NPFA 1VDHA 4TN2A 2X1FA 1HNWJ 2B56A 2VIHA 3A8IA 4NWBA 3TUJC 3KHRA 4DV2F 2DHSA 1K8AT 3NCRA 4XDCA 2R7RA 4RZRA 4TU9A 4PWUA 3OTOJ 2GAGC 2GJIA 3QYYA 3HD2A 3GIMA 1D9DA 3NS5A 4LREA 1EARA 4C48A 3BSAA 1RK8A 3K5MA 5EGHA 3W65A 4DCJB 2ACMA 4FDFA 2E5JA 4M5GA 5IT4A 1CEZA 4TVAB 3PIOQ 4ZP7A 2UXDJ 1UZDA 4UOPA 3I96A 3CPWR 1WHWA 2VF3A 4UOHA 3ILOA 3M32B 3VALA 4IDKB 2APOA 5GRRA 4EBEA 2V8VA 4AXIA 1FA0A 4ZOSA 3UD3P 4FP9A 5HLFB 5IWAJ 3NKNA 2ZEJA 2BQ3A 2AYEA 2JH3A 2EXUA 3OSPA 3G86A 4Q45A 5KFEA 4DV7J 4DL7A 1GH8A 2GS8A 3TJ9A 2NYHA 3T00A 3IXQA 3US5A 4KBIA 4B9NA 1S7IA 1L3VA 3AJ2A 1OY9A 3MI7X 1RAGB 3OFHA 4I7FB 3TNVA 5M2PA 3ZXWA 4DLGA 5HSPA 4OI3A 2E5LF 2MQOA 1FNMA 2E7XA 1TUWA 1TMMA 1HWUA 4U8VA 4X4RA 3H4DA 2JEJA 2C2KB 2DNHA 3G8TA 2OIHA 1SVDA 2AGPA 2GC8A 2DGTA 4FYVB 3UDEA 3JSMA 3CSKA 2HRUA 4EZ6A 2AJ4A 1Q82T 5I4MA 4X64J 1H73A 2OD4A 3SSSA 1SIZA 4M95A 3M4XA 4CLPA 1RBLA 4CH7A 2LA4A 3JQMA 4HH0A 4Y2AA 1DURA 1GXUA 2LU2A 2QLFB 2AJ1A 4N8OA 2VA3A 5I3QA 3LQVA 6FD1A 2IYIA 1FESA 4OZ0A 3DRRA 1R8HA 4PXDA 3V6DB 3SCIE 3R7SB 3ILIA 1IKXB 5GAEU 4MMOA 1IKXA 4N7TA 1K47A 3ITHB 1U6ZA 2AQ4A 4DV7F 5DLTA 1YBAA 1X8DA 2H48B 2CPZA 1S6QA 3JYTA 2GVDB 2RQKA 7AT1B 3GPAA 2W2MP 3NOCA 5L8RC 2B5JA 2M3DA 3CC2S 2FVQA 2HK2A 2QLWA 3RB3A 1IQTA 1GTEA 5KT6A 2DNKA 4DJBA 3R2CJ 1HQUB 3RUBL 1ELZA 4GTZA 3H90A 3TVYA 4P6QA 2OGUA 3W8PA 4YP3A 4KJIA 2Y3YA 4DR6F 5E5NA 3FSIA 1UJ5A 4CLYA 3HP6A 2ROEA 1HBNA 1FK9B 2MPUA 3RRKA 5GOVA 1U1RA 3R6GB 2VZ9A 2F65A 3DLJA 4NRUA 5CZVA 3HSDA 4JV5J 1CBKA 1UL3A 3BH7B 4ZG9A 2VPXB 3ZZTA 4DV1F 2CFXA 2HNZA 2AU0A 1K7HA 4HI2A 3MD1A 1VQOS 4RU2A 3DGPB 4J9RA 4LQYA 4ZIWA 2QN6B 5AE1A 5J2QA 4NWJA 2Y1LB 1KH9A 1KHJA 3W9JA 2OH2A 1ZM2A 4FBUA 2A0FB 2UP1A 2UVRA 1WDDA 4KSEB 1RDRA 2Z8QA 3FFIB 2D1CA 1T95A 4X65J 3HHNB 4MIVA 2FDNA 1VQNS 4NWXA 1Q4RA 3N6NA 2BUNA 4PZVA 5IV4A 2M0GB 4P2MA 2ZZMA 1FERA 1QVFR 5IQQA 1RYSA 1T05B 3CD0A 4C97A 4HR2A 2FJXA 3BREA 4O0IA 3IAS9 1FWLA 4ZS6A 4TY8B 2VPZB 1RE1B 3KHLA 4NLDA 3PX0A 1C4AA 3C15A 2VC0A 4LSLB 1YJRA 1QE1A 3H42A 5LRNA 2YTCA 1NZ8A 1VC5A 2CPEA 4NEYA 1RT4A 4OJHA 2HGMA 5TJ3A 1RWUA 3UPFA 3EDRB 3RRGA 4B3OA 1Q8BA 3MCNA 4RNFA 5KFCA 4NA1A 3WBHA 1FFWB 3DRXA 4JI8J 2FIUA 2OLWA 2JC1A 2W8SA 1YTYA 1HBOB 1W2IA 4ES1A 1CQMA 1KWMA 1QSYA 3GE9A 1OSDA 2G2ZA 3MF5A 2GMJA 2F8HA 3HFKA 3M2RA 4H4KA 4Q8FA 3J7AN 3M6WA 3RW6A 2FVSA 2V4JA 1NSQA 4F4KA 3DRRB 5L0KA 3AA8A 2E1MC 5A0YB 2MZRA 3IR7B 1YSJA 4ICLA 2R8GA 1M5KC 1H3DA 2WVEA 1XTZA 2GIRA 4NMXA 4UW2A 5J1PA 4DU8A 1D9FA 2A1BA 4QR0A 4PYAA 2E7VA 3PDNA 1SUQB 1Q53A 1RWPB 4AQYF 1M5PC 2FHMA 1HA1A 2GW8A 2CAJA 1HLWA 2KKHA 3PJ9A 4ID5B 3W5XA 4TXSA 1IBKJ 2XMKA 3SQOP 2XGPA 1IBLF 3DRPA 3CJ3A 2MJUA 4LIRA 3H2UB 3FJ2A 2LP4A 5CABA 2C22A 4NCBA 1HW8A 1MG7A 1P9YA 5T7LA 3VGSA 5M2UA 1RT2B 4R0JA 5CHCB 2UUCJ 1N56A 2QLXA 3OJSA 1GK8A 2AKWB 2B3TB 3U7JA 4JI5F 3EGZA 1CLFA 1FXRA 2AX1A 2K1RA 2PN6A 2POKA 4K2JA 5C5JA 4J9MA 4FBTA 3MM9B 1KNZA 1U02A 3MXHP 1SV5A 3TYTA 1EP4B 2CQHA 2KRBA 3BGOP 1KTVA 1YZ7A 1HQEA 2BYCA 3DMJB 3HKZD 2H5IB 3RBDA 4Q8EA 9RUBA 1RLCL 1SJQA 1UTAA 3DMJA 5GMKa 2A6OA 1H38A 1HNXJ 2KZZA 1ELYA 2HS3A 2Z56B 1N5SA 4X84A 3Q24A 2LFVA 1O8BA 2QA1A 2YWFA 2MKHA 3BV8A 4FYYB 3GONA 1GAOA 3UQSA 2Z2LA 4DN0A 4ZLNA 1WD6A 4BDPA 2C1EB 4C8OA 4C3LA 3E2EA 1GX5A 1HFEL 1TV6A 4CO1A 8RUCA 3BR9A 3VAKA 1FKAF 3MK2A 5CD4A 4YR2A 2ADBA 3CW2C 3OFGA 5D77A 1RCXB 3ZNUA 1U4BA 4FVCA 4F4YA 2FJEB 1UWBA 1AJBA 4WTYA 1HNVB 2M4MA 4V1Ak 1IKWB 2KVIA 5L0BA 1F3FA 4K8RA 1YQHA 2YKNB 5EDWA 3C14A 4A8YA 1HWKA 1XERA 3O2IA 1U48A 3C14B 3CEDA 1WHVA 4V19J 1SL2A 3DRYA 3NBPA 4L3KA 3AHPA 3W64A 1NNDA 1Z4UA 2ZBRA 3I31A 3CB4A 4HI1A 3D9BA 4PG7A 5KT3A 3T5KA 1I1GA 1DRZA 2HBYB 2KI2A 2J9CA 4IFYA 3PR4A 2HZVA 3PTWA 1WC4A 2AEFA 2KYXA 4I6WA 1U1KA 4WK3A 1N4LA 3NY0A 4QIEA 1B4SA 2PSZA 2W5WA 3OJUA 1SJ4P 1KR4A 5KTQA 4OFZA 1PBAA 1YGYA 3W3SA 1WHXA 3BB5A 3HFVA 3K5OA 1IKYA 4X4SA 2V4QA 3W7BA 3CMES 2LEAA 1JLBB 2MQMA 2ZOFA 3GJRB 2MB0B 5C66A 2FUG9 2B4VA 4CO0A 1AJAA 1GMWA 3MEDA 4N56A 1ZM9A 2PMWA 1HD1A 3MM9A 2CQPA 2NPIA 3LP2B 4Y2KA 2B0GA 2UUWA 3EZOA 5HMWA 2AT1B 2J76E 4TU8A 1XR5A 2BX6A 2GSNA 2H9ZA 2OTLS 4OYBA 4X2BA 5CQGA 1ANIA 1FI4A 4RJVA 1R0AA 4RW8A 3TJAA 1Q7YT 1FDDA 1S79A 1KSPA 2JJ4D 2KT2A 3JYTB 2AZ1A 3HKWA 2ZH1A 2IM1A 2DEIA 4NXMF 4YFUA 4ZPTR 2RQ4A 1Y7AA 2WOMA 2Z2ZA 1R6YA 2LKZA 2IM3A 3HT0A 4LVNP 3W2VB 1JKHB 3PFOA 1K1SA 3L7PA 3M1VB 1Q8LA 1Q95G 4OZNA 5HMXA 3CCUS 1LXNA 1VQKS 2WHOA 1FDBA 3NL0A 1NHUA 4PYDA 1KH4A 5DLGA 1R0BG 3B4DA 1OPIA 1CULB 1KBRA 3HF5A 1NSKL 1ACMB 2OD6A 1IKVA 1RT5A 2JVOA 3MOZA 4CNYA 5H9FK 1KQGB 5HO4A 1EW2A 3MMJA 1S57A 4DUZF 4IFYB 1NK7A 2VL1A 2WONB 1WWHA 4QYRA 3CJTA 3OR2B 3GG1A 3H5YA 3CMRA 1UFWA 3VVUA 2VJVA 2LQJA 2A2DA 1HHQA 1HBUB 1XK8A 2BJ1A 2F9JA 2MZJA 4OMFG 4PWWA 5IQ6A 2HQGA 4WFZA 1NPPA 3GZ7A 1J2VA 4NX9A 3DLGB 4CRJA 1ELXA 4B3SF 4DQSA 2HHHJ 3MR3A 2JEIA 5THWA 4LRFA 3RBXA 1O99A 2IY5B 2ZJPQ 1RUSA 4NRTA 2FLLA 1FRHA 3ETOA 4USIA 3M8PB 3U1MA 5B09A 2MGZB 2UUBF 3R3TA 2B7CB 4QU6A 2AMCB 4OLPA 4WYLA 1X4CA 4TKTA 1HNXF 2BW2A 1KHKA 2GLQA 2U2FA 2X1AA 3CMAS 3H2VE 2W5TA 2DHGA 3D68A 1MN9A 2LEPA 2DXEA 3R5CA 4DFMA 3M8QA 5LM7E 3M8WA 1FNXH 1ALKA 1OMSA 4I2QB 3ILLA 5DQGA 3MCSA 4CWBA 3EGWB 1JLEB 1ZETA 2EVZA 3IAM9 4F7VA 3VTIA 1FD8A 4LFCJ 2A10A 2HG4A 3QSYB 1S49A 3DNCA 4IFVA 5HQMA 1FTRA 1HI1A 2YKAA 5KFPA 4PXBA 2ZH9A 2NXJA 1IQZA 5AT1B 1NB7A 3DLBA 4LF9J 2HHQA 4GTXA 2DGXA 3CDEA 4L6V3 1LK5A 4KY3A 3BBCA 4CTAB 1QSLA 1F0XA 2ZKTA 2BR0A 3TA0A 4CH0S 3KXDA 4F2RA 1DLOA 1P27B 2HNYB 1X31C 4FNIA 2ZH8A 1K9MT 2B8QA 3DGVA 4MH8A 1NXIA 1RWNB 1VQSA 2OEJA 4JV1A 2X7IA 4PEOA 3CJRA 4YB6A 4C8ZA 1N33F 3MAAA 3EDQB 2JFKA 3CCJS 2V9KA 3LP2A 2D69A 1JLQA 4ZPAA 2CG8A 5HK4A 1SCJB 2UVVA 4DV4J 2R7VA 5A8WB 3UVJB 5K9FA 3C15B 4G3IA 3N79A 4LR8A 4CLZA 3OR2A 4DV0J 2ABYA 4RW4A 3IBFB 1RA7A 2PEHA 1Y10A 1F5BA 1SC4B 4L75A 3Q23A 3L7OA 3ICLA 4R0EA 3CVKA 4Z37A 4ZDNA 2O67A 5DG9A 1YI2S 4LF4F 3OVSA 2PFFB 3GG0A 5F8GA 3QIPB 1FX2A 3FFIA 2VONA 1IJFB 3FCVA 3H0PA 4AT1B 2R9LA 5B0CA 3JSYA 2DEJA 4K4YA 2DXFA 3A1YG 1UMJA 1YJ7A 3HLUA 2V2QA 4YB5A 1OYEA 2ZE2B 2MSSA 1H0HB 5T7LB 4C3KA 4DI6A 4UOCA 2QA4G 5HLFA 4LIWA 3TUZC 1Q78A 2HHPA 4LJMA 3V2UC 2ZH2A 1NKCA 2G0CA 5C7PA 4PQUB 2FJAB 3TUIC 3E8OA 5LSLA 4TQSA 4OL8A 1IVZA 1EQ0A 1HYSA 3MPUB 3DM2A 1O98A 3CJKA 4ZPCA 2IVFB 3PYDA 4URGA 2EK1A 5ETMA 3DI6B 1HNIA 2ZM6J 1WACA 3A3OB 4USWA 2KO1A 3Q89A 4RNNA 2HLUA 4CXUA 4LRCA 2UV8A 3JTOA 3T6JA 4YN3B 3P8BB 3HSZA 5CZXA 4W98A 4OHWA 4ZPDA 1N52B 2CNKB 2C3MA 1V3SA 3C66A 2DR5A 3N5FA 5F8NA 4F8RA 1M0SA 2CNLB 1TL1A 2RD5C 1E33P 1ED9A 3WC2A 1CC7A 3GCXP 3OD2A 3FQKA 2K7JA 2XLIA 1LOUA 2F7VA 4F0MA 3MURP 1PYTA 2WW8A 1FWPA 3VAJA 3NOGA 4DS5A 1F5CA 4UPKA 4X65F 2CPFA 1JJ2R 4YMEA 3PX6A 5A8WA 1EZZB 1G4CA 5CA5A 3PEJA 4A8FA 3TUPA 2GGPA 2HW3A 2DGWA 2XMVA 1NJZA 5I3PA 1R6VA 1EX8A 2AEJA 1FRJA 2FHJD 3FZ2A 2N3OA 2D1GA 4WTOB 3TEGA 1KLNA 2W4DA 2QMXA 3FKBA 2W7OA 2CKWA 2W5QA 4M5MA 4NXMJ 5HATA 1T7PA 4GTWA 4OYWA 2DBBA 1AT1B 2DCLA 4WU2A 4JI6F 1F5AA 1XMQF 1X60A 1SKRA 1XR7A 1D0EA 3J81j 2MKIA 4RWWA 3ZZ0A 2GO8A 1N5YB 1LWEA 1QLNA 4FDIA 2BXJA 3THPA 1SC1B 1GX6A 3OW2R 2ZFHA 2K8GA 4LFAJ 2IUCB 3BF4A 3BBBA 4TYBA 4ZP9A 4KAVA 2ZE2A 4ZK7M 4PXEA 2IAJA 3N01A 4AUKA 1KC8T 4B9SA 3VGTA 3T5JA 1UVMA 3E01B 3M05A 4J90A 1VRUB 4L76A 1MMDA 3DCAA 4WU3A 4DX6A 2ADCA 3HD1A 4ECQA 5E3RA 3QZ8A 1FJ7A 3Q2TC 4X4TA 3J7Z5 3QO9B 5FDLB 3WIUA 3OL9A 3D2WA 3R7BB 4BHQA 2H4YB 4PAAA 1RAEB 2KYZA 2HNZB 4JOUA 4Q2MA 1EJ7L 2KVQE 2V68A 4I69A 4XAKA 5LSOA 3H2LA 1K73T 1H7WA 4I6AA 2KT3A 3W9HA 2YNFB 2E9TA 1WG5A 2GIFA 1NBEB 3TX0A 4MHXA 1HWIA 2DH8A 2QRRA 3U27A 2V4RA 3LTOA 2YKOA 4FYWB 5HMYA 1S76D 4CZCA 4DUYF 2CJKA 2ROGA 3R2DJ 4CLLA 1WEXA 2DK2A 3PW7A 1LW2B 4A8XA 3ZNJ1 2R7WA 1UWBB 5HANA 1S0MA 3GB0A 3EGNA 5HN0A 3U1LA 1QVGR 2ZWOA 2DXDA 5IWAF 3A3PB 3TARA 4KRWA 2KDOA 4E8UA 1CG2A 2V34A 3KLEB 1U45A 4CLTA 1BQNB 1Q8IA 2XEXA 3AJDA 4QJVA 4LF1A 4XK8C 1S99A 1KEKA 3M8QB 3PKYA 3RB6A 4OX9J 1LWXA 4ECTA 3SMZA 2HHTA 2CZVC 4LQ3A 3DM2B 2NCKL 2ZZNA 1WOSA 3TZXA 1S6QB 4DN9A 5KFMA 3UDVA 1RTDB 1XMOJ 2UXDF 3SZZA 2P8IA 4YY3J 3BYRA 1UKUA 4JV0A 3DLHA 5KFIA 4CH1A 4J9VA 2IC3A 4I2PA 4IRDA 3GV8B 1MWYA 5ETNA 1PO6A 5BYRA 2KN4A 2Y8WA 2DKOB 3T1AA 4YUDA 4EYIB 4P2SA 5LMUF 2BJ9A 4BWMA 3G6YA 2PT0A 1HBOA 1AZSA 1YVFA 4A8QA 4BBYA 2QZUA 2BOAA 2W4PA 3HHLD 1XBWA 5BR8F 3F0NA 2HFNA 2KL8A 3CJSA 4QW8A 3UR3C 4U96A 3LAKA 1F1BB 3BGFA 3M2UB 2OJ3A 3OTDA 2P9EA 3LOUA 3KJVA 2JEGA 2EW9A 2WONA 4ZVUB 1VGYA 1SKUB 3M2VA 3TP2A 1VQ6S 2GGPB 1FSUA 3ILJA 1B7YB 1X5PA 2H65B 2NXUA 2YKPA 4ZN1A 1Q1KA 5C24B 5C2GA 1W7WA 3WHIA 5C24A 3BGLA 3T1YF 1NK0A 3BDHA 1HD0A 3GJTB 1PC4A 4DV4F 5KFOA 4P71A 3IN5A 3V4IA 1N34F 1F2HA 1J5EF 3QRQA 2HFSA 3CDWA 1MW7A 5I42B 2MLYA 1S1XB 2FLNA 2BACA 1JKHA 2A3JA 1VRTB 2CXEA 2WSFC 3IA0A 1ZS6A 4IOBA 4LT6A 5EX3A 3Q2SC 4EWTA 1IBLJ 4DR5J 4LF6F 3AXMA 2QSFA 3L95X 3TQ1A 3G6XA 1R0CB 1RT1A 4FKYA 4PG5A 3SFGA 4K4UA 1N48A 1YKWA 1ALJA 1QSSA 2L9WA 2VC1A 1VRUA 3TQEA 3MFIA 2ATLA 2FD2A 2I5JB 1HYSB 1G7CB 3IM8A 3NXZA 1ZZFA 1HMVA 3BSOA 4BLGA 3AOAA 1TK8A 2OPRA 3M6VA 4NLQA 4IKAA 4JI8F 3UI3A 4ATNA 4WFNQ 1RTDA 2EFGA 4RW4B 4GC6A 1YLXA 2V9WA 2CADA 4L3NA 4RNMA 3R5AA 1WSRA 1C0TB 2VG7B 3C16A 5IT0A 3LW5C 4RUHA 3JSMB 2A2CA 2UUBJ 1ANJA 1YDLA 3EPIA 2RQCA 4FS2A 1H72C 5KFVA 2W24A 1NK6A 2F9DA 4Y28C 5KFKA 3R5DA 3GIRA 2V2VA 1SI9A 1UWAA 3NGRA 4F04B 3RBEA 1IR2A 1M5VC 2AYBA 4JI2J 4OX7A 1S9GA 1FKOA 3RU0A 5IXUA 5DLFA 1M5OC 3KK3B 2G2YA 4CLSA 2YH1A 3BDGA 1WKLA 2DR7A 3H5UA 5DG8A 1W26A 4B56A 4OHXA 2QL9B 1S10A 3LP0B 3IC1A 3CD5A 3CJKB 2QO3A 1JLEA 3FGVA 1WELA 4KGMA 5D6GA 1RB0A 2XZDB 1WC1A 2YXLA 3I5CA 4ALZA 1N34J 1WC6A 1M90T 2HQDA 1CJTB 1RZMA 2M9KA 1S6PA 4Y2IA 5GMDA 5J1EB 5I42A 3DPCA 2I38A 1VQ7S 2IBOA 1T8EA 2Q6BA 1GMUA 2FHOB 3IRXA 2J8SA 2D3UA 3LAMA 3PVXA 2IAJB 2VICA 2H1YA 3LH2S 1RAIB 2HGNA 3W9IA 3D1QA 4P75A 2ZZTA 2YWHA 1WG1A 2RQMA 4IO1A 3ADAC 5KT4A 2Z58B 4Q5VA 3KKFA 2VBXA 3A12A 1MWQA 1NH7A 4LF8F 4WZMA 2YX7A 1LW0A 3O5TB 4JBCA 5KXAA 4DLEA 4DL3A 2QMUB 2BQUA 5AJ9A 2DNOA 1Y5LB 3U02A 2DY1A 1UP1A 3TX8A 1UFKA 4F67A 1EETB 4H4MB 4UOGA 4JI3J 2ZHAA 3BEGB 3A8JA 2H5JB 2QX0A 2XY6A 5IT9U 4YR1A 4DR7F 4P74A 2OO4A 3QGHA 4MIBA 4MT1A 3CDAA 3KK1A 3NGSA 5EGYA 4A8OA 5DM6Q 5A2QY 2W7PA 3Q0AA 2HKEA 1YHQS 1TKTB 2BOPA 3W2WA 2YBVA 4DL5A 4KYZA 1XR6A 