1Q86M

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
150
structure length
145
Chain Sequence
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
total genus 29
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1q86M02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 1q86M01
1VQ6L 1VQ9O 1VQ8L 2QEXO 3G4SO 1YJ9L 3CPWN 1VQ7L 3CCQO 1YITO 1K73M 2OTJL 1VQ8O 1YJ9O 1Q7YM 3I56L 1VQ7O 1N8RM 1K73P 1QVGN 2OTJO 3G71O 3CCEL 1VQKL 3CMAL 1Q7YP 3I56O 3CCRO 3OW2N 1YIJL 1Q86M 3CCEO 1VQKO 3CMAO 1Q81M 3CCQL 1Q86P 1YIJO 1VQ5L 1Q81P 3CPWK 3CCJL 3G71L 3CC7L 1VQ5O 2QA4L 3CCRL 1YJNL 3CCJO 1QVGK 3CC7O 1VQML 1YHQL 2QA4O 1S72L 1N8RP 1KD1M 3CCUL 1JJ2N 3OW2K 1YJNO 1VQMO 1VQOL 1YJWO 1S72O 1YHQO 1NJIM 1KD1P 3CCUO 1VQ4L 3CC2L 1VQLL 3CCVL 1VQOO 1M1KM 3CD6L 1YI2L 1VQ4O 3CC2O 1VQLO 3CCVO 2OTLL 1M1KP 3CMEO 3CD6O 1YI2O 1M90M 1W2BN 2OTLO 1K8AM 1KQSN 1YJWL 3CCML 1VQPL 1M90P 3G6EL 1JJ2K 3CCSL 1K9MM 1Q82M 3CCMO 3I55L 1VQPO 1QVFN 1QVFK 3G6EO 1KC8M 3CCSO 1K9MP 1VQNL 1Q82P 1VQ6O 3I55O 1NJIP 3CXCN 3CMEL 3CXCK 1KC8P 1VQNO 3CCLL 3CC4L 1W2BK 1KQSK 3CCLO 1VQ9L 2QEXL 3G4SL 3CC4O 1K8AP 1YITL
chains in the Genus database with same CATH superfamily
1VQ6L 1VQ9O 1VQ8L 2QEXO 3G4SO 1YJ9L 3CPWN 1VQ7L 3CCQO 5DQTA 1YITO 1K73M 2OTJL 1VQ8O 1YJ9O 1Q7YM 3I56L 1VQ7O 1N8RM 1K73P 1QVGN 2OTJO 3G71O 3CCEL 1VQKL 3CMAL 1Q7YP 3I56O 3CCRO 3OW2N 1YIJL 1Q86M 3CCEO 1VQKO 3CMAO 1Q81M 3CCQL 1Q86P 1YIJO 4QDLA 1VQ5L 1Q81P 4P6IC 3CPWK 2YZSA 4N06A 3G71L 3CC7L 3CCJL 1VQ5O 5FCLA 2QA4L 3CCRL 1YJNL 3CCJO 1QVGK 3CC7O 1VQML 5DLJA 4WJ0A 1YHQL 2QA4O 1S72L 1N8RP 1KD1M 4XTKA 3CCUL 3OW2K 1JJ2N 1YJNO 1VQMO 1VQOL 1YJWO 1YHQO 1S72O 1NJIM 1KD1P 3CCUO 1VQ4L 3CC2L 1VQLL 3CCVL 1VQOO 1M1KM 3CD6L 1YI2L 1VQ4O 3CC2O 1VQLO 3CCVO 2OTLL 1M1KP 3CMEO 3CD6O 1YI2O 5DS6A 1M90M 3GODA 1W2BN 2OTLO 1K8AM 1KQSN 1YJWL 3CCML 1VQPL 1M90P 3G6EL 1JJ2K 3CCSL 1K9MM 1Q82M 3CCMO 3I55L 1VQPO 5DS5A 1QVFN 1QVFK 3G6EO 1KC8M 3CCSO 1K9MP 1VQNL 1Q82P 1VQ6O 3I55O 1NJIP 3CXCN 3CMEL 3CXCK 1KC8P 1VQNO 5DS4A 3CCLL 3CC4L 4W8KA 1W2BK 1KQSK 3CCLO 1VQ9L 2QEXL 3G4SL 3CC4O 3NKDA 1K8AP 5DQZA 1YITL
