1M1KM

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
150
structure length
145
Chain Sequence
b'TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1m1kM02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 1m1kM01
3CD6O 3CCML 1YJWO 1Q81P 1K9MM 3CD6L 2QEXO 3CCRO 1YJWL 3CCRL 1VQLO 3CC2L 1K73M 3CCEO 2OTLL 1YJ9O 1VQLL 1VQ4L 1M1KM 3CCEL 3CCJO 1KC8P 1M90M 3CCVO 1YJNO 3CMEO 3CCJL 3CCVL 1YJNL 3CMEL 3CCLO 3CCUO 1VQ7O 3OW2N 1YI2L 1Q82M 1S72O 1QVGK 1VQ6L 3OW2K 1Q7YM 1N8RM 1VQ7L 1W2BN 1VQ5O 3CC4O 1VQ5L 1VQOO 1YITO 1Q86P 2QEXL 2QA4O 1K8AM 1KQSN 1VQNO 3CMAO 1Q81M 3I56O 3CXCN 3CCSO 1YJ9L 1VQNL 3CCQO 1KD1P 3I56L 2OTJO 1VQKO 3CCQL 3CPWN 2OTJL 1VQKL 3CCLL 3CCUL 1M1KP 1YHQO 1S72L 1VQMO 1KC8M 1M90P 1W2BK 1YHQL 1VQ9O 1VQPO 3CC4L 1VQPL 1NJIM 1VQOL 1YITL 1VQ8O 3G71O 3G6EO 2QA4L 1VQ8L 3G4SO 3G71L 1K9MP 1KQSK 1QVFN 1QVFK 3CMAL 1JJ2N 3CXCK 1JJ2K 3CCSL 3I55O 1K8AP 1K73P 3I55L 3CPWK 3CC2O 1KD1M 1VQML 1YIJO 2OTLO 1VQ4O 1Q82P 1VQ9L 1YIJL 1Q7YP 1N8RP 3CC7O 1YI2O 1VQ6O 3G6EL 1QVGN 3CC7L 3G4SL 1Q86M 3CCMO 1NJIP
chains in the Genus database with same CATH superfamily
3CD6O 3CCML 1YJWO 1Q81P 1K9MM 3CD6L 2QEXO 3CCRO 1YJWL 4N06A 3GODA 3CCRL 1VQLO 5FCLA 3CC2L 1K73M 3CCEO 2OTLL 1YJ9O 1VQLL 1VQ4L 4XTKA 1M1KM 3CCEL 3CCJO 1KC8P 1M90M 3CCVO 1YJNO 3CMEO 3CCJL 3CCVL 1YJNL 3CMEL 3CCLO 3CCUO 1VQ7O 3OW2N 1YI2L 1Q82M 1S72O 1QVGK 1VQ6L 3OW2K 1Q7YM 1N8RM 1VQ7L 1W2BN 3NKDA 1VQ5O 2YZSA 3CC4O 1VQ5L 1VQOO 1YITO 5DS6A 1Q86P 2QEXL 5DLJA 2QA4O 1K8AM 4P6IC 1KQSN 1VQNO 3CMAO 1Q81M 3I56O 3CXCN 3CCSO 1YJ9L 1VQNL 3CCQO 1KD1P 3I56L 2OTJO 1VQKO 3CCQL 3CPWN 2OTJL 1VQKL 3CCLL 3CCUL 1M1KP 1YHQO 1S72L 1VQMO 1KC8M 1M90P 5DQTA 1W2BK 1YHQL 1VQ9O 1VQPO 3CC4L 1VQPL 1NJIM 1VQOL 1YITL 4QDLA 1VQ8O 3G71O 5DS4A 3G6EO 2QA4L 1VQ8L 3G4SO 3G71L 1K9MP 1KQSK 1QVFN 1QVFK 3CMAL 1JJ2N 3CXCK 1JJ2K 3CCSL 3I55O 1K8AP 1K73P 3I55L 3CPWK 5DS5A 4WJ0A 3CC2O 1KD1M 1VQML 1YIJO 2OTLO 5DQZA 1VQ4O 1Q82P 1VQ9L 1YIJL 1Q7YP 4W8KA 1N8RP 3CC7O 1YI2O 1VQ6O 3G6EL 1QVGN 3CC7L 3G4SL 1Q86M 3CCMO 1NJIP
chains in the Genus database with same CATH topology