3BQ2A 4X64F 1FT8A 2PD1A 2CQ0A 4NLYA 5SUHA 3D4JA 2R8KA 1UPPA 3ED4A 2WZ1A 1N6QA 2XWXA 4NI2B 1X4EA 3MEKA 4P10A 3NS6A 1VBKA 2ZNYA 4JV5F 2X98A 1OO0B 1CSJA 2EFVA 1L3KA 1TL4A 3KG1A 2JLGA 1RABB 4FF1A 3D6FB 3N4WA 2VFSA 1LV5A 3R5BA 2BZ2A 4GVBA 1H6KX 4C8MA 2AYGA 5FD1A 4A8SA 1T05A 3DLKA 2ASYA 1XMOF 3I0RA 2HFOA 3GR0A 4DQIA 2FB0A 1U2FA 2AD9A 3PHEA 1Q79A 2KB2A 1CPZA 3V5RA 1E6VA 4NZ7A 4YDDB 5GVQA 2KHCA 4I7FA 4PRFA 1JXVA 5GAGI 4KV8B 1ITPA 1VMBA 1M5HA 5CCLA 2V2ZA 1RAJA 5G4DA 4X62J 1X9SA 1Y5NB 3KNAA 5EUHA 2BJEA 1SH3A 1Q8KA 1TKTA 3ZFVA 1KFSA 5L1LA 1PC5A 3OPKA 3P5BP 4ZG7A 3MM5B 1CQNA 3QAEA 2QFIA 2DGQA 5LXRA 2IJNA 3BGRA 1JMTA 5D4LA 1U1PA 4BC9A 1FJEB 2IPOB 4HTIA 4OQJA 4YQWA 1AJDA 5L0EA 5C42B 2IA6A 1ZAWA 2MY7A 2YNGB 1YRXA 1UEKA 3FVYA 4C7QA 4DG1A 3VAIA 1NSAA 2VD3A 1KOHA 4B3MF 4OI0A 1PAEX 1HARA 2AJQA 4YR0A 1RHRB 4UPHA 1BD6A 2DPJA 5CH7B 2DRBA 2DH9A 2W1BA 3QGPA 1HNWF 2DO4A 3GFHA 2BKPA 3SCLE 1D3WA 2JRSA 2GIQA 2WAQD 4CYUA 1VC0A 4B3TJ 1DARA 3IMQJ 5D3GA 2WW4A 3NKOA 3IRXB 1U1OA 2VFVA 3GWCA 3M30B 3NP5A 2VDHA 3T1HF 5AXLA 1EKSA 1S7HA 2C2RA 2RB7A 2ZH4A 4W92B 1PKUA 1IM4A 2Y8YA 4CLKA 2IMOA 3DRPB 4DWIA 5JVHQ 4HTJA 2KFZA 1K0TA 2LU1A 2JNJA 4HLBA 4AL7A 1PJ6A 1V5IB 2D3O1 2GNKA 3GIJA 2OPPA 3H8YA 3NCPA 4DPUA 3OTOF 2XNRA 2ZUAA 4F4AA 4F4WA 2RS2A 1EETA 2HHWA 2DITA 1V3RA 3DOKA 3G82B 5HJYA 4IG3A 2OMLA 1VBXA 4RW6A 3THTA 2M7SA 4ZPBA 5DRKA 1U24A 1VIXA 2C2OB 2ZOGA 3VAHA 4OYZA 2FLPA 1TUVA 3VZHA 2ZJRQ 4ZPWR 3NCQA 4CI0B 3CXCR 1FWKA 1RT3A 1T11A 4LQ9A 4JUZA 2CJ9A 5E41A 2KT5A 2MZSA 1HWJA 3IDDA 1J5OB 5DM7Q 5A8RA 3M8PA 4M5JA 2MGZA 1N6QB 4F0HA 4C98A 1QAIA 1C1CB 3AXKA 2K2PA 2H3EB 4Y6IA 2GAHC 1XJWB 4KT0C 1H98A 4ZMMA 1Y0HA 5D0GA 1FF2A 1U1MA 1X9WA 3OXFA 4ILRA 4S0MA 5KFFA 2MKJA 5LRMA 2HZCA 4U7UK 4FDJA 2P9CA 3OL6A 4GMKA 4DEZA 2RHQB 2DNMA 4K4WA 3T1YJ 2MTLA 1AXQA 1FRLA 3D6MB 4CO2A 1IWAA 4ZCIA 1Q0NA 3V6DA 3Q83A 2L41A 1IUJA 2QZ8A 1PG5B 1WDTA 2F63A 4LF4J 2AYMA 2CUYA 3NBPB 4GVLA 3TO8A 4WFYA 5H9EJ 2HEKA 2HRTA 3PYFA 1QJHA 4TNOA 1TK5A 3MPDA 1S59A 3ONQA 2E1PA 1OJ4A 1S1TB 4K5SA 4MTPA 2DCUB 2QT7A 2XHWA 4JP8A 2XMTA 1G6BA 1A6LA 3M6XA 4HHHA 2LEBA 2IUCA 2DHXA 4O4GA 4WP9A 3T01A 1B99A 1T02A 2R42A 1RJJA 3SZYA 3NGTA 1GXTA 4OZ5A 2KM8C 1MROA 5G0RA 1N36J 3GFXA 1UZHA 1QAXA 5C42A 1X4AA 3R1HA 3PJWA 1IR1A 3ISND 3HO1A 1Y3KA 3AJ1A 2ZC3A 4UTGA 2R3VA 2IA0A 2Y1RI 3ZTQA 4ECUA 1NRKA 2DGUA 4QW9A 1JB0C 3DN9A 1NK8A 2Y9HA 3QRPA 3LP0A 1HR0F 3EXYA 4KGZB 4USJC 5KFSA 4YR3A 1T03A 2OTJS 3H98A 4JI0J 2R7XA 5HL7Q 1X7VA 4P73A 3IG1B 3QLHB 1RXOB 1TVRB 3CNQP 5SZTA 2J6UA 4JYAF 3R5JB 3ITHA 2FZGB 5F41A 2JOQA 5HBMB 2W8KA 2HFVA 4YY3F 1YJWS 3Q3QA 3BYPA 4X4NA 3DHXA 4HDGA 2AW0A 5DDRC 3VAMA 2BANB 1VCTA 4RU9A 1WTFA 2Z57B 1U6FA 2JSXA 5E0OA 2AJ0A 2J0QD 4X4VA 4GKKJ 2HFZA 2W9BA 3T41A 2OPQA 3ZZYA 4DR1J 2CYYA 4EBDA 2CNNB 2Y1JA 3C3LA 3DHWC 5LQQA 4M5KA 3DLKB 2W2OP 4USTA 4UZCA 4K0KF 1T94A 3QT5A 1UW9A 2R7OA 3VQTA 3CCRS 2FJVA 1SH2A 4ED6A 3UD4P 3OL8A 2DIUA 4IRCA 1O5JA 1S1UA 4NLRA 5IOLA 1HQAA 3FC9A 2G0IA 1HI8A 1NO8A 4RKUC 2WB1D 1TP7A 2O01C 3FSXA 5CYMA 5KFGA 3OT9A 4ZPVR 3KHHA 1N5QA 1FHTA 4RWXA 4TU7A 4JI1J 1NKBA 4ELTA 4HDHA 5KFQA 3I0SB 3T3FA 4CCHA 1JJHA 1UVLA 4LVOP 1YK9A 3MUTP 4DSLA 1WNEA 1L3TA 4NLPA 2XB2D 3OLBA 5AJ3J 1DTTA 4TLQA 3ET6B 5ETSA 1NCLA 1FO1A 1YRTA 2VFUA 3OTEA 4MKBA 1KVKA 4MIAA 4DMZA 1LWFB 4ZIVA 5IS2A 4ECWA 5J2PA 1S0VA 1TAQA 4PWDA 4FXDA 2QE5A 3ENQA 4IR9A 1ZM4A 4ANEA 1FCAA 2PE8A 2B9EA 2K06A 3D66A 2YH0A 4M5NA 5J2NB 5C25A 5C25B 5IV3A 5GAHI 3DYAB 2XGQA 3MR5A 4FYXB 1ZTTA 4TN0A 1ZPVA 2I9SA 4DV6J 3RB0A 3UWTA 1U8SA 3HI9A 5DETA 3GJQB 5HROA 1J5EJ 2B4OA 2AHOB 2ZVIA 3ZZOA 1FDAA 1JJCB 3P3DA 2KXNB 4ED2A 2PI5A 3M8RA 5FJ4A 5DGBA 3MZIA 4RLEA 1DLOB 3J7ZT 4D3HA 2K7KA 4NI2A 2N7CA 3FZBA 2LQ9A 4UOFA 1AZSB 1RQ0A 3NWRA 1FXLA 3P4UB 1BXNA 4A4JA 1R3NA 3RAXA 2YNHB 4HHJA 1UVKA 4KE5A 3V6HA 1NJXA 2C3PA 4B02A 4GVBB 1YBUA 3WAXA 4O23A 2XMJA 3SQGB 1F60B 3SDEA 2B6AB 4NLSA 4RBVA 2ROPA 4QIWD 1VIOA 3KFWX 5B0GA 5JXSA 4RBTA 3N9UC 4QOTA 1RT7B 4IQMA 3TZYA 2XMAA 1S5ZA 3ZTRA 2KJWA 2HIQA 2R4FA 3PHTA 3KLFA 1A9NB 3GV5B 1T0TV 3HK2A 1WEYA 1KFDA 4ICLB 2J0WA 1UEVA 3DDNA 3KG0A 5ETQA 3J81U 3KUHA 1NB2A 2BA9A 2YVSA 1YJ9S 3FK4A 3EZ5A 2KRRA 3WAWA 2W5RA 4MFBA 4OX9F 2XS2A 1LWCA 4DL4A 4GTYA 2J7KA 1XMQJ 1TMJA 2E44A 2R7UA 2EPIA 1S9FA 4LF7F 1TKZB 4DR2J 3QT7A 2CQ2A 2HQCA 1MMLA 3V6JA 2RHSB 1FEEA 2MZQA 3OFEA 5L46A 2FC8A 2ACYA 2QYGA 3K2YA 3M32A 2RS8A 3D54A 8AT1B 2R8IA 2ZH6A 1FX4A 3QT8A 4K5RA 1HPZA 4ZVEA 3IWXA 2E1AA 3CCSS 4DUTA 2CZ4A 4FVMA 4IUFA 4KM4A 3D3CJ 4USMA 3WAVA 2HVIA 2BW7A 3G9CA 1KHWA 2LVWA 3Q8UA 4WFAQ 4DL6A 4KO0A 2XTJP 1Z2ZA 2AX0A 1PIEA 2ZVSA 4NYPA 4NASA 3R8YA 1UCNA 3C6TB 4LUBA 3G96A 2HMIA 4OI1A 5AE2A 2AGQA 3F56A 3NMAA 3TI0A 2H51B 3TRGA 3BO3A 1XQIA 3LPYA 1KKHA 3Q8YA 1TL1B 3VR1A 4ECVA 3PXGa 2R2UA 1NU4A 3LGHA 2VFTA 3HFZB 4PG8A 2RF2B 1VR6A 3MM8A 5DLWA 2BABA 4O3OA 2ALYB 2CQ3A 5EWGA 1C1BA 1JLGA 4I6YA 4KIAA 4OJ3A 4YHHJ 1NJIT 4JI5J 1PILA 4FS1A 2C3YA 4UQGA 3HHLA 4I67A 4DG1B 3LXQA 5K8NA 2V8GA 1C0UA 3DYAA 5BJRA 3A3NB 4ZJOA 5IT9Y 4DR5F 4LF6J 2C2EA 3MAHA 2ZM6F 1SPBP 1EB0A 3TA1A 3FRZA 4C4WA 4PKDB 1R0AB 4LF9F 4OI6A 1V9OA 4F4ZA 4PXCA 1IM6A 1NUEA 3E51A 2GFFA 4EBCA 1WKKA 3FEZA 2E5GA 1J5OA 1FRKA 4ID5A 4E98A 2ZBIA 3UCUP 1SUQA 2LDIA 5A8KB 3AODA 3FBCA 1B8JA 3ZZUA 2RDDA 3G6ES 1MMNA 1NK9A 4DF4A 4C9DA 1R43A 3A8EA 4XTTA 2E9RX 3B4MA 1RLDA 4FPRA 4WIIA 1VJQA 4WJBA 2D3OR 4CM2A 1YJNS 4DSEA 1D8ZA 1FXDA 5D0RA 2VG5A 3O1LA 3D0GE 1M1HA 2HVZA 4NZ0A 4K0KJ 3PRVA 3BO2A 3RGIA 1AROP 2HMIB 4R5PA 2FJDB 4FZVA 1JLCA 2OEMA 2BE2A 3AAWB 3OUYA 3BPDA 5HRTA 1RHKB 2DNZA 3BO4A 4HYKA 2KHDA 4C11A 2P9GA 2JFDA 1Y5IB 2VFRA 5IC6B 2QEXS 4DOZA 4HKQA 2XY7A 4PPZA 2W4CA 3MPWA 5I3UB 2OPSA 1LW2A 4QQBA 3JTNA 4CLWA 4DPWA 3HZEA 3PJXA 3WQPA 1APSA 1FJGJ 4B9LA 5LJ5Y 5EWFA 1RTJB 3MPVA 2HHUA 3KJFB 5HP1B 3MK0A 5C2CA 2DGOA 4EGLA 7FDRA 3JSRA 4ZP6A 3UO0A 3GYNA 3IBWA 4DV3J 4A8WA 3BSCA 3FCHA 1E6YA 2GVZB 4OX6A 2OP5A 4WIQA 3ZTPA 2ZH3A 1Q86T 4Z7CA 1Y11A 2L9NA 3BDPA 1KH5A 4KHRA 3MR2A 2AEMA 3K8VA 4WFXA 1UETA 3IO1A 5DDQC 5CAAA 5HMZA 1YRUA 4RUAA 3MMAB 5BR8J 3DC2A 1DY3A 4LRAA 1S1WB 1S1VA 2EEYA 2N4CA 3EICA 4G1QA 4OYMA 5F8IA 1XMBA 4EEYA 1PYOB 3S01A 3RR8A 1Y3JA 4X4OA 1ZM3A 4QIGA 3PX4A 2C28A 3O3LA 5L38A 1IN0A 3PYEA 3BSNA 1KQFB 1FE4A 1HKAA 1HNIB 1EI6A 1M1KT 3G4SS 4IOCQ 4X4UA 2RDJA 2IYGA 2E5IA 1R8CA 4R8UB 3UE2A 4B3OB 3I0SA 2J9EA 4C8YA 4IDKA 4QBUA 3DLGA 5U47A 3OHBA 3EPGA 2R7TA 5D4NA 2HK3A 2R8JA 2X3GA 3OQ2A 1RTIA 3WC0A 3ENVA 2QLJB 5EGEA 1F9EB 2LQ5A 1AJCA 5E3PA 1HBNB 5MAOA 2BE7D 1U09A 3IFEA 3OBIA 4OZ1A 1QTNB 2WVFA 1Z2LA 1FKPB 5A0YA 2IFYA 3GQCA 3CCZA 2MQ8A 2W2NP 3N28A 4K4XA 3AD9C 5KFAA 3CJQA 4YHHF 2COLA 1BC6A 3KMQA 1TKXB 2FQQB 3L9ZA 1FEHA 4OX8A 4QYZJ 2VBWA 1AB8A 1WI6A 4MK9A 3HPOA 1WF0A 2PI4A 4MAKA 5IJSA 1RWXB 3AOBA 2WVCA 2IRUA 1WF1A 1BWVA 1URRA 1HPZB 1VQYA 2VA2A 2C42A 2D41A 1PBUA 2YNIB 1BE4A 1TZ0A 3E3XA 5K5MA 2M88A 1RA6A 4O3RA 4UY85 2BM1A 4TY8A 4MK8A 1H7XA 3QRRA 4K4SA 4K2XA 3KJNB 4F4XA 1HWLA 1RU2A 2HBZB 5LL6d 5DG7A 3ZZZA 2DHAA 3DKDA 3IGNA 4G6VB 1I94J 2UVWA 2Q79A 3S8SA 2MQNA 2XMMA 1WHYA 3L7UA 2XNQA 3MD3A 3MOJB 3BPSP 4WPAA 3DOLA 3DRSA 4Q43A 4JI7J 2BMBA 2FVCA 3T19A 1AA1B 2F4FA 3OFFA 1AFIA 5GAHU 2DRDA 2GJFA 1S48A 2F1FA 2RKIA 2ZBCA 3EUNA 3HVAA 3QBCA 3SFUA 4C2MA 4J9KA 4B9MA 3T5LA 4ELVA 1UA0A 2ASJA 2IRYA 3KDOA 3EVOA 4LSNA 1HJKA 4QWAA 3SDEB 4KH0B 4OV1A 1ALIA 1E6YB 2GVZA 1U1NA 4F2SA 4CNZA 3FMBA 4J5OA 4WXWA 2V5HG 2RVJA 3PR5B 1RWKB 4KHPJ 4GC7A 1T03B 3DYCA 2PMHA 1PYSB 2BJDA 1JX4A 2IDLA 4LRDA 3UN3A 3KLHB 1UA1A 3CULA 4CYUB 4Y34A 2CPJA 2M5YA 3EVWA 4W4MA 3NMRA 3D6TB 3VF0B 5KFZA 2DNLA 2QLBB 4RX6A 4IFVB 1U2CA 2O5DA 2JLFA 2NZ4A 1ZEDA 5M2RA 2W5XA 3CCLS 2IC3B 3AD8C 4I2PB 1RAHB 1KVJA 4XDDA 5F8JA 2RRBA 2B8PA 2J9DA 1NPKA 3GTYX 4PPDA 3KHGA 1ED8A 1FJCA 4XIUA 1HQUA 2VG5B 4DR3F 5AXMA 2FC9A 2ERRA 4Q0BB 5AJ3F 3W62A 1LEOA 2B6AA 3EVMA 3NGUA 3MCOA 1N5TA 3DFEA 4NOHA 2XHCA 4IG3B 4CO4A 1VJWA 2V4JB 2HS0A 1SHNA 2A6MA 1OQ6A 1SV5B 2AJ2A 4M5IA 4X66F 3VV2B 3IS9A 5MLCV 2J0XA 3EMTA 3FBFA 5L9XA 4AQYJ 2BRLA 3O8WA 2ANHA 3VHQA 2DVIA 3D5MA 3KLHA 3NVLA 3CGIA 2HVDA 4RW8B 5ITHA 3KYLA 2OPSB 2W8DA 4X4PA 2W9AA 4YB1P 2B9WA 3GCWP 2KFYA 3RR7A 4DR1F 4DCPB 1IBMJ 4RL1A 5J1NA 3HVTA 3SBMA 4LSNB 2BJ8A 2HNDA 4DXLA 3EYZA 2E1CA 4FF4A 1MU2A 3JQJA 4CM0A 1ZPWX 1SBRA 2CQ1A 1HBMB 2XSJA 2OPQB 2W9BB 3QJLA 1ELOA 3I9ZA 3X3UA 1CULA 3BS9A 4AE5A 1OIAA 3T9NA 5CXTA 2W25A 2FJWA 5J2MB 1CJUB 3V81A 3PO4A 4G65A 4I2QA 5F9LA 3MEEA 5KFHA 4MKVA 4WP8A 3G71S 3C6TA 1TFYA 2MMYA 3L3CA 1EP4A 1K44A 3NNCA 2XYHB 2QYCA 1U7LA 1RAAB 4J9QA 3O6QA 2XMUA 3HZGA 1UPMB 4IH7A 4F25A 4ECZA 4ED5A 4FXVA 1ZAXA 2J5AA 2W7AA 3MK1A 3HULA 3HVWA 3EX7B 5J2QB 3MM6B 3UN5A 1VK3A 4HACA 1SKSA 2EFPA 2CPHA 2JHEA 2QA4S 2V8PA 4C6AA 2ZBQA 4PCQA 2HPUA 4EO6A 4ZLPA 1C2PA 3DU5A 2N82B 3NGDA 4WE1B 3IGVA 2E9ZA 3HHLC 4J7CA 3PY8A 4E0DA 3GP9A 3OLAA 3EWGA 4JI3F 2I8EA 4DPYA 1EHWA 1VQ4S 2RH6A 2VDIA 3UDLA 2QFJA 3MR7A 2QMWA 2L48A 5ETPA 1W25A 2F3JA 1KHNA 2M70A 4P7TA 2HQ3A 4QWDA 4GKKF 4RBUA 2Z4PA 3CJ4A 3HHEA 4ED4A 4CIOA 2DB1A 3HMJG 4QWCA 1RKJA 1VBZA 4JI4J 2CPDA 3P6YC 2FZKB 2Q3PA 2P6TA 3SSRA 1W2BR 2HVHA 2OKQA 4LMZA 1YJUA 3RTVA 3CCTA 5CYJA 2MQQA 3PRBA 5DZ6A 1BWEA 3NKMA 3M1VA 4EO8A 5KG4A 4UORA 2DISA 1X9MA 1N0UA 1N5VA 3BGUA 3QT6A 3BZQA 2VOOA 3DDKA 3G2XA 3OTBA 1FNOA 3CMQA 3H7HB 3D1HA 3SQGA 2RU3A 3ULHA 3W61A 2NUHA 3CJ5A 3OVAA 4PQUA 4F0KA 4WBFA 2CPXA 1QUVA 2I5JA 3FMWA 4CP5A 4LSLA 4EZ9A 2VBZA 3IRWP 4DPTA 4OJ1A 2DGVA 4A46A 3NNAA 3POTA 5E7OB 4DV5F 3RG6A 3S6EA 4C0BA 5GADU 1AUKA 1AYEA 2OAUA 1YJVA 1U47A 3B82A 2ZHBA 4QYZK 5B08A 1VI7A 3UDCA 3CCMS 1ZA2B 4A48A 3D0IE 1LWCB 5DZ7A 2XWYA 5AE3A 1N36F 2RRNA 4ZVPB 2MLXA 1JLBA 1RISA 5E3CA 2IVYA 1HW9A 1RHJB 2CNOB 2DPIA 1UAWA 5DGAA 1AFJA 3CDBA 5EHHA 2BDPA 4ZVFA 3QFHA 1HBMA 2QGFB 4UPIA 1WC0A 1MU2B 2C3OA 2F8MA 4EFAC 1D8YA 3HJFA 2ZHOA 1H2VZ 3FEYB 4KHPF 5KFJA 3BKTA 4ECXA 3L4BC 3W66A 2QC3A 3MEEB 4DS4A 2CQCA 2DR6A 2IRXA 4ER8A 2GO9A 3OSNA 3UFCX 4XPEA 3P96A 2RNEA 1TKXA 1EIYB 2J9DE 3AOCA 1GXLA 1RT4B 3HDSA 2LXFA 3VVTA 3KLGA 4Y00A 3CIMA 3QSIA 4DCOB 3DXSX 1JIHA 3NG8A 1HBUA 5IC4B 3FQLA 4G1IA 4J9UE 3IR5B 3L09A 3R7NB 3CCES 3RAQA 1KDNA 3PKMA 2GSUA 1WJ9A 2KM8B 2R7QA 3E2DA 5KFYA 1QAJA 1C1BB 1JLGB 1B0VA 5LOQA 