1K8AP

Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
b'SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2001-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1k8aP00
3CXCK 1Q7YP 2OTJO 3CCUL 1YHQL 1VQKL 3I56L 3CMAO 3OW2K 1YJNL 1VQLL 1VQMO 3CCLL 1M90P 3CD6L 3CCRO 1YITO 1KD1P 1K73M 1VQ7L 1VQ9L 1YJ9L 1VQOO 1Q7YM 1QVFK 1VQPO 1YJWL 3CCML 3CCUO 1YHQO 1M1KM 3CCEL 1QVGN 3G4SL 1VQKO 3I56O 3CCVL 3CXCN 1YI2L 2OTLL 1YJNO 1KQSN 1VQLO 1Q81M 1W2BN 3CCLO 1JJ2K 1N8RP 3CCJL 1KD1M 3CD6O 1VQ8O 2QEXL 3I55L 3OW2N 1VQ7O 1K9MP 1VQ9O 1VQ8L 2QA4L 1YJ9O 1S72L 1KC8P 1YIJL 1YJWO 3CCMO 1Q86P 3CCEO 3G4SO 1VQ4L 1QVFN 3CCVO 3CC4L 1YI2O 2OTLO 1Q82P 3CCJO 1M90M 3G6EL 3CPWK 1VQ6O 1K9MM 2QEXO 3I55O 3CC7L 3CCQL 1VQ6L 1NJIP 1VQNL 2QA4O 3CMEL 1S72O 1JJ2N 1YIJO 1VQ5L 1K8AP 1Q86M 1KQSK 3CCSL 3G71L 1W2BK 1VQ4O 3CC4O 1Q82M 2OTJL 1M1KP 1N8RM 3G6EO 1NJIM 3CMAL 1Q81P 3CC7O 3CCQO 1VQML 1VQNO 3CMEO 1K8AM 1KC8M 1VQ5O 3CPWN 3CCRL 3CC2O 1YITL 3CC2L 1K73P 3CCSO 3G71O 1QVGK 1VQOL 1VQPL
chains in the Genus database with same CATH superfamily
5DLJA 3CXCK 2YZSA 1Q7YP 2OTJO 3CCUL 4QDLA 1YHQL 4WJ0A 1VQKL 3I56L 3CMAO 3OW2K 1YJNL 1VQLL 1VQMO 3CCLL 1M90P 3CD6L 3CCRO 1YITO 5DS6A 1KD1P 1K73M 1VQ7L 1VQ9L 1YJ9L 1VQOO 1Q7YM 1QVFK 1VQPO 1YJWL 3CCML 3CCUO 4W8KA 1YHQO 1M1KM 3CCEL 1QVGN 3NKDA 3G4SL 1VQKO 3I56O 3CCVL 3CXCN 1YI2L 2OTLL 1YJNO 1KQSN 1VQLO 1Q81M 5DS5A 1W2BN 3CCLO 1JJ2K 1N8RP 3CCJL 1KD1M 3CD6O 5DS4A 1VQ8O 5FCLA 2QEXL 3I55L 3OW2N 1VQ7O 1K9MP 1VQ9O 1VQ8L 2QA4L 1YJ9O 1S72L 1KC8P 1YIJL 1YJWO 3CCMO 3GODA 1Q86P 3CCEO 3G4SO 1VQ4L 1QVFN 3CCVO 3CC4L 1YI2O 2OTLO 1Q82P 5DQTA 3CCJO 1M90M 3G6EL 3CPWK 1VQ6O 1K9MM 2QEXO 3I55O 3CC7L 3CCQL 1VQ6L 1NJIP 1VQNL 2QA4O 3CMEL 1S72O 1JJ2N 1YIJO 4N06A 4P6IC 1VQ5L 1K8AP 1Q86M 1KQSK 4XTKA 3CCSL 3G71L 1W2BK 1VQ4O 3CC4O 1Q82M 2OTJL 1M1KP 1N8RM 3G6EO 5DQZA 1NJIM 3CMAL 1Q81P 3CC7O 3CCQO 1VQML 1VQNO 3CMEO 1K8AM 1KC8M 1VQ5O 3CPWN 3CCRL 3CC2O 1YITL 3CC2L 1K73P 3CCSO 3G71O 1QVGK 1VQOL 1VQPL
chains in the Genus database with same CATH topology