3CD6O 3CCML 1YJWO 1Q81P 1K9MM 3CD6L 2QEXO 3CCRO 1YJWL 4N06A 3GODA 3CCRL 1VQLO 5FCLA 3CC2L 1K73M 3CCEO 2OTLL 1YJ9O 1VQLL 1VQ4L 4XTKA 1M1KM 3CCEL 3CCJO 1KC8P 1M90M 3CCVO 1YJNO 3CMEO 3CCJL 3CCVL 1YJNL 3CMEL 3CCLO 3CCUO 1VQ7O 3OW2N 1YI2L 1Q82M 1S72O 1QVGK 1VQ6L 3OW2K 1Q7YM 1N8RM 1VQ7L 1W2BN 3NKDA 1VQ5O 2YZSA 3CC4O 1VQ5L 1VQOO 1YITO 5DS6A 1Q86P 2QEXL 5DLJA 2QA4O 1K8AM 4P6IC 1KQSN 1VQNO 3CMAO 1Q81M 3I56O 3CXCN 3CCSO 1YJ9L 1VQNL 3CCQO 1KD1P 3I56L 2OTJO 1VQKO 3CCQL 3CPWN 2OTJL 1VQKL 3CCLL 3CCUL 1M1KP 1YHQO 1S72L 1VQMO 1KC8M 1M90P 5DQTA 1W2BK 1YHQL 1VQ9O 1VQPO 3CC4L 1VQPL 1NJIM 1VQOL 1YITL 4QDLA 1VQ8O 3G71O 5DS4A 3G6EO 2QA4L 1VQ8L 3G4SO 3G71L 1K9MP 1KQSK 1QVFN 1QVFK 3CMAL 1JJ2N 3CXCK 1JJ2K 3CCSL 3I55O 1K8AP 1K73P 3I55L 3CPWK 5DS5A 4WJ0A 3CC2O 1KD1M 1VQML 1YIJO 2OTLO 5DQZA 1VQ4O 1Q82P 1VQ9L 1YIJL 1Q7YP 4W8KA 1N8RP 3CC7O 1YI2O 1VQ6O 3G6EL 1QVGN 3CC7L 3G4SL 1Q86M 3CCMO 1NJIP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 O;  3CCM L;  1YJW O;  1Q81 P;  1K9M M;  3CD6 L;  2QEX O;  3CCR O;  1YJW L;  3CCR L;  1VQL O;  3CC2 L;  1K73 M;  3CCE O;  2OTL L;  1YJ9 O;  1VQL L;  1VQ4 L;  1M1K M;  3CCE L;  3CCJ O;  1KC8 P;  1M90 M;  3CCV O;  1YJN O;  3CME O;  3CCJ L;  3CCV L;  1YJN L;  3CME L;  3CCL O;  3CCU O;  1VQ7 O;  3OW2 N;  1YI2 L;  1Q82 M;  1S72 O;  1QVG K;  1VQ6 L;  3OW2 K;  1Q7Y M;  1N8R M;  1VQ7 L;  1W2B N;  1VQ5 O;  3CC4 O;  1VQ5 L;  1VQO O;  1YIT O;  1Q86 P;  2QEX L;  2QA4 O;  1K8A M;  1KQS N;  1VQN O;  3CMA O;  1Q81 M;  3I56 O;  3CXC N;  3CCS O;  1YJ9 L;  1VQN L;  3CCQ O;  1KD1 P;  3I56 L;  2OTJ O;  1VQK O;  3CCQ L;  3CPW N;  2OTJ L;  1VQK L;  3CCL L;  3CCU L;  1M1K P;  1YHQ O;  1S72 L;  1VQM O;  1KC8 M;  1M90 P;  1W2B K;  1YHQ L;  1VQ9 O;  1VQP O;  3CC4 L;  1VQP L;  1NJI M;  1VQO L;  1YIT L;  1VQ8 O;  3G71 O;  3G6E O;  2QA4 L;  1VQ8 L;  3G4S O;  3G71 L;  1K9M P;  1KQS K;  1QVF N;  1QVF K;  3CMA L;  1JJ2 N;  3CXC K;  1JJ2 K;  3CCS L;  3I55 O;  1K8A P;  1K73 P;  3I55 L;  3CPW K;  3CC2 O;  1KD1 M;  1VQM L;  1YIJ O;  2OTL O;  1VQ4 O;  1Q82 P;  1VQ9 L;  1YIJ L;  1Q7Y P;  1N8R P;  3CC7 O;  1YI2 O;  1VQ6 O;  3G6E L;  1QVG N;  3CC7 L;  3G4S L;  1Q86 M;  3CCM O;  1NJI P; 
#chains in the Genus database with same CATH topology
 3CD6 O;  3CCM L;  1YJW O;  1Q81 P;  1K9M M;  3CD6 L;  2QEX O;  3CCR O;  1YJW L;  4N06 A;  3GOD A;  3CCR L;  1VQL O;  5FCL A;  3CC2 L;  1K73 M;  3CCE O;  2OTL L;  1YJ9 O;  1VQL L;  1VQ4 L;  4XTK A;  1M1K M;  3CCE L;  3CCJ O;  1KC8 P;  1M90 M;  3CCV O;  1YJN O;  3CME O;  3CCJ L;  3CCV L;  1YJN L;  3CME L;  3CCL O;  3CCU O;  1VQ7 O;  3OW2 N;  1YI2 L;  1Q82 M;  1S72 O;  1QVG K;  1VQ6 L;  3OW2 K;  1Q7Y M;  1N8R M;  1VQ7 L;  1W2B N;  3NKD A;  1VQ5 