2XCAA 3TJ8A 2RJZA 1TV6B 1XN9A 1V5VA 3HVRA 2AV5A 1SC3B 2ZITA 4KTQA 1M1GA 4PUOB 2KJVA 2YNIA 4PG6A 2LECA 4ECRA 2D7SA 1XNQJ 3BH6B 4WE1A 1PJ5A 4HEA9 3M2RB 1X0FA 1BY9A 1D1UA 1IKWA 1NAQA 1BGXT 4X4QA 4J9LA 3PIPQ 1HQEB 3R97A 2ALZA 4M5HA 1ZEBA 4RR5A 4L72B 4P9SA 3M7VA 4F3QA 3NKYA 2NSCA 3MMBA 2VQEJ 3C2PA 5HBMA 2HQIA 4MJKA 1JLFB 4OI4A 4M63A 5JJBA 2KU7A 5F9NA 2D9OA 1L3SA 2K3KA 2HAFA 3A4TA 4NPOA 2FY1A 4RO0A 4UF4A 5D8HB 1S1XA 1UJ6A 2WVDA 1KOOA 2LDYA 2XMWA 3VGUA 3HVTB 3M8ZA 1NDPA 1QAYA 2O66A 4ED7A 1XNQF 2XG8A 1JNZB 2XZWA 3PACA 2IBKA 2BQRA 3T9ZA 4ZVHA 1TU0B 2VPWB 5FIIA 3EM1A 5AXNA 2K1RB 5HVFA 2F4VF 4ZN3A 3GU0A 3IM9A 3QAUA 4NMLA 3OHAA 2F40A 3TZWA 4M94A 5B0AA 1ROFA 1Y9OA 3WX4A 4JI1F 1S4EA 1N54B 3PCOB 1JK9B 3J81Y 4CXSA 4ZVTB 3A52A 2C3UA 3H59A 3JAMU 2E1RA 4RNOA 1OY8A 2JX2A 4ZVQB 2HVEA 4DSFA 1NJWA 4HT5A 4LFAF 1FE0A 3J80Y 2G0JA 2XLJA 2V50A 3H5XA 3KK1B 1FRMA 3J7A1 4LR7A 1NMEB 3PW2A 4JI2F 4IH6A 2VG6B 3VAGA 2NQPA 3P45B 1UVNA 2UXCJ 1BHNA 3R5GA 2EKYA 3QIPA 4A8KA 2XYPB 1VRTA 3GR1A 3M8YA 4X62F 3J80U 1WG4A 3MM7A 4B3RJ 2NXEA 4NCAA 2Q66A 1R27B 1U6BA 2HGLA 2RSQA 1Q5VA 4QIVA 3DLEB 2VKZG 2JVRA 4WF9Q 4U7UD 1B0PA 1X4GA 2G9OA 3TEHB 4DR7J 5KG5A 1VRQC 4OZLA 1BQNA 1HQ2A 2CQ4A 3KUEA 1F9FA 3K17A 4CO3A 2RE1A 3C8YA 3G6VA 2X1GA 4K4ZA 3DU6A 1T9YA 2ZDPA 4NLTA 2GMHA 1AUSL 4Q44A 1SJFA 4KQZA 3I56S 2W2PP 2RT3A 2YQ1A 1B64A 4LF8J 3SV3A 4IQXA 4NYOA 2BRKA 2L9DA 4AD6A 3MHYA 2UXBF 4Y3CA 1Q5YA 1U8WA 1QTMA 1CJKA 1XIQA 3GFZA 1OY6A 3QNWB 4ANCA 3W5ZA 4ED3A 1KS2A 4DUYJ 4OHYA 1EW9A 4ED0A 2XM3A 4CYRA 4MYTA 3LO3A 1P8GA 4FPIA 4CO5A 1F6TA 2EK6A 4DHVA 3LGNA 4DDFA 1P1TA 1U49A 4ZG6A 4OYOA 5HQ8A 4YOEA 1LW0B 3NKQA 4JI0F 4PABA 3CWJA 1REVA 3VGVA 4B9UA 4GKJJ 3Q8VA 3OTCA 4OZ2A 2XI2A 3RW7A 3WIVA 1HHTP 4XPCA 1KLMA 5ETKA 3A8KA 3TWZA 1DZ5A 2UUAJ 4N41A 1YZ6A 2RILA 1Z1ZA 4NCGA 3DOLB 3DRSB 2WBRA 3FDSA 3KG4A 4QWBA 3C16B 3JAMY 4U7CA 1IBMF 2U1AA 4ANDA 2IDEA 1HNZJ 4NYZA 3EE3A 1VQ9S 1MNEA 2RU9A 1TKZA 4KGXB 4QZVB 2WOMB 4WYWA 3DLLQ 1XEZA 4WK1A 5HI7A 4B9TA 3V4MA 4ECSA 5KG2A 3SYZA 8ATCB 5LJ3Y 4GRSA 4MFBB 1S9EB 2Z2MA 3BR8A 3JXOA 2GZOA 2CRLA 4M5DA 2CJBA 4RUBA 1WC3A 2LLZA 1RHMB 3HSJA 1TL3A 3JTPA 3H25A 1RP5A 3QJPA 4IO9Q 2EG1A 2NUUG 4ZITA 1FD2A 2DNRA 5L9NA 2XS5A 5K4PA 4M8LA 2JL9A 1RT1B 5K8MA 2ZH7A 1SJRA 3RB4A 4QU7A 2N7YA 1O0PA 1VISA 2PFDA 3TOQA 2R7SA 1S1VB 1VK8A 1Y6VA 5KOXA 1JLQB 1F2GA 5F8MA 4RW9B 3QO9A 5FDLA 5KFTA 2EC2A 5BYSA 2FYXA 3A13A 9ATCB 1GT8A 2O3DA 3I0RB 1B70B 4JB8B 2GQ2A 5K20B 3PW0A 2IJFA 2RH3A 1VOMA 4QIFA 2D9PA 1NDCA 2VQFF 1LFWA 4PR6A 2JZ5A 4LRBA 4KJGA 2QA2A 4CTAA 5H1SV 3HT3A 3MUVP 1SQGA 1RTHA 4Y2CA 1RT3B 1RTHB 3B54A 4N76A 1WORA 2HBQB 2HSEB 2W2QP 2F5GA 1RGVA 4CT8A 1XNRJ 2CQDA 2P2CB 3U1NA 1B7FA 3PFEA 3VCDA 5KG7A 1X4FA 4YB7A 4QAXA 1S4FA 4QCLA 2CQIA 3M2UA 4Y65A 3NWGA 3MFHA 1ZZNA 4MY4A 1REVB 3R6LB 1L3UA 1DTQB 2RDIA 4B3RF 4DX8H 3AY0A 1Q81T 4LFBJ 4LBIA 2CDQA 4KHMA 4EI2A 5KT5A 5T14A 1NHKL 1RKIA 1EQMA 1RT6B 2CDRB 4KFBB 5J2NA 2B7BB 3SXLA 4WCEQ 2JLEA 3RZAA 2VJUA 1VQPS 1JLFA 2V8HA 5GAGU 4EU0A 3BJYA 4AXJA 4DL2A 2F4VJ 4ERDA 3BN7A 4UOOA 4OYAA 2DRAA 1HDHA 3MWBA 5AXKA 4U67Q 3THVA 3PM9A 1YITS 3TR5A 1L5UA 1S77D 4ILLA 1BMQB 2GHVC 3HM9A 1WUUA 1GTHA 4F3MA 2C2ZB 1IR0A 2H4WB 2X51A 2XZTB 5ETTA 3LWMA 1S9EA 4M5DB 1NH8A 3MMCA 2GX8A 1VQLS 4KPCA 2W9CA 3ETMA 1LK7A 4KB7A 1VS3A 2XSJB 2KH9A 1OYDA 4P2XA 4RW7A 4ES3A 2H54B 1JNRB 5DQHA 1R8PA 3G87A 4NLWA 4PUOA 3KLEA 3FEXB 5CD4H 3MAAB 3MUMP 3PW5A 1YBTA 2V8DA 4KPYA 2ZDOA 4JI6J 4YS2A 1NJYA 3CF5Q 5GADI 2DR9A 2E7WA 3DI6A 3IWLA 1TTHB 1X5SA 2J8AA 4C11B 1HMVB 2KXHA 5A2QU 2VKRA 5K8OA 1SB6A 1TUGB 3J7YU 3KLGB 2LCWA 1TK0A 1RADB 1JXEA 4Z7YA 2LYVA 4R5PB 1TKDA 2VPYB 3IP0A 2M52A 2EBGA 2YNFA 3T6BA 5LSRA 4AL6A 3RRHA 3C46A 2YPZA 2MKYA 3MM6A 1U25A 2CVIA 3LGMA 4B3SJ 4CDIA 3GYGA 3MR6A 2ZD1A 1KH7A 1X4BA 2ZD1B 4RUCA 1WTBA 1NM2A 1DJ0A 2HS4A 4B9VA 4RPFA 1SQFA 3KMSA 3KLIB 3CD6S 4DFJA 5KFXA 2V6AA 2VOPA 2BJ7A 3HSGA 2D74B 2Z30B 4DQQA 1FKOB 3D67A 3ENWA 2PMZD 2BANA 3IR6B 4OYXA 3TAMB 3UD5A 3RYLA 4ZLJA 3M9OB 2J6TA 4H54A 3E01A 3M6UA 2XSFA 4USUA 5J2MA 5FLXU 4DR2F 3TW0A 2MHNA 3CCVS 2CIMA 2DR8A 5IZHA 1R8AA 2RAQA 5IFMA 2RUGA 3D0HE 2OPRB 3QFWA 4KAYA 3GSIA 3MTKA 4JV2A 2DNNA 1MLAA 2C2MB 2Y0SD 4NLXA 4LF5F 3MMCB 4I68A 4MIWA 2GA7A 2OUGA 2EFQA 2Z2YB 3RAMA 2VG6A 2BJ3A 2HNYA 4ZVRB 3D1OA 1B3TA 2FY8A 1RU1A 3KWMA 3X1LB 5LIAA 5E3AA 1JJ4A 3K5PA 4QPTA 4K7QA 3K5NA 3NNHA 3MEDB 2CPYA 1DTTB 1IKVB 1RT5B 2FGCA 3FSYA 1T9WA 1ZH5A 2RUSA 4FKXA 3KK3A 2YPYA 3TAMA 4CLUA 1S9GB 4KFBA 4NA3A 1E3CP 3G8SA 5DQIA 4ZGAA 1KHVA 1DQ9A 1KTQA 3CE8A 1RT7A 1E2SP 4B17A 2W01A 1DQ8A 4H4OB 1FJGF 4XO0A 2MDAA 2PEBA 2GQQA 1U1LA 3I4PA 2ZJQQ 1BUXA 2FGOA 1B0TA 3SIPB 3V4IB 2JEFA 3GFYA 1N5YA 4JI4F 1TVRA 4M1KA 5KFUA 3W2VA 2CA9A 2C2DA 3CC4S 1VHFA 4FYDA 2E66A 3HX9A 4MK7A 3SCKE 2YWGA 2W9CB 2HIYA 1RSCA 1TL3B 2N3LA 2K3IA 2QJ3A 4HT7A 3FRYA 1KQSR 3Q86A 2UXBJ 3I5AA 4O3QA 3IGZB 2B4PA 4EUVA 1OQ3A 2NR0A 4DPOA 3MCMA 2L08A 2HURA 1PSDA 1DQAA 1IXKA 1VBYA 1FTCA 5EX0A 4RW9A 1RBAA 5CCMA 3TANA 1EJJA 4UPLA 4M5LA 2OPPB 1JXLA 1QM9A 1VQ8S 1SH0A 1BQXA 2ZUGA 3QQCD 3LF0A 5D4OA 3OVBA 4F02A 1NPRA 2UU9J 2KZMA 1URAA 5D0HA 2W5SA 1E6VB 2WB4A 4H4MA 3Q8QB 1WSVA 5L1JA 3R27A 1OPZA 4BS2A 4PG4A 4A8MP 5CYMB 1S1TA 4DV0F 1N2LA 5A76A 2IM0A 1H74A 2OFGX 1CS4B 1N32F 4NL5A 1N8RT 1SL0A 1REGX 2YX4A 3PG9A 4O3NA 4K4TA 1VQMS 5KG3A 4DFKA 3K58A 1FFSB 1RTJA 2KXFA 4F3OA 3LP1B 4X66J 5HQLA 1T9UA 2YKNA 2MEWA 4CLFA 1DTQA 2OSQA 1NDLA 1R8BA 3KJVB 4IRKA 4KKOB 1EKRA 3ZZPA 4KKOA 2DNQA 2YNGA 2MKSA 4MKYA 4LBPA 3LALA 3ENAA 4J91A 2YWKA 4P52A 1FRIA 2ZC4A 4EK2A 4ZCMA 4DR3J 4AFFA 2I0XA 3CO9A 1K0VA 4KGVB 5JVGQ 5DO2A 4ZKAA 1Y7PA 2B9XA 2MY8A 3GJSB 4LBHA 5F0UA 3O44A 3RBZA 4ETXA 2DH7A 3LWLA 4AL5A 5HVHA 4ETZA 5DJBA 2PDAA 2MXYA 3BDEA 5D15A 1KD1T 2DGSA 4KGKA 4WXOA 1NHVA 2FLOA 5KG0A 1DAXA 4QR1A 2EBEA 3N5BA 4RW7B 4F26A 4ED8A 2B5JB 1IBCB 2DD8S 3NEKA 4Q0BA 1EQJA 1K1QA 3GSDA 1HIYA 2DJWA 2FTRA 4QR2A 1FVQA 2IHR1 4FN5A 2WK4A 4C8NA 2UVUA 4U95A 4R25A 2N4DA 3UVJA 5LXYA 2J7WA 2Q43A 5LMUJ 3CCQS 1X0PA 3M2VB 2WTFA 1S97A 5E2QA 1UFLA 3MECB 1CJVB 1KLMB 3CO0P 3WDOA 1RWVB 4QWEA 2VH7A 4DBQA 5L1KA 3ISZA 2UZAA 1TL7B 3KLVA 4CXKA 4RW6B 1V6HA 2G1HA 2YKQA 2LXIA 2V94A 4HL9A 5RUBA 3NKPA 2MHEA 1FFGB 4U8YA 3F73A 2IJRA 1RI7A 2G2OA 2RMLA 3ZC4A 1T9XA 4FNHA 3GIKA 3MTJA 4J9NA 3NAIA 1NSPA 4DFPA 5F3TA 5IM0A 5B0BA 2PA3A 3TVZA 1NK5A 1VFJA 1A0OB 1OS5A 3QGGA 4DQRA 4I0WA 3CUNA 4OHZA 3UCGA 2AGOA 4OI2A 1KVIA 4I4BA 2I6WA 4P72A 3ZTSA 3M9NB 4DL0C 4OYPA 1P9QC 4TYAA 2FPHX 5JUMA 1I94F 1SKWA 2MZ1A 3PEHA
chains in the Genus database with same CATH topology
1ANJA 1E2SP 1ZEBA 1ANIA 3M7VA 3BDHA 5LRNA 4LREA 5INHA 5TJ3A 4CXUA 4LRCA 5EGHA 3TG0A 1E3CP 4LRBA 4KJGA 1Y7AA 3Q3QA 3WBHA 3MK1A 4UOPA 5DLWA 4ZG7A 1KHNA 3UN5A 1O98A 1E33P 2W8SA 1ED9A 3M8ZA 5IJSA 1KH4A 3IGZB 5GRRA 4QAXA 1URBA 5L0EA 1AJDA 2W5VA 4MY4A 4UPKA 1ALJA 3NKNA 1ALHA 1EJJA 5L0KA 1EW8A 5LQQA 3BDGB 4CYSA 4UPLA 3T00A 2RH6A 4CXSA 3A52A 2D1GA 2W5SA 4UPHA 1HQAA 2W5QA 3CMRA 5DLVA 1P49A 1URAA 4UOOA 1HDHA 4GTWA 3OT9A 1N2LA 3NKOA 1KHLA 3UNYA 4LR7A 4FDIA 1ELXA 1B8JA 1O99A 4LRFA 4CYRA 1EW2A 2GSOA 2IUCB 3NKMA 4KAVA 4UORA 3M8YA 1HJKA 1ALIA 3BDGA 1KHKA 2W5TA 3WAYA 1KH9A 4B56A 3DYCA 4TN0A 3M8WA 1ALKA 4KJDA 4LRDA 3UN3A 5HRTA 4N7TA 1EI6A 1ELYA 1AUKA 4LR2A 5DLTA 2XRGA 3DPCA 2VQRA 3NKRA 3TX0A 1ZEDA 4MHXA 2GA3A 4GTXA 2W5XA 1KH7A 3MK2A 3IDDA 2ZKTA 3MK0A 1ED8A 1EQJA 1EW9A 3BDFA 1ELZA 4GTZA 1AJBA 3UO0A 1SHQA 4UPIA 4LR9A 1N2KA 5KXAA 5L0BA 1KH5A 1ZEFA 3UN2A 3T02A 3WAXA 4ZG6A 5LRMA 4FDJA 5AJ9A 3NKQA 5GOVA 2XR9A 1SHNA 2GLQA 4LR8A 4LRAA 4YR1A 3LXQA 3TWZA 3SZZA 4ZG9A 2ANHA 4CXKA 4KAYA 2G9YA 1K7HA 3NKPA 3NVLA 4NWJA 4LQYA 3WAWA 2W5WA 2W5RA 2W8DA 4GTYA 1KHJA 2GSUA 2IUCA 1E1ZP 3T01A 3KD8A 3E2DA 3IGYB 3ED4A 3SZYA 3B5QA 2QZUA 4MIVA 5C66A 5LIAA 4NWXA 2X98A 1AJAA 5EGEA 5K4PA 1AJCA 5IJQA 3WAVA 4KM4A 4ZGAA 1Y6VA 2GSNA 1FSUA 2IFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ANJ A;  1E2S P;  1ZEB A;  1ANI A;  3M7V A;  3BDH A;  5LRN A;  4LRE A;  5INH A;  5TJ3 A;  4CXU A;  4LRC A;  5EGH A;  3TG0 A;  1E3C P;  4LRB A;  4KJG A;  1Y7A A;  3Q3Q A;  3WBH A;  3MK1 A;  4UOP A;  5DLW A;  4ZG7 A;  1KHN A;  3UN5 A;  1O98 A;  1E33 P;  2W8S A;  1ED9 A;  3M8Z A;  5IJS A;  1KH4 A;  3IGZ B;  5GRR A;  4QAX A;  1URB A;  5L0E A;  1AJD A;  2W5V A;  4MY4 A;  4UPK A;  1ALJ A;  3NKN A;  1ALH A;  1EJJ A;  5L0K A;  1EW8 A;  5LQQ A;  3BDG B;  4CYS A;  4UPL A;  3T00 A;  2RH6 A;  4CXS A;  3A52 A;  2D1G A;  2W5S A;  4UPH A;  1HQA A;  2W5Q A;  3CMR A;  5DLV A;  1P49 A;  1URA A;  4UOO A;  1HDH A;  4GTW A;  3OT9 A;  1N2L A;  3NKO A;  1KHL A;  3UNY A;  4LR7 A;  4FDI A;  1ELX A;  1B8J A;  1O99 A;  4LRF A;  4CYR A;  1EW2 A;  2GSO A;  2IUC B;  3NKM A;  4KAV A;  4UOR A;  3M8Y A;  1HJK A;  1ALI A;  3BDG A;  1KHK A;  2W5T A;  3WAY A;  1KH9 A;  4B56 A;  3DYC A;  4TN0 A;  3M8W A;  1ALK A;  4KJD A;  4LRD A;  3UN3 A;  5HRT A;  4N7T A;  1EI6 A;  1ELY A;  1AUK A;  4LR2 A;  5DLT A;  2XRG A;  3DPC A;  2VQR A;  3NKR A;  3TX0 A;  1ZED A;  4MHX A;  2GA3 A;  4GTX A;  2W5X A;  1KH7 A;  3MK2 A;  3IDD A;  2ZKT A;  3MK0 A;  1ED8 A;  1EQJ A;  1EW9 A;  3BDF A;  1ELZ A;  4GTZ A;  1AJB A;  3UO0 A;  1SHQ A;  4UPI A;  4LR9 A;  1N2K A;  5KXA A;  5L0B A;  1KH5 A;  1ZEF A;  3UN2 A;  3T02 A;  3WAX A;  4ZG6 A;  5LRM A;  4FDJ A;  5AJ9 A;  3NKQ A;  5GOV A;  2XR9 A;  1SHN A;  2GLQ A;  4LR8 A;  4LRA A;  4YR1 A;  3LXQ A;  3TWZ A;  3SZZ A;  4ZG9 A;  2ANH A;  4CXK A;  4KAY A;  2G9Y A;  1K7H A;  3NKP A;  3NVL A;  4NWJ A;  4LQY A;  3WAW A;  2W5W A;  2W5R A;  2W8D A;  4GTY A;  1KHJ A;  2GSU A;  2IUC A;  1E1Z P;  3T01 A;  3KD8 A;  3E2D A;  3IGY B;  3ED4 A;  3SZY A;  3B5Q A;  2QZU A;  4MIV A;  5C66 A;  5LIA A;  4NWX A;  2X98 A;  1AJA A;  5EGE A;  5K4P A;  1AJC A;  5IJQ A;  3WAV A;  4KM4 A;  4ZGA A;  1Y6V A;  2GSN A;  1FSU A;  2IFY A; 
#chains in the Genus database with same CATH topology