chains in the Genus database with same CATH topology
1VQ6L 1VQ9O 1VQ8L 2QEXO 3G4SO 1YJ9L 3CPWN 1VQ7L 3CCQO 5DQTA 1YITO 1K73M 2OTJL 1VQ8O 1YJ9O 1Q7YM 3I56L 1VQ7O 1N8RM 1K73P 1QVGN 2OTJO 3G71O 3CCEL 1VQKL 3CMAL 1Q7YP 3I56O 3CCRO 3OW2N 1YIJL 1Q86M 3CCEO 1VQKO 3CMAO 1Q81M 3CCQL 1Q86P 1YIJO 4QDLA 1VQ5L 1Q81P 4P6IC 3CPWK 2YZSA 4N06A 3G71L 3CC7L 3CCJL 1VQ5O 5FCLA 2QA4L 3CCRL 1YJNL 3CCJO 1QVGK 3CC7O 1VQML 5DLJA 4WJ0A 1YHQL 2QA4O 1S72L 1N8RP 1KD1M 4XTKA 3CCUL 3OW2K 1JJ2N 1YJNO 1VQMO 1VQOL 1YJWO 1YHQO 1S72O 1NJIM 1KD1P 3CCUO 1VQ4L 3CC2L 1VQLL 3CCVL 1VQOO 1M1KM 3CD6L 1YI2L 1VQ4O 3CC2O 1VQLO 3CCVO 2OTLL 1M1KP 3CMEO 3CD6O 1YI2O 5DS6A 1M90M 3GODA 1W2BN 2OTLO 1K8AM 1KQSN 1YJWL 3CCML 1VQPL 1M90P 3G6EL 1JJ2K 3CCSL 1K9MM 1Q82M 3CCMO 3I55L 1VQPO 5DS5A 1QVFN 1QVFK 3G6EO 1KC8M 3CCSO 1K9MP 1VQNL 1Q82P 1VQ6O 3I55O 1NJIP 3CXCN 3CMEL 3CXCK 1KC8P 1VQNO 5DS4A 3CCLL 3CC4L 4W8KA 1W2BK 1KQSK 3CCLO 1VQ9L 2QEXL 3G4SL 3CC4O 3NKDA 1K8AP 5DQZA 1YITL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 L;  1VQ9 O;  1VQ8 L;  2QEX O;  3G4S O;  1YJ9 L;  3CPW N;  1VQ7 L;  3CCQ O;  1YIT O;  1K73 M;  2OTJ L;  1VQ8 O;  1YJ9 O;  1Q7Y M;  3I56 L;  1VQ7 O;  1N8R M;  1K73 P;  1QVG N;  2OTJ O;  3G71 O;  3CCE L;  1VQK L;  3CMA L;  1Q7Y P;  3I56 O;  3CCR O;  3OW2 N;  1YIJ L;  1Q86 M;  3CCE O;  1VQK O;  3CMA O;  1Q81 M;  3CCQ L;  1Q86 P;  1YIJ O;  1VQ5 L;  1Q81 P;  3CPW K;  3CCJ L;  3G71 L;  3CC7 L;  1VQ5 O;  2QA4 L;  3CCR L;  1YJN L;  3CCJ O;  1QVG K;  3CC7 O;  1VQM L;  1YHQ L;  2QA4 O;  1S72 L;  1N8R P;  1KD1 M;  3CCU L;  1JJ2 N;  3OW2 K;  1YJN O;  1VQM O;  1VQO L;  1YJW O;  1S72 O;  1YHQ O;  1NJI M;  1KD1 P;  3CCU O;  1VQ4 L;  3CC2 L;  1VQL L;  3CCV L;  1VQO O;  1M1K M;  3CD6 L;  1YI2 L;  1VQ4 O;  3CC2 O;  1VQL O;  3CCV O;  2OTL L;  1M1K P;  3CME O;  3CD6 O;  1YI2 O;  1M90 M;  1W2B N;  2OTL O;  1K8A M;  1KQS N;  1YJW L;  3CCM L;  1VQP L;  1M90 P;  3G6E L;  1JJ2 K;  3CCS L;  1K9M M;  1Q82 M;  3CCM O;  3I55 L;  1VQP O;  1QVF N;  1QVF K;  3G6E O;  1KC8 M;  3CCS O;  1K9M P;  1VQN L;  1Q82 P;  1VQ6 O;  3I55 O;  1NJI P;  3CXC N;  3CME L;  3CXC K;  1KC8 P;  1VQN O;  3CCL L;  3CC4 L;  1W2B K;  1KQS K;  3CCL O;  1VQ9 L;  2QEX L;  3G4S L;  3CC4 O;  1K8A P;  1YIT L; 