5DLJA 3CXCK 2YZSA 1Q7YP 2OTJO 3CCUL 4QDLA 1YHQL 4WJ0A 1VQKL 3I56L 3CMAO 3OW2K 1YJNL 1VQLL 1VQMO 3CCLL 1M90P 3CD6L 3CCRO 1YITO 5DS6A 1KD1P 1K73M 1VQ7L 1VQ9L 1YJ9L 1VQOO 1Q7YM 1QVFK 1VQPO 1YJWL 3CCML 3CCUO 4W8KA 1YHQO 1M1KM 3CCEL 1QVGN 3NKDA 3G4SL 1VQKO 3I56O 3CCVL 3CXCN 1YI2L 2OTLL 1YJNO 1KQSN 1VQLO 1Q81M 5DS5A 1W2BN 3CCLO 1JJ2K 1N8RP 3CCJL 1KD1M 3CD6O 5DS4A 1VQ8O 5FCLA 2QEXL 3I55L 3OW2N 1VQ7O 1K9MP 1VQ9O 1VQ8L 2QA4L 1YJ9O 1S72L 1KC8P 1YIJL 1YJWO 3CCMO 3GODA 1Q86P 3CCEO 3G4SO 1VQ4L 1QVFN 3CCVO 3CC4L 1YI2O 2OTLO 1Q82P 5DQTA 3CCJO 1M90M 3G6EL 3CPWK 1VQ6O 1K9MM 2QEXO 3I55O 3CC7L 3CCQL 1VQ6L 1NJIP 1VQNL 2QA4O 3CMEL 1S72O 1JJ2N 1YIJO 4N06A 4P6IC 1VQ5L 1K8AP 1Q86M 1KQSK 4XTKA 3CCSL 3G71L 1W2BK 1VQ4O 3CC4O 1Q82M 2OTJL 1M1KP 1N8RM 3G6EO 5DQZA 1NJIM 3CMAL 1Q81P 3CC7O 3CCQO 1VQML 1VQNO 3CMEO 1K8AM 1KC8M 1VQ5O 3CPWN 3CCRL 3CC2O 1YITL 3CC2L 1K73P 3CCSO 3G71O 1QVGK 1VQOL 1VQPL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC K;  1Q7Y P;  2OTJ O;  3CCU L;  1YHQ L;  1VQK L;  3I56 L;  3CMA O;  3OW2 K;  1YJN L;  1VQL L;  1VQM O;  3CCL L;  1M90 P;  3CD6 L;  3CCR O;  1YIT O;  1KD1 P;  1K73 M;  1VQ7 L;  1VQ9 L;  1YJ9 L;  1VQO O;  1Q7Y M;  1QVF K;  1VQP O;  1YJW L;  3CCM L;  3CCU O;  1YHQ O;  1M1K M;  3CCE L;  1QVG N;  3G4S L;  1VQK O;  3I56 O;  3CCV L;  3CXC N;  1YI2 L;  2OTL L;  1YJN O;  1KQS N;  1VQL O;  1Q81 M;  1W2B N;  3CCL O;  1JJ2 K;  1N8R P;  3CCJ L;  1KD1 M;  3CD6 O;  1VQ8 O;  2QEX L;  3I55 L;  3OW2 N;  1VQ7 O;  1K9M P;  1VQ9 O;  1VQ8 L;  2QA4 L;  1YJ9 O;  1S72 L;  1KC8 P;  1YIJ L;  1YJW O;  3CCM O;  1Q86 P;  3CCE O;  3G4S O;  1VQ4 L;  1QVF N;  3CCV O;  3CC4 L;  1YI2 O;  2OTL O;  1Q82 P;  3CCJ O;  1M90 M;  3G6E L;  3CPW K;  1VQ6 O;  1K9M M;  2QEX O;  3I55 O;  3CC7 L;  3CCQ L;  1VQ6 L;  1NJI P;  1VQN L;  2QA4 O;  3CME L;  1S72 O;  1JJ2 N;  1YIJ O;  1VQ5 L;  1K8A P;  1Q86 M;  1KQS K;  3CCS L;  3G71 L;  1W2B K;  1VQ4 O;  3CC4 O;  1Q82 M;  2OTJ L;  1M1K P;  1N8R M;  3G6E O;  1NJI M;  3CMA L;  1Q81 P;  3CC7 O;  3CCQ O;  1VQM L;  1VQN O;  3CME O;  1K8A M;  1KC8 M;  1VQ5 O;  3CPW N;  3CCR L;  3CC2 O;  1YIT L;  3CC2 L;  1K73 P;  3CCS O;  3G71 O;  1QVG K;  1VQO L;  1VQP L; 
#chains in the Genus database with same CATH topology
 5DLJ A;  3CXC K;  2YZS A;  1Q7Y P;  2OTJ O;  3CCU L;  4QDL A;  1YHQ L;  4WJ0 A;  1VQK L;  3I56 L;  3CMA O;  3OW2 K;  1YJN L;  1VQL L;  1VQM O;  3CCL L;  1M90 P;  3CD6 L;  3CCR O;  1YIT O;  5DS6 A;  1KD1 P;  1K73 M;  1VQ7 L;  1VQ9 L;  1YJ9 L;  1VQO O;  1Q7Y M;  1QVF K;  1VQP O;  1YJW L;  3CCM L;  3CCU O;  4W8K A;  1YHQ O;  1M1K M;  3CCE L;  1QVG N;  3NKD A;  3G4S L;  1VQK O;  3I56 O;  3CCV L;  3CXC N;  1YI2 L;  2OTL L;  1YJN O;  1KQS N;  1VQL O;  1Q81 M;  