 4USH A;  4USK A;  1ULR A;  2NSB A;  5K14 B;  2BVZ A;  4DUZ J;  2NS1 B;  4KO0 B;  4NLU A;  5A6P A;  3NKR A;  2I1R A;  1U0S A;  1YIJ S;  1SQE A;  1N0V C;  4IOA Q;  1U26 A;  4KAI A;  1LWE B;  3MPY A;  3GV7 B;  4KV8 A;  2I2Y A;  5KT7 A;  3MEG A;  2X1B A;  4U6P A;  2GQC A;  3SV4 A;  4FF2 A;  1T9T A;  3HXM A;  3DOM B;  4LF2 A;  4HH1 A;  3KK2 A;  3R1L A;  3DOM A;  1X5T A;  2HHH F;  5A8R B;  4KC5 A;  1GEH A;  2CJA A;  3BGR B;  2QL5 B;  1NLK L;  2ILY A;  4DPX A;  4ITS A;  4HAC B;  2BBE A;  7FD1 A;  2IMW P;  4NXN F;  1URB A;  2WRM A;  3Q8R B;  1NKE A;  1S6U A;  2ZNZ A;  3DLE A;  4GO5 X;  1CJV A;  2PGC A;  3IWN C;  1AW0 A;  2W5V A;  1C4C A;  4C3M A;  4J9O A;  4IR1 A;  1EW8 A;  2MQL A;  4CYS A;  3T1H J;  1QD1 A;  4KH1 B;  3LUY A;  5ETV A;  1BQM B;  2CQG A;  2FJB B;  2V0N A;  5H9F J;  1BQM A;  1H2T Z;  3AT1 B;  2B51 A;  2MST A;  2Y0B B;  2MKK A;  5DDP C;  1J27 A;  3K5L A;  1S6P B;  5DLV A;  3W2W B;  5ETO A;  1GFW B;  4LF7 J;  2XBP A;  3I82 A;  4KR0 B;  1VYA A;  2M8H A;  1RCO B;  1TR0 A;  4ED1 A;  1OSC A;  5ETR A;  2EG2 A;  4B3M J;  1URN A;  1T3O A;  2QTW A;  5IM0 B;  2EFO A;  2C2N A;  1U1Q A;  1RTZ A;  2DY9 A;  2EC0 A;  1G2E A;  5ADZ A;  3KK2 B;  4NXN J;  2XQC A;  4TQR A;  2WBM A;  3PW4 A;  3PV8 A;  1VQ5 S;  2XO6 A;  3RJM B;  3CIZ A;  4ES2 A;  1XNR F;  1LXJ A;  4E2F B;  1LQ9 A;  3TA2 A;  3OXL A;  4FXW A;  3HHL B;  1KP6 A;  1LKZ A;  4OIX A;  1DHM A;  2O1P A;  2DNP A;  3MEC A;  2ATC B;  1FK9 A;  2CVE A;  5K14 A;  4DU7 A;  3J7Y I;  2MZT A;  3CCW A;  4O0N A;  1N88 A;  1C0T A;  2NYI A;  2VG7 A;  4NCG B;  1U2R A;  2R2T A;  2EKN A;  4F36 A;  2FZC B;  3IS9 B;  4N47 A;  3KLF B;  4C0O C;  2GHP A;  6AT1 B;  2GA3 A;  2Y1I A;  4AYB D;  3HCX A;  4DV3 F;  3AFG A;  3C6U B;  3KNG A;  3DXB A;  1N33 J;  2YY3 A;  2EI5 A;  3MM5 A;  2MYF A;  4DSJ A;  3TAP A;  1R7I A;  3ET6 A;  3GMG A;  2OEL A;  2UUC F;  1YWX A;  1AUD A;  2HFU A;  3SSQ A;  1SHQ A;  4DSK A;  5HP1 A;  4LR9 A;  1XC9 A;  1PJ7 A;  1ZEF A;  2HND B;  2A18 A;  3I87 A;  1TQL A;  4I1T A;  2J0S D;  2G9Y A;  4O4R A;  5KFW A;  1PAU B;  4ZVG A;  4UZB A;  2HYI B;  1X4D A;  2BKO A;  5LT5 A;  2ZBP A;  4UUW A;  2XI3 A;  2JWN A;  3I32 A;  2ZH5 A;  4NLG A;  2M2B A;  1T3N A;  3TZZ A;  2XS7 A;  4C8L A;  4FF3 A;  4J9S A;  2MJN A;  5D3G B;  3OV7 A;  1JLC B;  2J7U A;  1UVI A;  2LMI A;  3OUY B;  1VLO A;  1Y00 A;  2V2K A;  1QE1 B;  3R9L A;  1N32 J;  5FLX Y;  2UU9 F;  1UJ4 A;  2GHW A;  4JYA J;  1PCA A;  3VZI A;  1E1Z P;  2XLK A;  3UR0 A;  2CPI A;  2IM2 A;  4IG0 B;  5CYQ A;  1HR0 J;  4OHV A;  4UT4 A;  1CS4 A;  4OYI A;  3BN4 A;  4O4G B;  3IGY B;  3F44 A;  4PQA A;  1IJE B;  1NK4 A;  5KOW A;  5L1I A;  1RWW B;  2CZ9 A;  3AB2 B;  2JDJ A;  3EXC X;  2HHV A;  4URS A;  1CC8 A;  1Q7L B;  4NLV A;  4ZHR A;  1KON A;  3FUY A;  2CWX A;  4K59 A;  2JC0 A;  3BBF A;  1VLY A;  2DTJ A;  3LAN A;  1TL5 A;  1HNZ F;  2FVP A;  1YG0 A;  1F3V A;  1MWZ A;  1RT6 A;  1ZBT A;  4LSZ B;  4WWS A;  2G4B A;  1UEU A;  2E5H A;  3MMB B;  3BKF A;  2VQF J;  5HAO A;  1RBO B;  1QDU B;  3QZ7 A;  4ID8 A;  3CT9 A;  4USV A;  2VU5 A;  1RYR A;  2QSW A;  2NLW A;  4NEZ A;  3QJJ A;  4GKJ F;  5INH A;  3QID A;  4WZQ A;  1CJT A;  1OWX A;  1WKJ A;  3C6U A;  5J1E A;  3SCJ E;  5HJX A;  3EGV A;  2SXL A;  2YKM B;  3JQK A;  2B43 A;  4OZJ A;  2XY5 A;  2XYG B;  3LPE A;  1WEZ A;  2RIJ A;  2RRA A;  4J37 A;  3NLC A;  3OXG A;  5A6W A;  1I3O B;  2DT9 A;  2HWT A;  3EZU A;  3JS9 A;  4ENO A;  5KFB A;  4K50 A;  2VB6 A;  2PO4 A;  3NAH A;  3QPI A;  4ZA1 A;  2R8H A;  4A47 A;  5KFD A;  3ISN C;  1Q16 B;  2HWI A;  4LFC F;  2UXC F;  3CJ2 A;  3BDG B;  1UVJ A;  3DOK B;  3G82 A;  1BLU A;  3VAF A;  5DS7 A;  3V6K A;  4MYU A;  3M9M B;  3TAQ A;  3C19 A;  1WF2 A;  2AF6 A;  3ZTO A;  5E33 A;  4K4V A;  2VUG A;  4H4K C;  4OZ3 A;  4ZCK A;  3ELH A;  3ZZR A;  3NGK A;  5KAK A;  3MDF A;  3K59 A;  5GAE I;  4ZP8 A;  4WP3 A;  2AIR B;  1V3Z A;  1KHL A;  2Z0G A;  1UW4 A;  5B0E A;  1YX2 A;  3P49 B;  2AWZ A;  1R89 A;  2DIV A;  5I3U A;  4CQ1 A;  5KG6 A;  3PO5 A;  5F8H A;  1LFP A;  2PII A;  2X3D A;  3H20 A;  2RKI B;  3VQS A;  3H5S A;  2GSO A;  3N0V A;  2GML A;  1I51 B;  1RTI B;  1C1C A;  1A7G E;  2QIF A;  4L73 A;  3LP1 A;  4JI7 F;  3QMQ A;  2XR9 A;  2VAS A;  4WKR A;  4ZJQ A;  3P5T L;  3AQO A;  1HNV A;  2OEK A;  4I64 A;  4TLR A;  3D3B J;  2R2S A;  3GYX B;  4WKY A;  3JB9 k;  3ZO7 A;  3K7R A;  4DV1 J;  2WCX A;  2G1D A;  3KJQ B;  3OR1 A;  4H4O A;  3W60 A;  3K0J A;  3FNN A;  2FHK A;  4GO7 X;  4KJD A;  3G8Q A;  2ZKU A;  2MLZ A;  1WI8 A;  5F3Z A;  1CJU A;  3V81 B;  3SI8 A;  2NXN A;  4UY8 T;  4G1Q B;  4B3T F;  1P1L A;  2OMO A;  2UUT A;  3DDI A;  3SEO A;  2HAI A;  5D0E A;  2VQE F;  3KTQ A;  1I5O B;  2GVD A;  2Q6C A;  2V69 A;  4OJG A;  3HHD A;  2OHD A;  2BM0 A;  4DZ6 A;  5A8K A;  1FDN A;  3N6L A;  1CJK B;  2AZ3 A;  2NZC A;  2NRE A;  2HZA A;  4N77 A;  4UQT A;  2B4U A;  2YNH A;  5B7W A;  2KTQ A;  3UNG C;  2CWK A;  4N8N A;  5GME A;  1N2K A;  4ECY A;  2H5E A;  3UN2 A;  3T02 A;  1IWG A;  1M5S A;  2BEF A;  2WSC C;  3I9V 9;  2YX1 A;  1C0U B;  1RAO A;  1ZA1 B;  2OSR A;  3N6M A;  1RHU B;  5DDO C;  1TL7 A;  3SZ2 A;  2M8D B;  1NEE A;  2W8L A;  1KRP A;  1PGZ A;  1HL6 A;  1T9V A;  3PNI A;  2GV1 A;  3QWP A;  1X4H A;  3PRD A;  5HRO B;  3K8W A;  1G3O A;  5KG1 A;  1EAY C;  1RAF B;  3AB4 B;  4EYH B;  2LQ8 A;  2YQ3 A;  3MAQ A;  3UCZ P;  5B0D A;  4ELU A;  4O44 B;  3I5B A;  5EN1 A;  2EFN A;  2WSE C;  2YKM A;  3AD7 C;  1HI0 P;  1RWM B;  1JWW A;  3KLI A;  1SJ3 P;  5K8P A;  2HBR B;  2E5L J;  3KD8 A;  2VHG A;  1MSW D;  1LWF A;  5J2P B;  4PWD B;  3B5Q A;  4V19 X;  2KG1 A;  4D3G A;  5BXI A;  3FBE A;  2XC9 A;  1U0H A;  2V67 A;  2IIH A;  1JLA B;  1U0H B;  1ZOT A;  3AH6 A;  3LA0 A;  4TY9 A;  2KG0 A;  3CJ8 A;  1VC6 A;  2DO0 A;  1F9H A;  4C0H A;  1D09 B;  3T5H A;  2LXU A;  2OFH X;  4NLO A;  5IJQ A;  1KQK A;  1Y4Z B;  3Q8S B;  4DV6 F;  4EMD A;  3Q8P B;  2BKN A;  1O6X A;  1VHI A;  2DYA A;  2VBY A;  2EWH A;  1D9A A;  3S7R A;  4HHU A;  3TVK A;  1JQG A;  1FVS A;  4O3S A;  5HVG A;  3MGJ A;  1WOP A;  1S1U B;  3MEG B;  2D3Z A;  3KDN A;  2ILZ A;  5ETL A;  5BYQ A;  2MKC A;  4I56 A;  4J9P A;  2OI2 A;  4LFB F;  1HHS A;  4DV5 J;  3TG0 A;  1S72 S;  4BCA A;  3FCW A;  2VV5 A;  4NZ6 A;  3D6H B;  3K89 A;  2ASD A;  1S0N A;  2UUA F;  3I6P A;  2RF2 A;  2GCF A;  3AQP A;  3MM8 B;  3HHK A;  2VOD A;  4ZJL A;  4Z2X A;  1CVJ A;  2DHH A;  2AJF E;  2GJ2 A;  3NS7 B;  2CQB A;  5E3Q A;  5KFL A;  4BC7 A;  1IKY B;  3HJV A;  1WC5 A;  3CTR A;  2F8E X;  1ICE B;  4IH5 A;  1SC6 A;  3VWS A;  1GMV A;  2HWH A;  2QV6 A;  3MM7 B;  4Q7A A;  4DZD A;  2KFN A;  1O51 A;  2P6S A;  1JLA A;  1ALH A;  4Y0F A;  3F41 A;  3I55 S;  1S0O A;  2BE2 B;  1R31 A;  3D28 A;  3JSB A;  2BE9 B;  5F0W A;  3M8S A;  1IBK F;  4ZLL A;  1DFD A;  3EJM A;  2QG9 B;  1S1W A;  2CG4 A;  3BQ0 A;  4DV2 J;  2HRY A;  5H9E K;  3MMA A;  3KUG A;  2HHX A;  1P49 A;  1TFW A;  4O44 A;  4C8K A;  3DGP A;  3CC7 S;  3M30 A;  4RNH A;  4CT9 A;  1SL1 A;  1G1X A;  1RWO B;  3D7S B;  1TEL A;  4YDX A;  3UNY A;  1I6J A;  2E29 A;  1WOO A;  4NE9 C;  4O3P A;  4OV6 A;  5JMN A;  4ZVO B;  4ZVS B;  1KN6 A;  4R8U A;  3Q22 A;  4IG0 A;  3CDU A;  3BM7 A;  5CYQ B;  1X5O A;  3I4H X;  3B78 A;  2BV3 A;  5T41 A;  1S6O A;  3B8H A;  1MRO B;  5G0R B;  2B9Y A;  1MN7 A;  4P2F A;  1ZTW A;  4Q2L A;  5F8L A;  1P6T A;  3WBZ A;  4N5S A;  4DF8 A;  4F50 A;  4YEA A;  1QY7 A;  5KFN A;  3AA9 A;  2AP6 A;  3WAY A;  1S12 A;  4ZCL A;  2MQP A;  3IBC B;  2XO7 A;  2L3M A;  5LMN J;  2FVR A;  3W8G A;  1FKP A;  3QWU A;  3W5Y A;  2R2R A;  4LF5 J;  3WZ0 A;  2FHJ A;  4LR2 A;  1QUP A;  3CJ0 A;  4IYQ A;  4DR4 J;  2XRG A;  3IG1 A;  3QAT A;  2CJX B;  2DNY A;  3QLH A;  3GII A;  2VQR A;  5B0F A;  2PA8 D;  3W1Y C;  6FDR A;  4HVZ A;  1H2U X;  5L39 A;  4DR6 J;  1DBD A;  4W90 B;  5D4P A;  4U9R A;  4BWJ A;  2IFX A;  5KT2 A;  2XCP A;  1SIW B;  3K57 A;  1GNK A;  1ZYQ A;  3BDF A;  2Q1L A;  3OL7 A;  3PZP A;  3CD7 A;  5D78 A;  2NXC A;  4ILM A;  3PYG A;  2IVM A;  2DNG A;  2LQB A;  2HQF A;  2PC6 A;  2QL7 B;  2YWW A;  3FBB A;  1GMW D;  1SXL A;  1RHQ B;  1XWL A;  2ZWP A;  3NRB A;  3WX8 A;  2WVB A;  3H4B A;  5LMN F;  3QGI A;  4DR4 F;  5KFR A;  3OR1 B;  3W63 A;  2YQ0 A;  4G1P A;  2ASL A;  2CJY B;  1NZA A;  4Y2M A;  5EWE A;  4UUX A;  3B6B A;  4DX5 A;  2P5V A;  3KOA A;  1YJT A;  4L74 A;  3UW1 A;  4P7V A;  3POT B;  4B08 A;  4OLO A;  3H40 A;  2XUL A;  4DX7 A;  3BQ1 A;  2V63 A;  2LA6 A;  2HLT A;  1GQE A;  2ZOM A;  1LNQ A;  1TAU A;  2G13 A;  2J6S A;  2YWE A;  3GLJ A;  1FRX A;  3S1T A;  1SJ1 A;  4URQ U;  3GIL A;  1ZAV A;  2UV8 G;  4ZHR B;  1RT2 A;  2CJQ A;  4DSI A;  3BKU A;  4MKA A;  4QPX A;  1RAC B;  4NA2 A;  2HHS A;  1NDK A;  4WFB Q;  4DQP A;  2NPF A;  1VDH A;  4TN2 A;  2X1F A;  1HNW J;  2B56 A;  2VIH A;  3A8I A;  4NWB A;  3TUJ C;  3KHR A;  4DV2 F;  2DHS A;  1K8A T;  3NCR A;  4XDC A;  2R7R A;  4RZR A;  4TU9 A;  4PWU A;  3OTO J;  2GAG C;  2GJI A;  3QYY A;  3HD2 A;  3GIM A;  1D9D A;  3NS5 A;  4LRE A;  1EAR A;  4C48 A;  3BSA A;  1RK8 A;  3K5M A;  5EGH A;  3W65 A;  4DCJ B;  2ACM A;  4FDF A;  2E5J A;  4M5G A;  5IT4 A;  1CEZ A;  4TVA B;  3PIO Q;  4ZP7 A;  2UXD J;  1UZD A;  4UOP A;  3I96 A;  3CPW R;  1WHW A;  2VF3 A;  4UOH A;  3ILO A;  3M32 B;  3VAL A;  4IDK B;  2APO A;  5GRR A;  4EBE A;  2V8V A;  4AXI A;  1FA0 A;  4ZOS A;  3UD3 P;  4FP9 A;  5HLF B;  5IWA J;  3NKN A;  2ZEJ A;  2BQ3 A;  2AYE A;  2JH3 A;  2EXU A;  3OSP A;  3G86 A;  4Q45 A;  5KFE A;  4DV7 J;  4DL7 A;  1GH8 A;  2GS8 A;  3TJ9 A;  2NYH A;  3T00 A;  3IXQ A;  3US5 A;  4KBI A;  4B9N A;  1S7I A;  1L3V A;  3AJ2 A;  1OY9 A;  3MI7 X;  1RAG B;  3OFH A;  4I7F B;  3TNV A;  5M2P A;  3ZXW A;  4DLG A;  5HSP A;  4OI3 A;  2E5L F;  2MQO A;  1FNM A;  2E7X A;  1TUW A;  1TMM A;  1HWU A;  4U8V A;  4X4R A;  3H4D A;  2JEJ A;  2C2K B;  2DNH A;  3G8T A;  2OIH A;  1SVD A;  2AGP A;  2GC8 A;  2DGT A;  4FYV B;  3UDE A;  3JSM A;  3CSK A;  2HRU A;  4EZ6 A;  2AJ4 A;  1Q82 T;  5I4M A;  4X64 J;  1H73 A;  2OD4 A;  3SSS A;  1SIZ A;  4M95 A;  3M4X A;  4CLP A;  1RBL A;  4CH7 A;  2LA4 A;  3JQM A;  4HH0 A;  4Y2A A;  1DUR A;  1GXU A;  2LU2 A;  2QLF B;  2AJ1 A;  4N8O A;  2VA3 A;  5I3Q A;  3LQV A;  6FD1 A;  2IYI A;  1FES A;  4OZ0 A;  3DRR A;  1R8H A;  4PXD A;  3V6D B;  3SCI E;  3R7S B;  3ILI A;  1IKX B;  5GAE U;  4MMO A;  1IKX A;  4N7T