3G4SO

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 28
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 3g4sO00
1YI2L 3CC2L 1VQNL 3CCMO 3CCJL 1Q82P 1VQLO 2QA4L 3CCUL 1KC8P 1VQ8O 1VQ6L 3OW2N 1KQSK 1JJ2K 1VQ9O 1VQPO 1K9MP 1YJ9O 3CCRL 3CC4O 3G6EL 1VQ7O 1VQML 1K8AM 3I56L 1W2BN 3CCSO 1QVGK 1VQOL 1YI2O 1YITL 1N8RP 1NJIM 2OTLO 3CCJO 3I55O 1JJ2N 3CPWN 1S72O 3CCVL 3G4SO 3CC7O 3CCEL 3CXCN 1Q82M 3CD6O 1Q7YM 1QVFN 1YJWL 1M1KM 1VQ4O 3CMAL 1VQ5O 1VQKL 3CCLO 3CCQL 1M90P 3G71L 3CCRO 1YHQO 1Q81P 2OTJO 1KD1P 3CMEL 1YIJO 1YJNL 1K73M 1Q86P 3CCML 3CC2O 1VQNO 1KQSN 1VQLL 1N8RM 2QA4O 3CCUO 1VQ8L 1VQ6O 1VQ9L 1VQPL 1YJWO 1KC8M 3CMAO 1YJ9L 1K8AP 3G71O 3OW2K 3CC4L 1VQ7L 1K9MM 1QVGN 3G6EO 1VQMO 1NJIP 3I56O 3CCSL 2QEXL 1KD1M 1VQOO 2OTLL 1YITO 3I55L 1W2BK 1S72L 1Q86M 1Q7YP 3G4SL 3CC7L 1M1KP 3CCVO 3CCEO 3CPWK 3CD6L 1VQ5L 1VQ4L 3CCLL 1VQKO 3CXCK 3CCQO 1YHQL 1QVFK 2OTJL 1K73P 1M90M 3CMEO 1YIJL 1YJNO 2QEXO 1Q81M
chains in the Genus database with same CATH superfamily
1YI2L 3CC2L 1VQNL 3CCMO 3CCJL 1Q82P 1VQLO 2QA4L 3CCUL 1KC8P 1VQ8O 1VQ6L 5DQZA 3OW2N 1KQSK 1JJ2K 4W8KA 1VQ9O 1VQPO 1K9MP 1YJ9O 4WJ0A 3CCRL 3CC4O 3G6EL 1VQ7O 1VQML 1K8AM 3I56L 1W2BN 3CCSO 5DS5A 1QVGK 1VQOL 2YZSA 1YI2O 1YITL 1N8RP 1NJIM 2OTLO 3CCJO 3I55O 1JJ2N 4N06A 3CPWN 1S72O 3CCVL 3G4SO 3CC7O 3CCEL 3CXCN 1Q82M 3CD6O 1Q7YM 1QVFN 1YJWL 1M1KM 1VQ4O 3CMAL 1VQ5O 1VQKL 3CCLO 3CCQL 1M90P 3G71L 3CCRO 1YHQO 1Q81P 2OTJO 1KD1P 3CMEL 5DS6A 1YIJO 1YJNL 1K73M 1Q86P 3CCML 5DS4A 3CC2O 1VQNO 1KQSN 3NKDA 1VQLL 1N8RM 2QA4O 3CCUO 1VQ8L 1VQ6O 1VQ9L 1VQPL 1YJWO 1KC8M 3CMAO 1YJ9L 1K8AP 3G71O 3OW2K 3CC4L 1VQ7L 1K9MM 5DQTA 1QVGN 3G6EO 1VQMO 1NJIP 3I56O 3CCSL 2QEXL 1KD1M 1VQOO 2OTLL 1YITO 3I55L 1W2BK 1S72L 5FCLA 1Q86M 1Q7YP 4QDLA 3G4SL 3CC7L 1M1KP 3CCVO 3CCEO 3CPWK 3CD6L 1VQ5L 1VQ4L 3CCLL 1VQKO 3CXCK 3CCQO 1YHQL 1QVFK 2OTJL 4XTKA 1K73P 1M90M 3GODA 3CMEO 1YIJL 4P6IC 1YJNO 2QEXO 1Q81M 5DLJA
chains in the Genus database with same CATH topology
1YI2L 3CC2L 1VQNL 3CCMO 3CCJL 1Q82P 1VQLO 2QA4L 3CCUL 1KC8P 1VQ8O 1VQ6L 5DQZA 3OW2N 1KQSK 1JJ2K 4W8KA 1VQ9O 1VQPO 1K9MP 1YJ9O 4WJ0A 3CCRL 3CC4O 3G6EL 1VQ7O 1VQML 1K8AM 3I56L 1W2BN 3CCSO 5DS5A 1QVGK 1VQOL 2YZSA 1YI2O 1YITL 1N8RP 1NJIM 2OTLO 3CCJO 3I55O 1JJ2N 4N06A 3CPWN 1S72O 3CCVL 3G4SO 3CC7O 3CCEL 3CXCN 1Q82M 3CD6O 1Q7YM 1QVFN 1YJWL 1M1KM 1VQ4O 3CMAL 1VQ5O 1VQKL 