O;  2YZS A;  3CC4 O;  1VQ5 L;  1VQO O;  1YIT O;  5DS6 A;  1Q86 P;  2QEX L;  5DLJ A;  2QA4 O;  1K8A M;  4P6I C;  1KQS N;  1VQN O;  3CMA O;  1Q81 M;  3I56 O;  3CXC N;  3CCS O;  1YJ9 L;  1VQN L;  3CCQ O;  1KD1 P;  3I56 L;  2OTJ O;  1VQK O;  3CCQ L;  3CPW N;  2OTJ L;  1VQK L;  3CCL L;  3CCU L;  1M1K P;  1YHQ O;  1S72 L;  1VQM O;  1KC8 M;  1M90 P;  5DQT A;  1W2B K;  1YHQ L;  1VQ9 O;  1VQP O;  3CC4 L;  1VQP L;  1NJI M;  1VQO L;  1YIT L;  4QDL A;  1VQ8 O;  3G71 O;  5DS4 A;  3G6E O;  2QA4 L;  1VQ8 L;  3G4S O;  3G71 L;  1K9M P;  1KQS K;  1QVF N;  1QVF K;  3CMA L;  1JJ2 N;  3CXC K;  1JJ2 K;  3CCS L;  3I55 O;  1K8A P;  1K73 P;  3I55 L;  3CPW K;  5DS5 A;  4WJ0 A;  3CC2 O;  1KD1 M;  1VQM L;  1YIJ O;  2OTL O;  5DQZ A;  1VQ4 O;  1Q82 P;  1VQ9 L;  1YIJ L;  1Q7Y P;  4W8K A;  1N8R P;  3CC7 O;  1YI2 O;  1VQ6 O;  3G6E L;  1QVG N;  3CC7 L;  3G4S L;  1Q86 M;  3CCM O;  1NJI P; 
#chains in the Genus database with same CATH homology
 3CD6 O;  3CCM L;  1YJW O;  1Q81 P;  1K9M M;  3CD6 L;  2QEX O;  3CCR O;  1YJW L;  4N06 A;  3GOD A;  3CCR L;  1VQL O;  5FCL A;  3CC2 L;  1K73 M;  3CCE O;  2OTL L;  1YJ9 O;  1VQL L;  1VQ4 L;  4XTK A;  1M1K M;  3CCE L;  3CCJ O;  1KC8 P;  1M90 M;  3CCV O;  1YJN O;  3CME O;  3CCJ L;  3CCV L;  1YJN L;  3CME L;  3CCL O;  3CCU O;  1VQ7 O;  3OW2 N;  1YI2 L;  1Q82 M;  1S72 O;  1QVG K;  1VQ6 L;  3OW2 K;  1Q7Y M;  1N8R M;  1VQ7 L;  1W2B N;  3NKD A;  1VQ5 O;  2YZS A;  3CC4 O;  1VQ5 L;  1VQO O;  1YIT O;  5DS6 A;  1Q86 P;  2QEX L;  5DLJ A;  2QA4 O;  1K8A M;  4P6I C;  1KQS N;  1VQN O;  3CMA O;  1Q81 M;  3I56 O;  3CXC N;  3CCS O;  1YJ9 L;  1VQN L;  3CCQ O;  1KD1 P;  3I56 L;  2OTJ O;  1VQK O;  3CCQ L;  3CPW N;  2OTJ L;  1VQK L;  3CCL L;  3CCU L;  1M1K P;  1YHQ O;  1S72 L;  1VQM O;  1KC8 M;  1M90 P;  5DQT A;  1W2B K;  1YHQ L;  1VQ9 O;  1VQP O;  3CC4 L;  1VQP L;  1NJI M;  1VQO L;  1YIT L;  4QDL A;  1VQ8 O;  3G71 O;  5DS4 A;  3G6E O;  2QA4 L;  1VQ8 L;  3G4S O;  3G71 L;  1K9M P;  1KQS K;  1QVF N;  1QVF K;  3CMA L;  1JJ2 N;  3CXC K;  1JJ2 K;  3CCS L;  3I55 O;  1K8A P;  1K73 P;  3I55 L;  3CPW K;  5DS5 A;  4WJ0 A;  3CC2 O;  1KD1 M;  1VQM L;  1YIJ O;  2OTL O;  5DQZ A;  1VQ4 O;  1Q82 P;  1VQ9 L;  1YIJ L;  1Q7Y P;  4W8K A;  1N8R P;  3CC7 O;  1YI2 O;  1VQ6 O;  3G6E L;  1QVG N;  3CC7 L;  3G4S L;  1Q86 M;  3CCM O;  1NJI P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...