A;  1K47 A;  3ITH B;  1U6Z A;  2AQ4 A;  4DV7 F;  5DLT A;  1YBA A;  1X8D A;  2H48 B;  2CPZ A;  1S6Q A;  3JYT A;  2GVD B;  2RQK A;  7AT1 B;  3GPA A;  2W2M P;  3NOC A;  5L8R C;  2B5J A;  2M3D A;  3CC2 S;  2FVQ A;  2HK2 A;  2QLW A;  3RB3 A;  1IQT A;  1GTE A;  5KT6 A;  2DNK A;  4DJB A;  3R2C J;  1HQU B;  3RUB L;  1ELZ A;  4GTZ A;  3H90 A;  3TVY A;  4P6Q A;  2OGU A;  3W8P A;  4YP3 A;  4KJI A;  2Y3Y A;  4DR6 F;  5E5N A;  3FSI A;  1UJ5 A;  4CLY A;  3HP6 A;  2ROE A;  1HBN A;  1FK9 B;  2MPU A;  3RRK A;  5GOV A;  1U1R A;  3R6G B;  2VZ9 A;  2F65 A;  3DLJ A;  4NRU A;  5CZV A;  3HSD A;  4JV5 J;  1CBK A;  1UL3 A;  3BH7 B;  4ZG9 A;  2VPX B;  3ZZT A;  4DV1 F;  2CFX A;  2HNZ A;  2AU0 A;  1K7H A;  4HI2 A;  3MD1 A;  1VQO S;  4RU2 A;  3DGP B;  4J9R A;  4LQY A;  4ZIW A;  2QN6 B;  5AE1 A;  5J2Q A;  4NWJ A;  2Y1L B;  1KH9 A;  1KHJ A;  3W9J A;  2OH2 A;  1ZM2 A;  4FBU A;  2A0F B;  2UP1 A;  2UVR A;  1WDD A;  4KSE B;  1RDR A;  2Z8Q A;  3FFI B;  2D1C A;  1T95 A;  4X65 J;  3HHN B;  4MIV A;  2FDN A;  1VQN S;  4NWX A;  1Q4R A;  3N6N A;  2BUN A;  4PZV A;  5IV4 A;  2M0G B;  4P2M A;  2ZZM A;  1FER A;  1QVF R;  5IQQ A;  1RYS A;  1T05 B;  3CD0 A;  4C97 A;  4HR2 A;  2FJX A;  3BRE A;  4O0I A;  3IAS 9;  1FWL A;  4ZS6 A;  4TY8 B;  2VPZ B;  1RE1 B;  3KHL A;  4NLD A;  3PX0 A;  1C4A A;  3C15 A;  2VC0 A;  4LSL B;  1YJR A;  1QE1 A;  3H42 A;  5LRN A;  2YTC A;  1NZ8 A;  1VC5 A;  2CPE A;  4NEY A;  1RT4 A;  4OJH A;  2HGM A;  5TJ3 A;  1RWU A;  3UPF A;  3EDR B;  3RRG A;  4B3O A;  1Q8B A;  3MCN A;  4RNF A;  5KFC A;  4NA1 A;  3WBH A;  1FFW B;  3DRX A;  4JI8 J;  2FIU A;  2OLW A;  2JC1 A;  2W8S A;  1YTY A;  1HBO B;  1W2I A;  4ES1 A;  1CQM A;  1KWM A;  1QSY A;  3GE9 A;  1OSD A;  2G2Z A;  3MF5 A;  2GMJ A;  2F8H A;  3HFK A;  3M2R A;  4H4K A;  4Q8F A;  3J7A N;  3M6W A;  3RW6 A;  2FVS A;  2V4J A;  1NSQ A;  4F4K A;  3DRR B;  5L0K A;  3AA8 A;  2E1M C;  5A0Y B;  2MZR A;  3IR7 B;  1YSJ A;  4ICL A;  2R8G A;  1M5K C;  1H3D A;  2WVE A;  1XTZ A;  2GIR A;  4NMX A;  4UW2 A;  5J1P A;  4DU8 A;  1D9F A;  2A1B A;  4QR0 A;  4PYA A;  2E7V A;  3PDN A;  1SUQ B;  1Q53 A;  1RWP B;  4AQY F;  1M5P C;  2FHM A;  1HA1 A;  2GW8 A;  2CAJ A;  1HLW A;  2KKH A;  3PJ9 A;  4ID5 B;  3W5X A;  4TXS A;  1IBK J;  2XMK A;  3SQO P;  2XGP A;  1IBL F;  3DRP A;  3CJ3 A;  2MJU A;  4LIR A;  3H2U B;  3FJ2 A;  2LP4 A;  5CAB A;  2C22 A;  4NCB A;  1HW8 A;  1MG7 A;  1P9Y A;  5T7L A;  3VGS A;  5M2U A;  1RT2 B;  4R0J A;  5CHC B;  2UUC J;  1N56 A;  2QLX A;  3OJS A;  1GK8 A;  2AKW B;  2B3T B;  3U7J A;  4JI5 F;  3EGZ A;  1CLF A;  1FXR A;  2AX1 A;  2K1R A;  2PN6 A;  2POK A;  4K2J A;  5C5J A;  4J9M A;  4FBT A;  3MM9 B;  1KNZ A;  1U02 A;  3MXH P;  1SV5 A;  3TYT A;  1EP4 B;  2CQH A;  2KRB A;  3BGO P;  1KTV A;  1YZ7 A;  1HQE A;  2BYC A;  3DMJ B;  3HKZ D;  2H5I B;  3RBD A;  4Q8E A;  9RUB A;  1RLC L;  1SJQ A;  1UTA A;  3DMJ A;  5GMK a;  2A6O A;  1H38 A;  1HNX J;  2KZZ A;  1ELY A;  2HS3 A;  2Z56 B;  1N5S A;  4X84 A;  3Q24 A;  2LFV A;  1O8B A;  2QA1 A;  2YWF A;  2MKH A;  3BV8 A;  4FYY B;  3GON A;  1GAO A;  3UQS A;  2Z2L A;  4DN0 A;  4ZLN A;  1WD6 A;  4BDP A;  2C1E B;  4C8O A;  4C3L A;  3E2E A;  1GX5 A;  1HFE L;  1TV6 A;  4CO1 A;  8RUC A;  3BR9 A;  3VAK A;  1FKA F;  3MK2 A;  5CD4 A;  4YR2 A;  2ADB A;  3CW2 C;  3OFG A;  5D77 A;  1RCX B;  3ZNU A;  1U4B A;  4FVC A;  4F4Y A;  2FJE B;  1UWB A;  1AJB A;  4WTY A;  1HNV B;  2M4M A;  4V1A k;  1IKW B;  2KVI A;  5L0B A;  1F3F A;  4K8R A;  1YQH A;  2YKN B;  5EDW A;  3C14 A;  4A8Y A;  1HWK A;  1XER A;  3O2I A;  1U48 A;  3C14 B;  3CED A;  1WHV A;  4V19 J;  1SL2 A;  3DRY A;  3NBP A;  4L3K A;  3AHP A;  3W64 A;  1NND A;  1Z4U A;  2ZBR A;  3I31 A;  3CB4 A;  4HI1 A;  3D9B A;  4PG7 A;  5KT3 A;  3T5K A;  1I1G A;  1DRZ A;  2HBY B;  2KI2 A;  2J9C A;  4IFY A;  3PR4 A;  2HZV A;  3PTW A;  1WC4 A;  2AEF A;  2KYX A;  4I6W A;  1U1K A;  4WK3 A;  1N4L A;  3NY0 A;  4QIE A;  1B4S A;  2PSZ A;  2W5W A;  3OJU A;  1SJ4 P;  1KR4 A;  5KTQ A;  4OFZ A;  1PBA A;  1YGY A;  3W3S A;  1WHX A;  3BB5 A;  3HFV A;  3K5O A;  1IKY A;  4X4S A;  2V4Q A;  3W7B A;  3CME S;  2LEA A;  1JLB B;  2MQM A;  2ZOF A;  3GJR B;  2MB0 B;  5C66 A;  2FUG 9;  2B4V A;  4CO0 A;  1AJA A;  1GMW A;  3MED A;  4N56 A;  1ZM9 A;  2PMW A;  1HD1 A;  3MM9 A;  2CQP A;  2NPI A;  3LP2 B;  4Y2K A;  2B0G A;  2UUW A;  3EZO A;  5HMW A;  2AT1 B;  2J76 E;  4TU8 A;  1XR5 A;  2BX6 A;  2GSN A;  2H9Z A;  2OTL S;  4OYB A;  4X2B A;  5CQG A;  1ANI A;  1FI4 A;  4RJV A;  1R0A A;  4RW8 A;  3TJA A;  1Q7Y T;  1FDD A;  1S79 A;  1KSP A;  2JJ4 D;  2KT2 A;  3JYT B;  2AZ1 A;  3HKW A;  2ZH1 A;  2IM1 A;  2DEI A;  4NXM F;  4YFU A;  4ZPT R;  2RQ4 A;  1Y7A A;  2WOM A;  2Z2Z A;  1R6Y A;  2LKZ A;  2IM3 A;  3HT0 A;  4LVN P;  3W2V B;  1JKH B;  3PFO A;  1K1S A;  3L7P A;  3M1V B;  1Q8L A;  1Q95 G;  4OZN A;  5HMX A;  3CCU S;  1LXN A;  1VQK S;  2WHO A;  1FDB A;  3NL0 A;  1NHU A;  4PYD A;  1KH4 A;  5DLG A;  1R0B G;  3B4D A;  1OPI A;  1CUL B;  1KBR A;  3HF5 A;  1NSK L;  1ACM B;  2OD6 A;  1IKV A;  1RT5 A;  2JVO A;  3MOZ A;  4CNY A;  5H9F K;  1KQG B;  5HO4 A;  1EW2 A;  3MMJ A;  1S57 A;  4DUZ F;  4IFY B;  1NK7 A;  2VL1 A;  2WON B;  1WWH A;  4QYR A;  3CJT A;  3OR2 B;  3GG1 A;  3H5Y A;  3CMR A;  1UFW A;  3VVU A;  2VJV A;  2LQJ A;  2A2D A;  1HHQ A;  1HBU B;  1XK8 A;  2BJ1 A;  2F9J A;  2MZJ A;  4OMF G;  4PWW A;  5IQ6 A;  2HQG A;  4WFZ A;  1NPP A;  3GZ7 A;  1J2V A;  4NX9 A;  3DLG B;  4CRJ A;  1ELX A;  4B3S F;  4DQS A;  2HHH J;  3MR3 A;  2JEI A;  5THW A;  4LRF A;  3RBX A;  1O99 A;  2IY5 B;  2ZJP Q;  1RUS A;  4NRT A;  2FLL A;  1FRH A;  3ETO A;  4USI A;  3M8P B;  3U1M A;  5B09 A;  2MGZ B;  2UUB F;  3R3T A;  2B7C B;  4QU6 A;  2AMC B;  4OLP A;  4WYL A;  1X4C A;  4TKT A;  1HNX F;  2BW2 A;  1KHK A;  2GLQ A;  2U2F A;  2X1A A;  3CMA S;  3H2V E;  2W5T A;  2DHG A;  3D68 A;  1MN9 A;  2LEP A;  2DXE A;  3R5C A;  4DFM A;  3M8Q A;  5LM7 E;  3M8W A;  1FNX H;  1ALK A;  1OMS A;  4I2Q B;  3ILL A;  5DQG A;  3MCS A;  4CWB A;  3EGW B;  1JLE B;  1ZET A;  2EVZ A;  3IAM 9;  4F7V A;  3VTI A;  1FD8 A;  4LFC J;  2A10 A;  2HG4 A;  3QSY B;  1S49 A;  3DNC A;  4IFV A;  5HQM A;  1FTR A;  1HI1 A;  2YKA A;  5KFP A;  4PXB A;  2ZH9 A;  2NXJ A;  1IQZ A;  5AT1 B;  1NB7 A;  3DLB A;  4LF9 J;  2HHQ A;  4GTX A;  2DGX A;  3CDE A;  4L6V 3;  1LK5 A;  4KY3 A;  3BBC A;  4CTA B;  1QSL A;  1F0X A;  2ZKT A;  2BR0 A;  3TA0 A;  4CH0 S;  3KXD A;  4F2R A;  1DLO A;  1P27 B;  2HNY B;  1X31 C;  4FNI A;  2ZH8 A;  1K9M T;  2B8Q A;  3DGV A;  4MH8 A;  1NXI A;  1RWN B;  1VQS A;  2OEJ A;  4JV1 A;  2X7I A;  4PEO A;  3CJR A;  4YB6 A;  4C8Z A;  1N33 F;  3MAA A;  3EDQ B;  2JFK A;  3CCJ S;  2V9K A;  3LP2 A;  2D69 A;  1JLQ A;  4ZPA A;  2CG8 A;  5HK4 A;  1SCJ B;  2UVV A;  4DV4 J;  2R7V A;  5A8W B;  3UVJ B;  5K9F A;  3C15 B;  4G3I A;  3N79 A;  4LR8 A;  4CLZ A;  3OR2 A;  4DV0 J;  2ABY A;  4RW4 A;  3IBF B;  1RA7 A;  2PEH A;  1Y10 A;  1F5B A;  1SC4 B;  4L75 A;  3Q23 A;  3L7O A;  3ICL A;  4R0E A;  3CVK A;  4Z37 A;  4ZDN A;  2O67 A;  5DG9 A;  1YI2 S;  4LF4 F;  3OVS A;  2PFF B;  3GG0 A;  5F8G A;  3QIP B;  1FX2 A;  3FFI A;  2VON A;  1IJF B;  3FCV A;  3H0P A;  4AT1 B;  2R9L A;  5B0C A;  3JSY A;  2DEJ A;  4K4Y A;  2DXF A;  3A1Y G;  1UMJ A;  1YJ7 A;  3HLU A;  2V2Q A;  4YB5 A;  1OYE A;  2ZE2 B;  2MSS A;  1H0H B;  5T7L B;  4C3K A;  4DI6 A;  4UOC A;  2QA4 G;  5HLF A;  4LIW A;  3TUZ C;  1Q78 A;  2HHP A;  4LJM A;  3V2U C;  2ZH2 A;  1NKC A;  2G0C A;  5C7P A;  4PQU B;  2FJA B;  3TUI C;  3E8O A;  5LSL A;  4TQS A;  4OL8 A;  1IVZ A;  1EQ0 A;  1HYS A;  3MPU B;  3DM2 A;  1O98 A;  3CJK A;  4ZPC A;  2IVF B;  3PYD A;  4URG A;  2EK1 A;  5ETM A;  3DI6 B;  1HNI A;  2ZM6 J;  1WAC A;  3A3O B;  4USW A;  2KO1 A;  3Q89 A;  4RNN A;  2HLU A;  4CXU A;  4LRC A;  2UV8 A;  3JTO A;  3T6J A;  4YN3 B;  3P8B B;  3HSZ A;  5CZX A;  4W98 A;  4OHW A;  4ZPD A;  1N52 B;  2CNK B;  2C3M A;  1V3S A;  3C66 A;  2DR5 A;  3N5F A;  5F8N A;  4F8R A;  1M0S A;  2CNL B;  1TL1 A;  2RD5 C;  1E33 P;  1ED9 A;  3WC2 A;  1CC7 A;  3GCX P;  3OD2 A;  3FQK A;  2K7J A;  2XLI A;  1LOU A;  2F7V A;  4F0M A;  3MUR P;  1PYT A;  2WW8 A;  1FWP A;  3VAJ A;  3NOG A;  4DS5 A;  1F5C A;  4UPK A;  4X65 F;  2CPF A;  1JJ2 R;  4YME A;  3PX6 A;  5A8W A;  1EZZ B;  1G4C A;  5CA5 A;  3PEJ A;  4A8F A;  3TUP A;  2GGP A;  2HW3 A;  2DGW A;  2XMV A;  1NJZ A;  5I3P A;  1R6V A;  1EX8 A;  2AEJ A;  1FRJ A;  2FHJ D;  3FZ2 A;  2N3O A;  2D1G A;  4WTO B;  3TEG A;  1KLN A;  2W4D A;  2QMX A;  3FKB A;  2W7O A;  2CKW A;  2W5Q A;  4M5M A;  4NXM J;  5HAT A;  1T7P A;  4GTW A;  4OYW A;  2DBB A;  1AT1 B;  2DCL A;  4WU2 A;  4JI6 F;  1F5A A;  1XMQ F;  1X60 A;  1SKR A;  1XR7 A;  1D0E A;  3J81 j;  2MKI A;  4RWW A;  3ZZ0 A;  2GO8 A;  1N5Y B;  1LWE A;  1QLN A;  4FDI A;  2BXJ A;  3THP A;  1SC1 B;  1GX6 A;  3OW2 R;  2ZFH A;  2K8G A;  4LFA J;  2IUC B;  3BF4 A;  3BBB A;  4TYB A;  4ZP9 A;  4KAV A;  2ZE2 A;  4ZK7 M;  4PXE A;  2IAJ A;  3N01 A;  4AUK A;  1KC8 T;  4B9S A;  3VGT A;  3T5J A;  1UVM A;  3E01 B;  3M05 A;  4J90 A;  1VRU B;  4L76 A;  1MMD A;  3DCA A;  4WU3 A;  4DX6 A;  2ADC A;  3HD1 A;  4ECQ A;  5E3R A;  3QZ8 A;  1FJ7 A;  3Q2T C;  4X4T A;  3J7Z 5;  3QO9 B;  5FDL B;  3WIU A;  3OL9 A;  3D2W A;  3R7B B;  4BHQ A;  2H4Y B;  4PAA A;  1RAE B;  2KYZ A;  2HNZ B;  4JOU A;  4Q2M A;  1EJ7 L;  2KVQ E;  2V68 A;  4I69 A;  4XAK A;  5LSO A;  3H2L A;  1K73 T;  1H7W A;  4I6A A;  2KT3 A;  3W9H A;  2YNF B;  2E9T A;  1WG5 A;  2GIF A;  1NBE B;  3TX0 A;  4MHX A;  1HWI A;  2DH8 A;  2QRR A;  3U27 A;  2V4R A;  3LTO A;  2YKO A;  4FYW B;  5HMY A;  1S76 D;  4CZC A;  4DUY F;  2CJK A;  2ROG A;  3R2D J;  4CLL A;  1WEX A;  2DK2 A;  3PW7 A;  1LW2 B;  4A8X A;  3ZNJ 1;  2R7W A;  1UWB B;  5HAN A;  1S0M A;  3GB0 A;  3EGN A;  5HN0 A;  3U1L A;  1QVG R;  2ZWO A;  2DXD A;  5IWA F;  3A3P B;  3TAR A;  4KRW A;  2KDO A;  4E8U A;  1CG2 A;  2V34 A;  3KLE B;  1U45 A;  4CLT A;  1BQN B;  1Q8I A;  2XEX A;  3AJD A;  4QJV A;  4LF1 A;  4XK8 C;  1S99 A;  1KEK A;  3M8Q B;  3PKY A;  3RB6 A;  4OX9 J;  1LWX A;  4ECT A;  3SMZ A;  2HHT