3CCLO 3CCQL 1M90P 3G71L 3CCRO 1YHQO 1Q81P 2OTJO 1KD1P 3CMEL 5DS6A 1YIJO 1YJNL 1K73M 1Q86P 3CCML 5DS4A 3CC2O 1VQNO 1KQSN 3NKDA 1VQLL 1N8RM 2QA4O 3CCUO 1VQ8L 1VQ6O 1VQ9L 1VQPL 1YJWO 1KC8M 3CMAO 1YJ9L 1K8AP 3G71O 3OW2K 3CC4L 1VQ7L 1K9MM 5DQTA 1QVGN 3G6EO 1VQMO 1NJIP 3I56O 3CCSL 2QEXL 1KD1M 1VQOO 2OTLL 1YITO 3I55L 1W2BK 1S72L 5FCLA 1Q86M 1Q7YP 4QDLA 3G4SL 3CC7L 1M1KP 3CCVO 3CCEO 3CPWK 3CD6L 1VQ5L 1VQ4L 3CCLL 1VQKO 3CXCK 3CCQO 1YHQL 1QVFK 2OTJL 4XTKA 1K73P 1M90M 3GODA 3CMEO 1YIJL 4P6IC 1YJNO 2QEXO 1Q81M 5DLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 L;  3CC2 L;  1VQN L;  3CCM O;  3CCJ L;  1Q82 P;  1VQL O;  2QA4 L;  3CCU L;  1KC8 P;  1VQ8 O;  1VQ6 L;  3OW2 N;  1KQS K;  1JJ2 K;  1VQ9 O;  1VQP O;  1K9M P;  1YJ9 O;  3CCR L;  3CC4 O;  3G6E L;  1VQ7 O;  1VQM L;  1K8A M;  3I56 L;  1W2B N;  3CCS O;  1QVG K;  1VQO L;  1YI2 O;  1YIT L;  1N8R P;  1NJI M;  2OTL O;  3CCJ O;  3I55 O;  1JJ2 N;  3CPW N;  1S72 O;  3CCV L;  3G4S O;  3CC7 O;  3CCE L;  3CXC N;  1Q82 M;  3CD6 O;  1Q7Y M;  1QVF N;  1YJW L;  1M1K M;  1VQ4 O;  3CMA L;  1VQ5 O;  1VQK L;  3CCL O;  3CCQ L;  1M90 P;  3G71 L;  3CCR O;  1YHQ O;  1Q81 P;  2OTJ O;  1KD1 P;  3CME L;  1YIJ O;  1YJN L;  1K73 M;  1Q86 P;  3CCM L;  3CC2 O;  1VQN O;  1KQS N;  1VQL L;  1N8R M;  2QA4 O;  3CCU O;  1VQ8 L;  1VQ6 O;  1VQ9 L;  1VQP L;  1YJW O;  1KC8 M;  3CMA O;  1YJ9 L;  1K8A P;  3G71 O;  3OW2 K;  3CC4 L;  1VQ7 L;  1K9M M;  1QVG N;  3G6E O;  1VQM O;  1NJI P;  3I56 O;  3CCS L;  2QEX L;  1KD1 M;  1VQO O;  2OTL L;  1YIT O;  3I55 L;  1W2B K;  1S72 L;  1Q86 M;  1Q7Y P;  3G4S L;  3CC7 L;  1M1K P;  3CCV O;  3CCE O;  3CPW K;  3CD6 L;  1VQ5 L;  1VQ4 L;  3CCL L;  1VQK O;  3CXC K;  3CCQ O;  1YHQ L;  1QVF K;  2OTJ L;  1K73 P;  1M90 M;  3CME O;  1YIJ L;  1YJN O;  2QEX O;  1Q81 M; 
#chains in the Genus database with same CATH topology
 1YI2 L;  3CC2 L;  1VQN L;  3CCM O;  3CCJ L;  1Q82 P;  1VQL O;  2QA4 L;  3CCU L;  1KC8 P;  1VQ8 O;  1VQ6 L;  5DQZ A;  3OW2 N;  1KQS K;  1JJ2 K;  4W8K A;  1VQ9 O;  1VQP O;  1K9M P;  1YJ9 O;  4WJ0 A;  3CCR L;  3CC4 O;  3G6E L;  1VQ7 O;  1VQM L;  1K8A M;  3I56 L;  1W2B N;  3CCS O;  5DS5 A;  1QVG K;  1VQO L;  2YZS A;  1YI2 O;  1YIT L;  1N8R P;  1NJI M;  2OTL O;  3CCJ O;  3I55 O;  1JJ2 N;  4N06 A;  3CPW N;  1S72 O;  3CCV L;  3G4S O;  3CC7 O;  3CCE L;  3CXC N;  1Q82 M;  3CD6 O;  