5DS5 A;  1W2B N;  3CCL O;  1JJ2 K;  1N8R P;  3CCJ L;  1KD1 M;  3CD6 O;  5DS4 A;  1VQ8 O;  5FCL A;  2QEX L;  3I55 L;  3OW2 N;  1VQ7 O;  1K9M P;  1VQ9 O;  1VQ8 L;  2QA4 L;  1YJ9 O;  1S72 L;  1KC8 P;  1YIJ L;  1YJW O;  3CCM O;  3GOD A;  1Q86 P;  3CCE O;  3G4S O;  1VQ4 L;  1QVF N;  3CCV O;  3CC4 L;  1YI2 O;  2OTL O;  1Q82 P;  5DQT A;  3CCJ O;  1M90 M;  3G6E L;  3CPW K;  1VQ6 O;  1K9M M;  2QEX O;  3I55 O;  3CC7 L;  3CCQ L;  1VQ6 L;  1NJI P;  1VQN L;  2QA4 O;  3CME L;  1S72 O;  1JJ2 N;  1YIJ O;  4N06 A;  4P6I C;  1VQ5 L;  1K8A P;  1Q86 M;  1KQS K;  4XTK A;  3CCS L;  3G71 L;  1W2B K;  1VQ4 O;  3CC4 O;  1Q82 M;  2OTJ L;  1M1K P;  1N8R M;  3G6E O;  5DQZ A;  1NJI M;  3CMA L;  1Q81 P;  3CC7 O;  3CCQ O;  1VQM L;  1VQN O;  3CME O;  1K8A M;  1KC8 M;  1VQ5 O;  3CPW N;  3CCR L;  3CC2 O;  1YIT L;  3CC2 L;  1K73 P;  3CCS O;  3G71 O;  1QVG K;  1VQO L;  1VQP L; 
#chains in the Genus database with same CATH homology
 5DLJ A;  3CXC K;  2YZS A;  1Q7Y P;  2OTJ O;  3CCU L;  4QDL A;  1YHQ L;  4WJ0 A;  1VQK L;  3I56 L;  3CMA O;  3OW2 K;  1YJN L;  1VQL L;  1VQM O;  3CCL L;  1M90 P;  3CD6 L;  3CCR O;  1YIT O;  5DS6 A;  1KD1 P;  1K73 M;  1VQ7 L;  1VQ9 L;  1YJ9 L;  1VQO O;  1Q7Y M;  1QVF K;  1VQP O;  1YJW L;  3CCM L;  3CCU O;  4W8K A;  1YHQ O;  1M1K M;  3CCE L;  1QVG N;  3NKD A;  3G4S L;  1VQK O;  3I56 O;  3CCV L;  3CXC N;  1YI2 L;  2OTL L;  1YJN O;  1KQS N;  1VQL O;  1Q81 M;  5DS5 A;  1W2B N;  3CCL O;  1JJ2 K;  1N8R P;  3CCJ L;  1KD1 M;  3CD6 O;  5DS4 A;  1VQ8 O;  5FCL A;  2QEX L;  3I55 L;  3OW2 N;  1VQ7 O;  1K9M P;  1VQ9 O;  1VQ8 L;  2QA4 L;  1YJ9 O;  1S72 L;  1KC8 P;  1YIJ L;  1YJW O;  3CCM O;  3GOD A;  1Q86 P;  3CCE O;  3G4S O;  1VQ4 L;  1QVF N;  3CCV O;  3CC4 L;  1YI2 O;  2OTL O;  1Q82 P;  5DQT A;  3CCJ O;  1M90 M;  3G6E L;  3CPW K;  1VQ6 O;  1K9M M;  2QEX O;  3I55 O;  3CC7 L;  3CCQ L;  1VQ6 L;  1NJI P;  1VQN L;  2QA4 O;  3CME L;  1S72 O;  1JJ2 N;  1YIJ O;  4N06 A;  4P6I C;  1VQ5 L;  1K8A P;  1Q86 M;  1KQS K;  4XTK A;  3CCS L;  3G71 L;  1W2B K;  1VQ4 O;  3CC4 O;  1Q82 M;  2OTJ L;  1M1K P;  1N8R M;  3G6E O;  5DQZ A;  1NJI M;  3CMA L;  1Q81 P;  3CC7 O;  3CCQ O;  1VQM L;  1VQN O;  3CME O;  1K8A M;  1KC8 M;  1VQ5 O;  3CPW N;  3CCR L;  3CC2 O;  1YIT L;  3CC2 L;  1K73 P;  3CCS O;  3G71 O;  1QVG K;  1VQO L;  1VQP L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...