A;  2CZV C;  4LQ3 A;  3DM2 B;  2NCK L;  2ZZN A;  1WOS A;  3TZX A;  1S6Q B;  4DN9 A;  5KFM A;  3UDV A;  1RTD B;  1XMO J;  2UXD F;  3SZZ A;  2P8I A;  4YY3 J;  3BYR A;  1UKU A;  4JV0 A;  3DLH A;  5KFI A;  4CH1 A;  4J9V A;  2IC3 A;  4I2P A;  4IRD A;  3GV8 B;  1MWY A;  5ETN A;  1PO6 A;  5BYR A;  2KN4 A;  2Y8W A;  2DKO B;  3T1A A;  4YUD A;  4EYI B;  4P2S A;  5LMU F;  2BJ9 A;  4BWM A;  3G6Y A;  2PT0 A;  1HBO A;  1AZS A;  1YVF A;  4A8Q A;  4BBY A;  2QZU A;  2BOA A;  2W4P A;  3HHL D;  1XBW A;  5BR8 F;  3F0N A;  2HFN A;  2KL8 A;  3CJS A;  4QW8 A;  3UR3 C;  4U96 A;  3LAK A;  1F1B B;  3BGF A;  3M2U B;  2OJ3 A;  3OTD A;  2P9E A;  3LOU A;  3KJV A;  2JEG A;  2EW9 A;  2WON A;  4ZVU B;  1VGY A;  1SKU B;  3M2V A;  3TP2 A;  1VQ6 S;  2GGP B;  1FSU A;  3ILJ A;  1B7Y B;  1X5P A;  2H65 B;  2NXU A;  2YKP A;  4ZN1 A;  1Q1K A;  5C24 B;  5C2G A;  1W7W A;  3WHI A;  5C24 A;  3BGL A;  3T1Y F;  1NK0 A;  3BDH A;  1HD0 A;  3GJT B;  1PC4 A;  4DV4 F;  5KFO A;  4P71 A;  3IN5 A;  3V4I A;  1N34 F;  1F2H A;  1J5E F;  3QRQ A;  2HFS A;  3CDW A;  1MW7 A;  5I42 B;  2MLY A;  1S1X B;  2FLN A;  2BAC A;  1JKH A;  2A3J A;  1VRT B;  2CXE A;  2WSF C;  3IA0 A;  1ZS6 A;  4IOB A;  4LT6 A;  5EX3 A;  3Q2S C;  4EWT A;  1IBL J;  4DR5 J;  4LF6 F;  3AXM A;  2QSF A;  3L95 X;  3TQ1 A;  3G6X A;  1R0C B;  1RT1 A;  4FKY A;  4PG5 A;  3SFG A;  4K4U A;  1N48 A;  1YKW A;  1ALJ A;  1QSS A;  2L9W A;  2VC1 A;  1VRU A;  3TQE A;  3MFI A;  2ATL A;  2FD2 A;  2I5J B;  1HYS B;  1G7C B;  3IM8 A;  3NXZ A;  1ZZF A;  1HMV A;  3BSO A;  4BLG A;  3AOA A;  1TK8 A;  2OPR A;  3M6V A;  4NLQ A;  4IKA A;  4JI8 F;  3UI3 A;  4ATN A;  4WFN Q;  1RTD A;  2EFG A;  4RW4 B;  4GC6 A;  1YLX A;  2V9W A;  2CAD A;  4L3N A;  4RNM A;  3R5A A;  1WSR A;  1C0T B;  2VG7 B;  3C16 A;  5IT0 A;  3LW5 C;  4RUH A;  3JSM B;  2A2C A;  2UUB J;  1ANJ A;  1YDL A;  3EPI A;  2RQC A;  4FS2 A;  1H72 C;  5KFV A;  2W24 A;  1NK6 A;  2F9D A;  4Y28 C;  5KFK A;  3R5D A;  3GIR A;  2V2V A;  1SI9 A;  1UWA A;  3NGR A;  4F04 B;  3RBE A;  1IR2 A;  1M5V C;  2AYB A;  4JI2 J;  4OX7 A;  1S9G A;  1FKO A;  3RU0 A;  5IXU A;  5DLF A;  1M5O C;  3KK3 B;  2G2Y A;  4CLS A;  2YH1 A;  3BDG A;  1WKL A;  2DR7 A;  3H5U A;  5DG8 A;  1W26 A;  4B56 A;  4OHX A;  2QL9 B;  1S10 A;  3LP0 B;  3IC1 A;  3CD5 A;  3CJK B;  2QO3 A;  1JLE A;  3FGV A;  1WEL A;  4KGM A;  5D6G A;  1RB0 A;  2XZD B;  1WC1 A;  2YXL A;  3I5C A;  4ALZ A;  1N34 J;  1WC6 A;  1M90 T;  2HQD A;  1CJT B;  1RZM A;  2M9K A;  1S6P A;  4Y2I A;  5GMD A;  5J1E B;  5I42 A;  3DPC A;  2I38 A;  1VQ7 S;  2IBO A;  1T8E A;  2Q6B A;  1GMU A;  2FHO B;  3IRX A;  2J8S A;  2D3U A;  3LAM A;  3PVX A;  2IAJ B;  2VIC A;  2H1Y A;  3LH2 S;  1RAI B;  2HGN A;  3W9I A;  3D1Q A;  4P75 A;  2ZZT A;  2YWH A;  1WG1 A;  2RQM A;  4IO1 A;  3ADA C;  5KT4 A;  2Z58 B;  4Q5V A;  3KKF A;  2VBX A;  3A12 A;  1MWQ A;  1NH7 A;  4LF8 F;  4WZM A;  2YX7 A;  1LW0 A;  3O5T B;  4JBC A;  5KXA A;  4DLE A;  4DL3 A;  2QMU B;  2BQU A;  5AJ9 A;  2DNO A;  1Y5L B;  3U02 A;  2DY1 A;  1UP1 A;  3TX8 A;  1UFK A;  4F67 A;  1EET B;  4H4M B;  4UOG A;  4JI3 J;  2ZHA A;  3BEG B;  3A8J A;  2H5J B;  2QX0 A;  2XY6 A;  5IT9 U;  4YR1 A;  4DR7 F;  4P74 A;  2OO4 A;  3QGH A;  4MIB A;  4MT1 A;  3CDA A;  3KK1 A;  3NGS A;  5EGY A;  4A8O A;  5DM6 Q;  5A2Q Y;  2W7P A;  3Q0A A;  2HKE A;  1YHQ S;  1TKT B;  2BOP A;  3W2W A;  2YBV A;  4DL5 A;  4KYZ A;  1XR6 A;  3BQ2 A;  4X64 F;  1FT8 A;  2PD1 A;  2CQ0 A;  4NLY A;  5SUH A;  3D4J A;  2R8K A;  1UPP A;  3ED4 A;  2WZ1 A;  1N6Q A;  2XWX A;  4NI2 B;  1X4E A;  3MEK A;  4P10 A;  3NS6 A;  1VBK A;  2ZNY A;  4JV5 F;  2X98 A;  1OO0 B;  1CSJ A;  2EFV A;  1L3K A;  1TL4 A;  3KG1 A;  2JLG A;  1RAB B;  4FF1 A;  3D6F B;  3N4W A;  2VFS A;  1LV5 A;  3R5B A;  2BZ2 A;  4GVB A;  1H6K X;  4C8M A;  2AYG A;  5FD1 A;  4A8S A;  1T05 A;  3DLK A;  2ASY A;  1XMO F;  3I0R A;  2HFO A;  3GR0 A;  4DQI A;  2FB0 A;  1U2F A;  2AD9 A;  3PHE A;  1Q79 A;  2KB2 A;  1CPZ A;  3V5R A;  1E6V A;  4NZ7 A;  4YDD B;  5GVQ A;  2KHC A;  4I7F A;  4PRF A;  1JXV A;  5GAG I;  4KV8 B;  1ITP A;  1VMB A;  1M5H A;  5CCL A;  2V2Z A;  1RAJ A;  5G4D A;  4X62 J;  1X9S A;  1Y5N B;  3KNA A;  5EUH A;  2BJE A;  1SH3 A;  1Q8K A;  1TKT A;  3ZFV A;  1KFS A;  5L1L A;  1PC5 A;  3OPK A;  3P5B P;  4ZG7 A;  3MM5 B;  1CQN A;  3QAE A;  2QFI A;  2DGQ A;  5LXR A;  2IJN A;  3BGR A;  1JMT A;  5D4L A;  1U1P A;  4BC9 A;  1FJE B;  2IPO B;  4HTI A;  4OQJ A;  4YQW A;  1AJD A;  5L0E A;  5C42 B;  2IA6 A;  1ZAW A;  2MY7 A;  2YNG B;  1YRX A;  1UEK A;  3FVY A;  4C7Q A;  4DG1 A;  3VAI A;  1NSA A;  2VD3 A;  1KOH A;  4B3M F;  4OI0 A;  1PAE X;  1HAR A;  2AJQ A;  4YR0 A;  1RHR B;  4UPH A;  1BD6 A;  2DPJ A;  5CH7 B;  2DRB A;  2DH9 A;  2W1B A;  3QGP A;  1HNW F;  2DO4 A;  3GFH A;  2BKP A;  3SCL E;  1D3W A;  2JRS A;  2GIQ A;  2WAQ D;  4CYU A;  1VC0 A;  4B3T J;  1DAR A;  3IMQ J;  5D3G A;  2WW4 A;  3NKO A;  3IRX B;  1U1O A;  2VFV A;  3GWC A;  3M30 B;  3NP5 A;  2VDH A;  3T1H F;  5AXL A;  1EKS A;  1S7H A;  2C2R A;  2RB7 A;  2ZH4 A;  4W92 B;  1PKU A;  1IM4 A;  2Y8Y A;  4CLK A;  2IMO A;  3DRP B;  4DWI A;  5JVH Q;  4HTJ A;  2KFZ A;  1K0T A;  2LU1 A;  2JNJ A;  4HLB A;  4AL7 A;  1PJ6 A;  1V5I B;  2D3O 1;  2GNK A;  3GIJ A;  2OPP A;  3H8Y A;  3NCP A;  4DPU A;  3OTO F;  2XNR A;  2ZUA A;  4F4A A;  4F4W A;  2RS2 A;  1EET A;  2HHW A;  2DIT A;  1V3R A;  3DOK A;  3G82 B;  5HJY A;  4IG3 A;  2OML A;  1VBX A;  4RW6 A;  3THT A;  2M7S A;  4ZPB A;  5DRK A;  1U24 A;  1VIX A;  2C2O B;  2ZOG A;  3VAH A;  4OYZ A;  2FLP A;  1TUV A;  3VZH A;  2ZJR Q;  4ZPW R;  3NCQ A;  4CI0 B;  3CXC R;  1FWK A;  1RT3 A;  1T11 A;  4LQ9 A;  4JUZ A;  2CJ9 A;  5E41 A;  2KT5 A;  2MZS A;  1HWJ A;  3IDD A;  1J5O B;  5DM7 Q;  5A8R A;  3M8P A;  4M5J A;  2MGZ A;  1N6Q B;  4F0H A;  4C98 A;  1QAI A;  1C1C B;  3AXK A;  2K2P A;  2H3E B;  4Y6I A;  2GAH C;  1XJW B;  4KT0 C;  1H98 A;  4ZMM A;  1Y0H A;  5D0G A;  1FF2 A;  1U1M A;  1X9W A;  3OXF A;  4ILR A;  4S0M A;  5KFF A;  2MKJ A;  5LRM A;  2HZC A;  4U7U K;  4FDJ A;  2P9C A;  3OL6 A;  4GMK A;  4DEZ A;  2RHQ B;  2DNM A;  4K4W A;  3T1Y J;  2MTL A;  1AXQ A;  1FRL A;  3D6M B;  4CO2 A;  1IWA A;  4ZCI A;  1Q0N A;  3V6D A;  3Q83 A;  2L41 A;  1IUJ A;  2QZ8 A;  1PG5 B;  1WDT A;  2F63 A;  4LF4 J;  2AYM A;  2CUY A;  3NBP B;  4GVL A;  3TO8 A;  4WFY A;  5H9E J;  2HEK A;  2HRT A;  3PYF A;  1QJH A;  4TNO A;  1TK5 A;  3MPD A;  1S59 A;  3ONQ A;  2E1P A;  1OJ4 A;  1S1T B;  4K5S A;  4MTP A;  2DCU B;  2QT7 A;  2XHW A;  4JP8 A;  2XMT A;  1G6B A;  1A6L A;  3M6X A;  4HHH A;  2LEB A;  2IUC A;  2DHX A;  4O4G A;  4WP9 A;  3T01 A;  1B99 A;  1T02 A;  2R42 A;  1RJJ A;  3SZY A;  3NGT A;  1GXT A;  4OZ5 A;  2KM8 C;  1MRO A;  5G0R A;  1N36 J;  3GFX A;  1UZH A;  1QAX A;  5C42 A;  1X4A A;  3R1H A;  3PJW A;  1IR1 A;  3ISN D;  3HO1 A;  1Y3K A;  3AJ1 A;  2ZC3 A;  4UTG A;  2R3V A;  2IA0 A;  2Y1R I;  3ZTQ A;  4ECU A;  1NRK A;  2DGU A;  4QW9 A;  1JB0 C;  3DN9 A;  1NK8 A;  2Y9H A;  3QRP A;  3LP0 A;  1HR0 F;  3EXY A;  4KGZ B;  4USJ C;  5KFS A;  4YR3 A;  1T03 A;  2OTJ S;  3H98 A;  4JI0 J;  2R7X A;  5HL7 Q;  1X7V A;  4P73 A;  3IG1 B;  3QLH B;  1RXO B;  1TVR B;  3CNQ P;  5SZT A;  2J6U A;  4JYA F;  3R5J B;  3ITH A;  2FZG B;  5F41 A;  2JOQ A;  5HBM B;  2W8K A;  2HFV A;  4YY3 F;  1YJW S;  3Q3Q A;  3BYP A;  4X4N A;  3DHX A;  4HDG A;  2AW0 A;  5DDR C;  3VAM A;  2BAN B;  1VCT A;  4RU9 A;  1WTF A;  2Z57 B;  1U6F A;  2JSX A;  5E0O A;  2AJ0 A;  2J0Q D;  4X4V A;  4GKK J;  2HFZ A;  2W9B A;  3T41 A;  2OPQ A;  3ZZY A;  4DR1 J;  2CYY A;  4EBD A;  2CNN B;  2Y1J A;  3C3L A;  3DHW C;  5LQQ A;  4M5K A;  3DLK B;  2W2O P;  4UST A;  4UZC A;  4K0K F;  1T94 A;  3QT5 A;  1UW9 A;  2R7O A;  3VQT A;  3CCR S;  2FJV A;  1SH2 A;  4ED6 A;  3UD4 P;  3OL8 A;  2DIU A;  4IRC A;  1O5J A;  1S1U A;  4NLR A;  5IOL A;  1HQA A;  3FC9 A;  2G0I A;  1HI8 A;  1NO8 A;  4RKU C;  2WB1 D;  1TP7 A;  2O01 C;  3FSX A;  5CYM A;  5KFG A;  3OT9 A;  4ZPV R;  3KHH A;  1N5Q A;  1FHT A;  4RWX A;  4TU7 A;  4JI1 J;  1NKB A;  4ELT A;  4HDH A;  5KFQ A;  3I0S B;  3T3F A;  4CCH A;  1JJH A;  1UVL A;  4LVO P;  1YK9 A;  3MUT P;  4DSL A;  1WNE A;  1L3T A;  4NLP A;  2XB2 D;  3OLB A;  5AJ3 J;  1DTT A;  4TLQ A;  3ET6 B;  5ETS A;  1NCL A;  1FO1 A;  1YRT A;  2VFU A;  3OTE A;  4MKB A;  1KVK A;  4MIA A;  4DMZ A;  1LWF B;  4ZIV A;  5IS2 A;  4ECW A;  5J2P A;  1S0V A;  1TAQ A;  4PWD A;  4FXD A;  2QE5 A;  3ENQ A;  4IR9 A;  1ZM4 A;  4ANE A;  1FCA A;  2PE8 A;  2B9E A;  2K06 A;  3D66 A;  2YH0 A;  4M5N A;  5J2N B;  5C25 A;  5C25 B;  5IV3 A;  5GAH I;  3DYA B;  2XGQ A;  3MR5 A;  4FYX B;  1ZTT A;  4TN0 A;  1ZPV A;  2I9S A;  4DV6 J;  3RB0 A;  3UWT A;  1U8S A;  3HI9 A;  5DET A;  3GJQ B;  5HRO A;  1J5E J;  2B4O A;  2AHO B;  2ZVI A;  3ZZO A;  1FDA A;  1JJC B;  3P3D A;  2KXN B;  4ED2 A;  2PI5 A;  3M8R A;  5FJ4 A;  5DGB A;  3MZI A;  4RLE A;  1DLO B;  3J7Z T;  4D3H A;  2K7K A;  4NI2 A;  2N7C A;  3FZB A;  2LQ9 A;  4UOF A;  1AZS B;  1RQ0 A;  3NWR A;  1FXL A;  3P4U B;  1BXN A;  4A4J A;  1R3N A;  3RAX A;  2YNH B;  4HHJ A;  1UVK A;  4KE5 A;  3V6H A;  1NJX A;  2C3P A;  4B02 A;  4GVB B;  1YBU A;  3WAX A;  4O23 A;  2XMJ A;  3SQG B;  1F60 B;  3SDE A;  2B6A B;  4NLS A;  4RBV A;  2ROP A;  4QIW D;  1VIO A;  3KFW X;  5B0G A;  5JXS A;  4RBT A;  3N9U C;  4QOT A;  1RT7 B;  4IQM A;  3TZY A;  2XMA A;  1S5Z A;  3ZTR A;  2KJW A;  2HIQ A;  2R4F A;  3PHT A;  3KLF A;  1A9N B;  3GV5 B;  1T0T V;  3HK2 A;  1WEY A;  1KFD A;  4ICL B;  2J0W A;  1UEV A;  3DDN A;  3KG0 A;  5ETQ A;  3J81 U;  3KUH A;  1NB2 A;  2BA9 A;  2YVS A;  1YJ9 S;  3FK4 A;  3EZ5 A;  2KRR A;  3WAW A;  2W5R A;  4MFB A;  4OX9 F;  2XS2 A;  1LWC A;  4DL4 A;  4GTY A;  2J7K A;  1XMQ J;  1TMJ A;  2E44 A;  2R7U A;  2EPI A;  1S9F A;  4LF7 F;  1TKZ B;  4DR2 J;  3QT7 A;  2CQ2 A;  2HQC A;  1MML A;  3V6J A;  2RHS B;  1FEE A;  2MZQ A;  3OFE A;  5L46 A;  2FC8 A;  2ACY A;  2QYG A;  3K2Y A;  3M32 A;  2RS8 A;  3D54 A;  8AT1 B;  2R8I A;  2ZH6 A;  1FX4 A;  3QT8 A;  4K5R A;  1HPZ A;  4ZVE A;  3IWX A;  2E1A A;  3CCS S;  4DUT A;  2CZ4 A;  