1Q7Y M;  1QVF N;  1YJW L;  1M1K M;  1VQ4 O;  3CMA L;  1VQ5 O;  1VQK L;  3CCL O;  3CCQ L;  1M90 P;  3G71 L;  3CCR O;  1YHQ O;  1Q81 P;  2OTJ O;  1KD1 P;  3CME L;  5DS6 A;  1YIJ O;  1YJN L;  1K73 M;  1Q86 P;  3CCM L;  5DS4 A;  3CC2 O;  1VQN O;  1KQS N;  3NKD A;  1VQL L;  1N8R M;  2QA4 O;  3CCU O;  1VQ8 L;  1VQ6 O;  1VQ9 L;  1VQP L;  1YJW O;  1KC8 M;  3CMA O;  1YJ9 L;  1K8A P;  3G71 O;  3OW2 K;  3CC4 L;  1VQ7 L;  1K9M M;  5DQT A;  1QVG N;  3G6E O;  1VQM O;  1NJI P;  3I56 O;  3CCS L;  2QEX L;  1KD1 M;  1VQO O;  2OTL L;  1YIT O;  3I55 L;  1W2B K;  1S72 L;  5FCL A;  1Q86 M;  1Q7Y P;  4QDL A;  3G4S L;  3CC7 L;  1M1K P;  3CCV O;  3CCE O;  3CPW K;  3CD6 L;  1VQ5 L;  1VQ4 L;  3CCL L;  1VQK O;  3CXC K;  3CCQ O;  1YHQ L;  1QVF K;  2OTJ L;  4XTK A;  1K73 P;  1M90 M;  3GOD A;  3CME O;  1YIJ L;  4P6I C;  1YJN O;  2QEX O;  1Q81 M;  5DLJ A; 
#chains in the Genus database with same CATH homology
 1YI2 L;  3CC2 L;  1VQN L;  3CCM O;  3CCJ L;  1Q82 P;  1VQL O;  2QA4 L;  3CCU L;  1KC8 P;  1VQ8 O;  1VQ6 L;  5DQZ A;  3OW2 N;  1KQS K;  1JJ2 K;  4W8K A;  1VQ9 O;  1VQP O;  1K9M P;  1YJ9 O;  4WJ0 A;  3CCR L;  3CC4 O;  3G6E L;  1VQ7 O;  1VQM L;  1K8A M;  3I56 L;  1W2B N;  3CCS O;  5DS5 A;  1QVG K;  1VQO L;  2YZS A;  1YI2 O;  1YIT L;  1N8R P;  1NJI M;  2OTL O;  3CCJ O;  3I55 O;  1JJ2 N;  4N06 A;  3CPW N;  1S72 O;  3CCV L;  3G4S O;  3CC7 O;  3CCE L;  3CXC N;  1Q82 M;  3CD6 O;  1Q7Y M;  1QVF N;  1YJW L;  1M1K M;  1VQ4 O;  3CMA L;  1VQ5 O;  1VQK L;  3CCL O;  3CCQ L;  1M90 P;  3G71 L;  3CCR O;  1YHQ O;  1Q81 P;  2OTJ O;  1KD1 P;  3CME L;  5DS6 A;  1YIJ O;  1YJN L;  1K73 M;  1Q86 P;  3CCM L;  5DS4 A;  3CC2 O;  1VQN O;  1KQS N;  3NKD A;  1VQL L;  1N8R M;  2QA4 O;  3CCU O;  1VQ8 L;  1VQ6 O;  1VQ9 L;  1VQP L;  1YJW O;  1KC8 M;  3CMA O;  1YJ9 L;  1K8A P;  3G71 O;  3OW2 K;  3CC4 L;  1VQ7 L;  1K9M M;  5DQT A;  1QVG N;  3G6E O;  1VQM O;  1NJI P;  3I56 O;  3CCS L;  2QEX L;  1KD1 M;  1VQO O;  2OTL L;  1YIT O;  3I55 L;  1W2B K;  1S72 L;  5FCL A;  1Q86 M;  1Q7Y P;  4QDL A;  3G4S L;  3CC7 L;  1M1K P;  3CCV O;  3CCE O;  3CPW K;  3CD6 L;  1VQ5 L;  1VQ4 L;  3CCL L;  1VQK O;  3CXC K;  3CCQ O;  1YHQ L;  1QVF K;  2OTJ L;  4XTK A;  1K73 P;  1M90 M;  3GOD A;  3CME O;  1YIJ L;  4P6I C;  1YJN O;  2QEX O;  1Q81 M;  5DLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...