4FVM A;  4IUF A;  4KM4 A;  3D3C J;  4USM A;  3WAV A;  2HVI A;  2BW7 A;  3G9C A;  1KHW A;  2LVW A;  3Q8U A;  4WFA Q;  4DL6 A;  4KO0 A;  2XTJ P;  1Z2Z A;  2AX0 A;  1PIE A;  2ZVS A;  4NYP A;  4NAS A;  3R8Y A;  1UCN A;  3C6T B;  4LUB A;  3G96 A;  2HMI A;  4OI1 A;  5AE2 A;  2AGQ A;  3F56 A;  3NMA A;  3TI0 A;  2H51 B;  3TRG A;  3BO3 A;  1XQI A;  3LPY A;  1KKH A;  3Q8Y A;  1TL1 B;  3VR1 A;  4ECV A;  3PXG a;  2R2U A;  1NU4 A;  3LGH A;  2VFT A;  3HFZ B;  4PG8 A;  2RF2 B;  1VR6 A;  3MM8 A;  5DLW A;  2BAB A;  4O3O A;  2ALY B;  2CQ3 A;  5EWG A;  1C1B A;  1JLG A;  4I6Y A;  4KIA A;  4OJ3 A;  4YHH J;  1NJI T;  4JI5 J;  1PIL A;  4FS1 A;  2C3Y A;  4UQG A;  3HHL A;  4I67 A;  4DG1 B;  3LXQ A;  5K8N A;  2V8G A;  1C0U A;  3DYA A;  5BJR A;  3A3N B;  4ZJO A;  5IT9 Y;  4DR5 F;  4LF6 J;  2C2E A;  3MAH A;  2ZM6 F;  1SPB P;  1EB0 A;  3TA1 A;  3FRZ A;  4C4W A;  4PKD B;  1R0A B;  4LF9 F;  4OI6 A;  1V9O A;  4F4Z A;  4PXC A;  1IM6 A;  1NUE A;  3E51 A;  2GFF A;  4EBC A;  1WKK A;  3FEZ A;  2E5G A;  1J5O A;  1FRK A;  4ID5 A;  4E98 A;  2ZBI A;  3UCU P;  1SUQ A;  2LDI A;  5A8K B;  3AOD A;  3FBC A;  1B8J A;  3ZZU A;  2RDD A;  3G6E S;  1MMN A;  1NK9 A;  4DF4 A;  4C9D A;  1R43 A;  3A8E A;  4XTT A;  2E9R X;  3B4M A;  1RLD A;  4FPR A;  4WII A;  1VJQ A;  4WJB A;  2D3O R;  4CM2 A;  1YJN S;  4DSE A;  1D8Z A;  1FXD A;  5D0R A;  2VG5 A;  3O1L A;  3D0G E;  1M1H A;  2HVZ A;  4NZ0 A;  4K0K J;  3PRV A;  3BO2 A;  3RGI A;  1ARO P;  2HMI B;  4R5P A;  2FJD B;  4FZV A;  1JLC A;  2OEM A;  2BE2 A;  3AAW B;  3OUY A;  3BPD A;  5HRT A;  1RHK B;  2DNZ A;  3BO4 A;  4HYK A;  2KHD A;  4C11 A;  2P9G A;  2JFD A;  1Y5I B;  2VFR A;  5IC6 B;  2QEX S;  4DOZ A;  4HKQ A;  2XY7 A;  4PPZ A;  2W4C A;  3MPW A;  5I3U B;  2OPS A;  1LW2 A;  4QQB A;  3JTN A;  4CLW A;  4DPW A;  3HZE A;  3PJX A;  3WQP A;  1APS A;  1FJG J;  4B9L A;  5LJ5 Y;  5EWF A;  1RTJ B;  3MPV A;  2HHU A;  3KJF B;  5HP1 B;  3MK0 A;  5C2C A;  2DGO A;  4EGL A;  7FDR A;  3JSR A;  4ZP6 A;  3UO0 A;  3GYN A;  3IBW A;  4DV3 J;  4A8W A;  3BSC A;  3FCH A;  1E6Y A;  2GVZ B;  4OX6 A;  2OP5 A;  4WIQ A;  3ZTP A;  2ZH3 A;  1Q86 T;  4Z7C A;  1Y11 A;  2L9N A;  3BDP A;  1KH5 A;  4KHR A;  3MR2 A;  2AEM A;  3K8V A;  4WFX A;  1UET A;  3IO1 A;  5DDQ C;  5CAA A;  5HMZ A;  1YRU A;  4RUA A;  3MMA B;  5BR8 J;  3DC2 A;  1DY3 A;  4LRA A;  1S1W B;  1S1V A;  2EEY A;  2N4C A;  3EIC A;  4G1Q A;  4OYM A;  5F8I A;  1XMB A;  4EEY A;  1PYO B;  3S01 A;  3RR8 A;  1Y3J A;  4X4O A;  1ZM3 A;  4QIG A;  3PX4 A;  2C28 A;  3O3L A;  5L38 A;  1IN0 A;  3PYE A;  3BSN A;  1KQF B;  1FE4 A;  1HKA A;  1HNI B;  1EI6 A;  1M1K T;  3G4S S;  4IOC Q;  4X4U A;  2RDJ A;  2IYG A;  2E5I A;  1R8C A;  4R8U B;  3UE2 A;  4B3O B;  3I0S A;  2J9E A;  4C8Y A;  4IDK A;  4QBU A;  3DLG A;  5U47 A;  3OHB A;  3EPG A;  2R7T A;  5D4N A;  2HK3 A;  2R8J A;  2X3G A;  3OQ2 A;  1RTI A;  3WC0 A;  3ENV A;  2QLJ B;  5EGE A;  1F9E B;  2LQ5 A;  1AJC A;  5E3P A;  1HBN B;  5MAO A;  2BE7 D;  1U09 A;  3IFE A;  3OBI A;  4OZ1 A;  1QTN B;  2WVF A;  1Z2L A;  1FKP B;  5A0Y A;  2IFY A;  3GQC A;  3CCZ A;  2MQ8 A;  2W2N P;  3N28 A;  4K4X A;  3AD9 C;  5KFA A;  3CJQ A;  4YHH F;  2COL A;  1BC6 A;  3KMQ A;  1TKX B;  2FQQ B;  3L9Z A;  1FEH A;  4OX8 A;  4QYZ J;  2VBW A;  1AB8 A;  1WI6 A;  4MK9 A;  3HPO A;  1WF0 A;  2PI4 A;  4MAK A;  5IJS A;  1RWX B;  3AOB A;  2WVC A;  2IRU A;  1WF1 A;  1BWV A;  1URR A;  1HPZ B;  1VQY A;  2VA2 A;  2C42 A;  2D41 A;  1PBU A;  2YNI B;  1BE4 A;  1TZ0 A;  3E3X A;  5K5M A;  2M88 A;  1RA6 A;  4O3R A;  4UY8 5;  2BM1 A;  4TY8 A;  4MK8 A;  1H7X A;  3QRR A;  4K4S A;  4K2X A;  3KJN B;  4F4X A;  1HWL A;  1RU2 A;  2HBZ B;  5LL6 d;  5DG7 A;  3ZZZ A;  2DHA A;  3DKD A;  3IGN A;  4G6V B;  1I94 J;  2UVW A;  2Q79 A;  3S8S A;  2MQN A;  2XMM A;  1WHY A;  3L7U A;  2XNQ A;  3MD3 A;  3MOJ B;  3BPS P;  4WPA A;  3DOL A;  3DRS A;  4Q43 A;  4JI7 J;  2BMB A;  2FVC A;  3T19 A;  1AA1 B;  2F4F A;  3OFF A;  1AFI A;  5GAH U;  2DRD A;  2GJF A;  1S48 A;  2F1F A;  2RKI A;  2ZBC A;  3EUN A;  3HVA A;  3QBC A;  3SFU A;  4C2M A;  4J9K A;  4B9M A;  3T5L A;  4ELV A;  1UA0 A;  2ASJ A;  2IRY A;  3KDO A;  3EVO A;  4LSN A;  1HJK A;  4QWA A;  3SDE B;  4KH0 B;  4OV1 A;  1ALI A;  1E6Y B;  2GVZ A;  1U1N A;  4F2S A;  4CNZ A;  3FMB A;  4J5O A;  4WXW A;  2V5H G;  2RVJ A;  3PR5 B;  1RWK B;  4KHP J;  4GC7 A;  1T03 B;  3DYC A;  2PMH A;  1PYS B;  2BJD A;  1JX4 A;  2IDL A;  4LRD A;  3UN3 A;  3KLH B;  1UA1 A;  3CUL A;  4CYU B;  4Y34 A;  2CPJ A;  2M5Y A;  3EVW A;  4W4M A;  3NMR A;  3D6T B;  3VF0 B;  5KFZ A;  2DNL A;  2QLB B;  4RX6 A;  4IFV B;  1U2C A;  2O5D A;  2JLF A;  2NZ4 A;  1ZED A;  5M2R A;  2W5X A;  3CCL S;  2IC3 B;  3AD8 C;  4I2P B;  1RAH B;  1KVJ A;  4XDD A;  5F8J A;  2RRB A;  2B8P A;  2J9D A;  1NPK A;  3GTY X;  4PPD A;  3KHG A;  1ED8 A;  1FJC A;  4XIU A;  1HQU A;  2VG5 B;  4DR3 F;  5AXM A;  2FC9 A;  2ERR A;  4Q0B B;  5AJ3 F;  3W62 A;  1LEO A;  2B6A A;  3EVM A;  3NGU A;  3MCO A;  1N5T A;  3DFE A;  4NOH A;  2XHC A;  4IG3 B;  4CO4 A;  1VJW A;  2V4J B;  2HS0 A;  1SHN A;  2A6M A;  1OQ6 A;  1SV5 B;  2AJ2 A;  4M5I A;  4X66 F;  3VV2 B;  3IS9 A;  5MLC V;  2J0X A;  3EMT A;  3FBF A;  5L9X A;  4AQY J;  2BRL A;  3O8W A;  2ANH A;  3VHQ A;  2DVI A;  3D5M A;  3KLH A;  3NVL A;  3CGI A;  2HVD A;  4RW8 B;  5ITH A;  3KYL A;  2OPS B;  2W8D A;  4X4P A;  2W9A A;  4YB1 P;  2B9W A;  3GCW P;  2KFY A;  3RR7 A;  4DR1 F;  4DCP B;  1IBM J;  4RL1 A;  5J1N A;  3HVT A;  3SBM A;  4LSN B;  2BJ8 A;  2HND A;  4DXL A;  3EYZ A;  2E1C A;  4FF4 A;  1MU2 A;  3JQJ A;  4CM0 A;  1ZPW X;  1SBR A;  2CQ1 A;  1HBM B;  2XSJ A;  2OPQ B;  2W9B B;  3QJL A;  1ELO A;  3I9Z A;  3X3U A;  1CUL A;  3BS9 A;  4AE5 A;  1OIA A;  3T9N A;  5CXT A;  2W25 A;  2FJW A;  5J2M B;  1CJU B;  3V81 A;  3PO4 A;  4G65 A;  4I2Q A;  5F9L A;  3MEE A;  5KFH A;  4MKV A;  4WP8 A;  3G71 S;  3C6T A;  1TFY A;  2MMY A;  3L3C A;  1EP4 A;  1K44 A;  3NNC A;  2XYH B;  2QYC A;  1U7L A;  1RAA B;  4J9Q A;  3O6Q A;  2XMU A;  3HZG A;  1UPM B;  4IH7 A;  4F25 A;  4ECZ A;  4ED5 A;  4FXV A;  1ZAX A;  2J5A A;  2W7A A;  3MK1 A;  3HUL A;  3HVW A;  3EX7 B;  5J2Q B;  3MM6 B;  3UN5 A;  1VK3 A;  4HAC A;  1SKS A;  2EFP A;  2CPH A;  2JHE A;  2QA4 S;  2V8P A;  4C6A A;  2ZBQ A;  4PCQ A;  2HPU A;  4EO6 A;  4ZLP A;  1C2P A;  3DU5 A;  2N82 B;  3NGD A;  4WE1 B;  3IGV A;  2E9Z A;  3HHL C;  4J7C A;  3PY8 A;  4E0D A;  3GP9 A;  3OLA A;  3EWG A;  4JI3 F;  2I8E A;  4DPY A;  1EHW A;  1VQ4 S;  2RH6 A;  2VDI A;  3UDL A;  2QFJ A;  3MR7 A;  2QMW A;  2L48 A;  5ETP A;  1W25 A;  2F3J A;  1KHN A;  2M70 A;  4P7T A;  2HQ3 A;  4QWD A;  4GKK F;  4RBU A;  2Z4P A;  3CJ4 A;  3HHE A;  4ED4 A;  4CIO A;  2DB1 A;  3HMJ G;  4QWC A;  1RKJ A;  1VBZ A;  4JI4 J;  2CPD A;  3P6Y C;  2FZK B;  2Q3P A;  2P6T A;  3SSR A;  1W2B R;  2HVH A;  2OKQ A;  4LMZ A;  1YJU A;  3RTV A;  3CCT A;  5CYJ A;  2MQQ A;  3PRB A;  5DZ6 A;  1BWE A;  3NKM A;  3M1V A;  4EO8 A;  5KG4 A;  4UOR A;  2DIS A;  1X9M A;  1N0U A;  1N5V A;  3BGU A;  3QT6 A;  3BZQ A;  2VOO A;  3DDK A;  3G2X A;  3OTB A;  1FNO A;  3CMQ A;  3H7H B;  3D1H A;  3SQG A;  2RU3 A;  3ULH A;  3W61 A;  2NUH A;  3CJ5 A;  3OVA A;  4PQU A;  4F0K A;  4WBF A;  2CPX A;  1QUV A;  2I5J A;  3FMW A;  4CP5 A;  4LSL A;  4EZ9 A;  2VBZ A;  3IRW P;  4DPT A;  4OJ1 A;  2DGV A;  4A46 A;  3NNA A;  3POT A;  5E7O B;  4DV5 F;  3RG6 A;  3S6E A;  4C0B A;  5GAD U;  1AUK A;  1AYE A;  2OAU A;  1YJV A;  1U47 A;  3B82 A;  2ZHB A;  4QYZ K;  5B08 A;  1VI7 A;  3UDC A;  3CCM S;  1ZA2 B;  4A48 A;  3D0I E;  1LWC B;  5DZ7 A;  2XWY A;  5AE3 A;  1N36 F;  2RRN A;  4ZVP B;  2MLX A;  1JLB A;  1RIS A;  5E3C A;  2IVY A;  1HW9 A;  1RHJ B;  2CNO B;  2DPI A;  1UAW A;  5DGA A;  1AFJ A;  3CDB A;  5EHH A;  2BDP A;  4ZVF A;  3QFH A;  1HBM A;  2QGF B;  4UPI A;  1WC0 A;  1MU2 B;  2C3O A;  2F8M A;  4EFA C;  1D8Y A;  3HJF A;  2ZHO A;  1H2V Z;  3FEY B;  4KHP F;  5KFJ A;  3BKT A;  4ECX A;  3L4B C;  3W66 A;  2QC3 A;  3MEE B;  4DS4 A;  2CQC A;  2DR6 A;  2IRX A;  4ER8 A;  2GO9 A;  3OSN A;  3UFC X;  4XPE A;  3P96 A;  2RNE A;  1TKX A;  1EIY B;  2J9D E;  3AOC A;  1GXL A;  1RT4 B;  3HDS A;  2LXF A;  3VVT A;  3KLG A;  4Y00 A;  3CIM A;  3QSI A;  4DCO B;  3DXS X;  1JIH A;  3NG8 A;  1HBU A;  5IC4 B;  3FQL A;  4G1I A;  4J9U E;  3IR5 B;  3L09 A;  3R7N B;  3CCE S;  3RAQ A;  1KDN A;  3PKM A;  2GSU A;  1WJ9 A;  2KM8 B;  2R7Q A;  3E2D A;  5KFY A;  1QAJ A;  1C1B B;  1JLG B;  1B0V A;  5LOQ A;  2XCA A;  3TJ8 A;  2RJZ A;  1TV6 B;  1XN9 A;  1V5V A;  3HVR A;  2AV5 A;  1SC3 B;  2ZIT A;  4KTQ A;  1M1G A;  4PUO B;  2KJV A;  2YNI A;  4PG6 A;  2LEC A;  4ECR A;  2D7S A;  1XNQ J;  3BH6 B;  4WE1 A;  1PJ5 A;  4HEA 9;  3M2R B;  1X0F A;  1BY9 A;  1D1U A;  1IKW A;  1NAQ A;  1BGX T;  4X4Q A;  4J9L A;  3PIP Q;  1HQE B;  3R97 A;  2ALZ A;  4M5H A;  1ZEB A;  4RR5 A;  4L72 B;  4P9S A;  3M7V A;  4F3Q A;  3NKY A;  2NSC A;  3MMB A;  2VQE J;  3C2P A;  5HBM A;  2HQI A;  4MJK A;  1JLF B;  4OI4 A;  4M63 A;  5JJB A;  2KU7 A;  5F9N A;  2D9O A;  1L3S A;  2K3K A;  2HAF A;  3A4T A;  4NPO A;  2FY1 A;  4RO0 A;  4UF4 A;  5D8H B;  1S1X A;  1UJ6 A;  2WVD A;  1KOO A;  2LDY A;  2XMW A;  3VGU A;  3HVT B;  3M8Z A;  1NDP A;  1QAY A;  2O66 A;  4ED7 A;  1XNQ F;  2XG8 A;  1JNZ B;  2XZW A;  3PAC A;  2IBK A;  2BQR A;  3T9Z A;  4ZVH A;  1TU0 B;  2VPW B;  5FII A;  3EM1 A;  5AXN A;  2K1R B;  5HVF A;  2F4V F;  4ZN3 A;  3GU0 A;  3IM9 A;  3QAU A;  4NML A;  3OHA A;  2F40 A;  3TZW A;  4M94 A;  5B0A A;  1ROF A;  1Y9O A;  3WX4 A;  4JI1 F;  1S4E A;  1N54 B;  3PCO B;  1JK9 B;  3J81 Y;  4CXS A;  4ZVT B;  3A52 A;  2C3U A;  3H59 A;  3JAM U;  2E1R A;  4RNO A;  1OY8 A;  2JX2 A;  4ZVQ B;  2HVE A;  4DSF A;  1NJW A;  4HT5 A;  4LFA F;  1FE0 A;  3J80 Y;  2G0J A;  2XLJ A;  2V50 A;  3H5X A;  3KK1 B;  1FRM A;  3J7A 1;  4LR7 A;  1NME B;  3PW2 A;  4JI2 F;  4IH6 A;  2VG6 B;  3VAG A;  2NQP A;  3P45 B;  1UVN A;  2UXC J;  1BHN A;  3R5G A;  2EKY A;  3QIP A;  4A8K A;  2XYP B;  1VRT A;  3GR1 A;  3M8Y A;  4X62 F;  3J80 U;  1WG4 A;  3MM7 A;  4B3R J;  2NXE A;  4NCA A;  2Q66 A;  1R27 B;  1U6B A;  2HGL A;  2RSQ A;  1Q5V A;  4QIV A;  3DLE B;  2VKZ G;  2JVR A;  4WF9 Q;  4U7U D;  1B0P A;  1X4G A;  2G9O A;  3TEH B;  4DR7 J;  5KG5 A;  1VRQ C;  4OZL A;  1BQN A;  1HQ2 A;  2CQ4 A;  3KUE A;  1F9F A;  3K17 A;  4CO3 A;  2RE1 A;  3C8Y A;  3G6V A;  2X1G A;  4K4Z A;  3DU6 A;  1T9Y A;  2ZDP A;  4NLT A;  2GMH A;  1AUS L;  4Q44 A;  1SJF A;  4KQZ A;  3I56 S;  2W2P P;  2RT3 A;  2YQ1 A;  1B64 A;  4LF8 J;  3SV3 A;  4IQX A;  4NYO A;  2BRK A;  2L9D A;  4AD6 A;  3MHY A;  2UXB F;  4Y3C A;  1Q5Y A;  1U8W A;  1QTM A;  1CJK A;  1XIQ A;  3GFZ A;  1OY6 A;  3QNW B;  4ANC A;  3W5Z A;  4ED3 A;  1KS2 A;  4DUY J;  4OHY A;  1EW9 A;  4ED0 A;  2XM3 A;  4CYR A;  4MYT A;  3LO3 A;  1P8G A;  4FPI A;  4CO5 A;  1F6T A;  2EK6 A;  4DHV A;  3LGN A;  4DDF A;  1P1T A;  1U49 A;  4ZG6 A;  4OYO A;  5HQ8 A;  4YOE A;  1LW0 B;  3NKQ A;  4JI0 F;  4PAB A;  3CWJ A;  1REV A;  3VGV A;  4B9U A;  4GKJ J;  3Q8V A;  3OTC A;  4OZ2 A;  2XI2 A;  3RW7 A;  3WIV A;  1HHT P;  4XPC A;  1KLM A;  5ETK A;  3A8K A;  3TWZ A;  1DZ5 A;  2UUA J;  4N41 A;  1YZ6 A;  2RIL A;  1Z1Z A;  4NCG A;  3DOL B;  3DRS B;  2WBR A;  3FDS A;  3KG4 A;  4QWB A;  3C16 B;  3JAM Y;  4U7C A;  1IBM F;  2U1A A;  4AND A;  2IDE A;  1HNZ J;  4NYZ A;  3EE3 A;  1VQ9 S;  1MNE A;  2RU9 A;  1TKZ A;  4KGX B;  4QZV B;  2WOM B;  4WYW A;  3DLL Q;  1XEZ A;  4WK1 A;  5HI7 A;  4B9T A;  3V4M A;  4ECS A;  5KG2 A;  3SYZ A;  8ATC B;  5LJ3 Y;  4GRS A;  4MFB B;  1S9E B;  2Z2M A;  3BR8 A;  3JXO A;  2GZO A;  2CRL A;  4M5D A;  2CJB A;  4RUB A;  1WC3 A;  2LLZ A;  1RHM B;  3HSJ A;  1TL3 A;  3JTP A;  3H25 A;  1RP5 A;  3QJP A;  4IO9 Q;  2EG1 A;  2NUU G;  4ZIT A;  1FD2 A;  2DNR A;  5L9N A;  2XS5 A;  5K4P A;  4M8L A;  2JL9 A;  1RT1 B;  5K8M A;  2ZH7 A;  1SJR A;  3RB4 A;  4QU7 A;  2N7Y A;  1O0P A;  1VIS A;  2PFD A;  3TOQ A;  2R7S A;  1S1V B;  1VK8 A;  1Y6V A;  5KOX A;  1JLQ B;  1F2G A;  5F8M A;  4RW9 B;  3QO9 A;  5FDL A;  5KFT A;  2EC2 A;  5BYS A;  2FYX A;  3A13 A;  9ATC B;  1GT8 A;  2O3D A;  3I0R B;  1B70 B;  4JB8 B;  2GQ2 A;  5K20 B;  3PW0 A;  2IJF A;  2RH3 A;  1VOM A;  4QIF A;  2D9P A;  1NDC A;  2VQF F;  1LFW A;  4PR6 A;  2JZ5 A;  4LRB A;  4KJG A;  2QA2 A;  4CTA A;  5H1S V;  3HT3 A;  3MUV P;  1SQG A;  1RTH A;  4Y2C A;  1RT3 B;  1RTH B;  3B54 A;  4N76 A;  1WOR A;  2HBQ B;  2HSE B;  2W2Q P;  2F5G A;  1RGV A;  4CT8 A;  1XNR J;  2CQD A;  2P2C B;  3U1N A;  1B7F A;  3PFE A;  3VCD A;  5KG7 A;  1X4F A;  4YB7 A;  4QAX A;  1S4F A;  4QCL A;  2CQI A;  3M2U A;  4Y65 A;  3NWG A;  3MFH A;  1ZZN A;  4MY4 A;  1REV B;  3R6L B;  1L3U A;  1DTQ B;  2RDI A;  4B3R F;  4DX8 H;  3AY0 A;  1Q81 T;  4LFB J;  4LBI A;  2CDQ A;  4KHM A;  4EI2 A;  5KT5 A;  5T14 A;  1NHK L;  1RKI A;  1EQM A;  1RT6 B;  2CDR B;  4KFB B;  5J2N A;  2B7B B;  3SXL A;  4WCE Q;  2JLE A;  3RZA A;  2VJU A;  1VQP S;  1JLF A;  2V8H A;  5GAG U;  4EU0 A;  3BJY A;  4AXJ A;  4DL2 A;  2F4V J;  4ERD A;  3BN7 A;  4UOO A;  4OYA A;  2DRA A;  1HDH A;  3MWB A;  5AXK A;  4U67 Q;  3THV A;  3PM9 A;  1YIT S;  3TR5 A;  1L5U A;  1S77 D;  4ILL A;  1BMQ B;  2GHV C;  3HM9 A;  1WUU A;  1GTH A;  4F3M A;  2C2Z B;  1IR0 A;  2H4W B;  2X51 A;  2XZT B;  5ETT A;  3LWM A;  1S9E A;  4M5D B;  1NH8 A;  3MMC A;  2GX8 A;  1VQL S;  4KPC A;  2W9C A;  3ETM A;  1LK7 A;  4KB7 A;  1VS3 A;  2XSJ B;  2KH9 A;  1OYD A;  4P2X A;  4RW7 A;  4ES3 A;  2H54 B;  1JNR B;  5DQH A;  1R8P A;  3G87 A;  4NLW A;  4PUO A;  3KLE A;  3FEX B;  5CD4 H;  3MAA B;  3MUM P;  3PW5 A;  1YBT A;  2V8D A;  4KPY A;  2ZDO A;  4JI6 J;  4YS2 A;  1NJY A;  3CF5 Q;  5GAD I;  2DR9 A;  2E7W A;  3DI6 A;  3IWL A;  1TTH B;  1X5S A;  2J8A A;  4C11 B;  1HMV B;  2KXH A;  5A2Q U;  2VKR A;  5K8O A;  1SB6 A;  1TUG B;  3J7Y U;  3KLG B;  2LCW A;  1TK0 A;  1RAD B;  1JXE A;  4Z7Y A;  2LYV A;  4R5P B;  1TKD A;  2VPY B;  3IP0 A;  2M52 A;  2EBG A;  2YNF A;  3T6B A;  5LSR A;  4AL6 A;  3RRH A;  3C46 A;  2YPZ A;  2MKY A;  3MM6 A;  1U25 A;  2CVI A;  3LGM A;  4B3S J;  4CDI A;  3GYG A;  3MR6 A;  2ZD1 A;  1KH7 A;  1X4B A;  2ZD1 B;  4RUC A;  1WTB A;  1NM2 A;  1DJ0 A;  2HS4 A;  4B9V A;  4RPF A;  1SQF A;  3KMS A;  3KLI B;  3CD6 S;  4DFJ A;  5KFX A;  2V6A A;  2VOP A;  2BJ7 A;  3HSG A;  2D74 B;  2Z30 B;  4DQQ A;  1FKO B;  3D67 A;  3ENW A;  2PMZ D;  2BAN A;  3IR6 B;  4OYX A;  3TAM B;  3UD5 A;  3RYL A;  4ZLJ A;  3M9O B;  2J6T A;  4H54 A;  3E01 A;  3M6U A;  2XSF A;  4USU A;  5J2M A;  5FLX U;  4DR2 F;  3TW0 A;  2MHN A;  3CCV S;  2CIM A;  2DR8 A;  5IZH A;  1R8A A;  2RAQ A;  5IFM A;  2RUG A;  3D0H E;  2OPR B;  3QFW A;  4KAY A;  3GSI A;  3MTK A;  4JV2 A;  2DNN A;  1MLA A;  2C2M B;  2Y0S D;  4NLX A;  4LF5 F;  3MMC B;  4I68 A;  4MIW A;  2GA7 A;  2OUG A;  2EFQ A;  2Z2Y B;  3RAM A;  2VG6 A;  2BJ3 A;  2HNY A;  4ZVR B;  3D1O A;  1B3T A;  2FY8 A;  1RU1 A;  3KWM A;  3X1L B;  5LIA A;  5E3A A;  1JJ4 A;  3K5P A;  4QPT A;  4K7Q A;  3K5N A;  3NNH A;  3MED B;  2CPY A;  1DTT B;  1IKV B;  1RT5 B;  2FGC A;  3FSY A;  1T9W A;  1ZH5 A;  2RUS A;  4FKX A;  3KK3 A;  2YPY A;  3TAM A;  4CLU A;  1S9G B;  4KFB A;  4NA3 A;  1E3C P;  3G8S A;  5DQI A;  4ZGA A;  1KHV A;  1DQ9 A;  1KTQ A;  3CE8 A;  1RT7 A;  1E2S P;  4B17 A;  2W01 A;  1DQ8 A;  4H4O B;  1FJG F;  4XO0 A;  2MDA A;  2PEB A;  2GQQ A;  1U1L A;  3I4P A;  2ZJQ Q;  1BUX A;  2FGO A;  1B0T A;  3SIP B;  3V4I B;  2JEF A;  3GFY A;  1N5Y A;  4JI4 F;  1TVR A;  4M1K A;  5KFU A;  3W2V A;  2CA9 A;  2C2D A;  3CC4 S;  1VHF A;  4FYD A;  2E66 A;  3HX9 A;  4MK7 A;  3SCK E;  2YWG A;  2W9C B;  2HIY A;  1RSC A;  1TL3 B;  2N3L A;  2K3I A;  2QJ3 A;  4HT7 A;  3FRY A;  1KQS R;  3Q86 A;  2UXB J;  3I5A A;  4O3Q A;  3IGZ B;  2B4P A;  4EUV A;  1OQ3 A;  2NR0 A;  4DPO A;  3MCM A;  2L08 A;  2HUR A;  1PSD A;  1DQA A;  1IXK A;  1VBY A;  1FTC A;  5EX0 A;  4RW9 A;  1RBA A;  5CCM A;  3TAN A;  1EJJ A;  4UPL A;  4M5L A;  2OPP B;  1JXL A;  1QM9 A;  1VQ8 S;  1SH0 A;  1BQX A;  2ZUG A;  3QQC D;  3LF0 A;  5D4O A;  3OVB A;  4F02 A;  1NPR A;  2UU9 J;  2KZM A;  1URA A;  5D0H A;  2W5S A;  1E6V B;  2WB4 A;  4H4M A;  3Q8Q B;  1WSV A;  5L1J A;  3R27 A;  1OPZ A;  4BS2 A;  4PG4 A;  4A8M P;  5CYM B;  1S1T A;  4DV0 F;  1N2L A;  5A76 A;  2IM0 A;  1H74 A;  2OFG X;  1CS4 B;  1N32 F;  4NL5 A;  1N8R T;  1SL0 A;  1REG X;  2YX4 A;  3PG9 A;  4O3N A;  4K4T A;  1VQM S;  5KG3 A;  4DFK A;  3K58 A;  1FFS B;  1RTJ A;  2KXF A;  4F3O A;  3LP1 B;  4X66 J;  5HQL A;  1T9U A;  2YKN A;  2MEW A;  4CLF A;  1DTQ A;  2OSQ A;  1NDL A;  1R8B A;  3KJV B;  4IRK A;  4KKO B;  1EKR A;  3ZZP A;  4KKO A;  2DNQ A;  2YNG A;  2MKS A;  4MKY A;  4LBP A;  3LAL A;  3ENA A;  4J91 A;  2YWK A;  4P52 A;  1FRI A;  2ZC4 A;  4EK2 A;  4ZCM A;  4DR3 J;  4AFF A;  2I0X A;  3CO9 A;  1K0V A;  4KGV B;  5JVG Q;  5DO2 A;  4ZKA A;  1Y7P A;  2B9X A;  2MY8 A;  3GJS B;  4LBH A;  5F0U A;  3O44 A;  3RBZ A;  4ETX A;  2DH7 A;  3LWL A;  4AL5 A;  5HVH A;  4ETZ A;  5DJB A;  2PDA A;  2MXY A;  3BDE A;  5D15 A;  1KD1 T;  2DGS A;  4KGK A;  4WXO A;  1NHV A;  2FLO A;  5KG0 A;  1DAX A;  4QR1 A;  2EBE A;  3N5B A;  4RW7 B;  4F26 A;  4ED8 A;  2B5J B;  1IBC B;  2DD8 S;  3NEK A;  4Q0B A;  1EQJ A;  1K1Q A;  3GSD A;  1HIY A;  2DJW A;  2FTR A;  4QR2 A;  1FVQ A;  2IHR 1;  4FN5 A;  2WK4 A;  4C8N A;  2UVU A;  4U95 A;  4R25 A;  2N4D A;  3UVJ A;  5LXY A;  2J7W A;  2Q43 A;  5LMU J;  3CCQ S;  1X0P A;  3M2V B;  2WTF A;  1S97 A;  5E2Q A;  1UFL A;  3MEC B;  1CJV B;  1KLM B;  3CO0 P;  3WDO A;  1RWV B;  4QWE A;  2VH7 A;  4DBQ A;  5L1K A;  3ISZ A;  2UZA A;  1TL7 B;  3KLV A;  4CXK A;  4RW6 B;  1V6H A;  2G1H A;  2YKQ A;  2LXI A;  2V94 A;  4HL9 A;  5RUB A;  3NKP A;  2MHE A;  1FFG B;  4U8Y A;  3F73 A;  2IJR A;  1RI7 A;  2G2O A;  2RML A;  3ZC4 A;  1T9X A;  4FNH A;  3GIK A;  3MTJ A;  4J9N A;  3NAI A;  1NSP A;  4DFP A;  5F3T A;  5IM0 A;  5B0B A;  2PA3 A;  3TVZ A;  1NK5 A;  1VFJ A;  1A0O B;  1OS5 A;  3QGG A;  4DQR A;  4I0W A;  3CUN A;  4OHZ A;  3UCG A;  2AGO A;  4OI2 A;  1KVI A;  4I4B A;  2I6W A;  4P72 A;  3ZTS A;  3M9N B;  4DL0 C;  4OYP A;  1P9Q C;  4TYA A;  2FPH X;  5JUM A;  1I94 F;  1SKW A;  2MZ1 A;  3PEH A; 
#chains in the Genus database with same CATH homology
 1ANJ A;  1E2S P;  1ZEB A;  1ANI A;  3M7V A;  3BDH A;  5LRN A;  4LRE A;  5INH A;  5TJ3 A;  4CXU A;  4LRC A;  5EGH A;  3TG0 A;  1E3C P;  4LRB A;  4KJG A;  1Y7A A;  3Q3Q A;  3WBH A;  3MK1 A;  4UOP A;  5DLW A;  4ZG7 A;  1KHN A;  3UN5 A;  1O98 A;  1E33 P;  2W8S A;  1ED9 A;  3M8Z A;  5IJS A;  1KH4 A;  3IGZ B;  5GRR A;  4QAX A;  1URB A;  5L0E A;  1AJD A;  2W5V A;  4MY4 A;  4UPK A;  1ALJ A;  3NKN A;  1ALH A;  1EJJ A;  5L0K A;  1EW8 A;  5LQQ A;  3BDG B;  4CYS A;  4UPL A;  3T00 A;  2RH6 A;  4CXS A;  3A52 A;  2D1G A;  2W5S A;  4UPH A;  1HQA A;  2W5Q A;  3CMR A;  5DLV A;  1P49 A;  1URA A;  4UOO A;  1HDH A;  4GTW A;  3OT9 A;  1N2L A;  3NKO A;  1KHL A;  3UNY A;  4LR7 A;  4FDI A;  1ELX A;  1B8J A;  1O99 A;  4LRF A;  4CYR A;  1EW2 A;  2GSO A;  2IUC B;  3NKM A;  4KAV A;  4UOR A;  3M8Y A;  1HJK A;  1ALI A;  3BDG A;  1KHK A;  2W5T A;  3WAY A;  1KH9 A;  4B56 A;  3DYC A;  4TN0 A;  3M8W A;  1ALK A;  4KJD A;  4LRD A;  3UN3 A;  5HRT A;  4N7T A;  1EI6 A;  1ELY A;  1AUK A;  4LR2 A;  5DLT A;  2XRG A;  3DPC A;  2VQR A;  3NKR A;  3TX0 A;  1ZED A;  4MHX A;  2GA3 A;  4GTX A;  2W5X A;  1KH7 A;  3MK2 A;  3IDD A;  2ZKT A;  3MK0 A;  1ED8 A;  1EQJ A;  1EW9 A;  3BDF A;  1ELZ A;  4GTZ A;  1AJB A;  3UO0 A;  1SHQ A;  4UPI A;  4LR9 A;  1N2K A;  5KXA A;  5L0B A;  1KH5 A;  1ZEF A;  3UN2 A;  3T02 A;  3WAX A;  4ZG6 A;  5LRM A;  4FDJ A;  5AJ9 A;  3NKQ A;  5GOV A;  2XR9 A;  1SHN A;  2GLQ A;  4LR8 A;  4LRA A;  4YR1 A;  3LXQ A;  3TWZ A;  3SZZ A;  4ZG9 A;  2ANH A;  4CXK A;  4KAY A;  2G9Y A;  1K7H A;  3NKP A;  3NVL A;  4NWJ A;  4LQY A;  3WAW A;  2W5W A;  2W5R A;  2W8D A;  4GTY A;  1KHJ A;  2GSU A;  2IUC A;  1E1Z P;  3T01 A;  3KD8 A;  3E2D A;  3IGY B;  3ED4 A;  3SZY A;  3B5Q A;  2QZU A;  4MIV A;  5C66 A;  5LIA A;  4NWX A;  2X98 A;  1AJA A;  5EGE A;  5K4P A;  1AJC A;  5IJQ A;  3WAV A;  4KM4 A;  4ZGA A;  1Y6V A;  2GSN A;  1FSU A;  2IFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...