#chains in the Genus database with same CATH topology
 1VQ6 L;  1VQ9 O;  1VQ8 L;  2QEX O;  3G4S O;  1YJ9 L;  3CPW N;  1VQ7 L;  3CCQ O;  5DQT A;  1YIT O;  1K73 M;  2OTJ L;  1VQ8 O;  1YJ9 O;  1Q7Y M;  3I56 L;  1VQ7 O;  1N8R M;  1K73 P;  1QVG N;  2OTJ O;  3G71 O;  3CCE L;  1VQK L;  3CMA L;  1Q7Y P;  3I56 O;  3CCR O;  3OW2 N;  1YIJ L;  1Q86 M;  3CCE O;  1VQK O;  3CMA O;  1Q81 M;  3CCQ L;  1Q86 P;  1YIJ O;  4QDL A;  1VQ5 L;  1Q81 P;  4P6I C;  3CPW K;  2YZS A;  4N06 A;  3G71 L;  3CC7 L;  3CCJ L;  1VQ5 O;  5FCL A;  2QA4 L;  3CCR L;  1YJN L;  3CCJ O;  1QVG K;  3CC7 O;  1VQM L;  5DLJ A;  4WJ0 A;  1YHQ L;  2QA4 O;  1S72 L;  1N8R P;  1KD1 M;  4XTK A;  3CCU L;  3OW2 K;  1JJ2 N;  1YJN O;  1VQM O;  1VQO L;  1YJW O;  1YHQ O;  1S72 O;  1NJI M;  1KD1 P;  3CCU O;  1VQ4 L;  3CC2 L;  1VQL L;  3CCV L;  1VQO O;  1M1K M;  3CD6 L;  1YI2 L;  1VQ4 O;  3CC2 O;  1VQL O;  3CCV O;  2OTL L;  1M1K P;  3CME O;  3CD6 O;  1YI2 O;  5DS6 A;  1M90 M;  3GOD A;  1W2B N;  2OTL O;  1K8A M;  1KQS N;  1YJW L;  3CCM L;  1VQP L;  1M90 P;  3G6E L;  1JJ2 K;  3CCS L;  1K9M M;  1Q82 M;  3CCM O;  3I55 L;  1VQP O;  5DS5 A;  1QVF N;  1QVF K;  3G6E O;  1KC8 M;  3CCS O;  1K9M P;  1VQN L;  1Q82 P;  1VQ6 O;  3I55 O;  1NJI P;  3CXC N;  3CME L;  3CXC K;  1KC8 P;  1VQN O;  5DS4 A;  3CCL L;  3CC4 L;  4W8K A;  1W2B K;  1KQS K;  3CCL O;  1VQ9 L;  2QEX L;  3G4S L;  3CC4 O;  3NKD A;  1K8A P;  5DQZ A;  1YIT L; 
#chains in the Genus database with same CATH homology
 1VQ6 L;  1VQ9 O;  1VQ8 L;  2QEX O;  3G4S O;  1YJ9 L;  3CPW N;  1VQ7 L;  3CCQ O;  5DQT A;  1YIT O;  1K73 M;  2OTJ L;  1VQ8 O;  1YJ9 O;  1Q7Y M;  3I56 L;  1VQ7 O;  1N8R M;  1K73 P;  1QVG N;  2OTJ O;  3G71 O;  3CCE L;  1VQK L;  3CMA L;  1Q7Y P;  3I56 O;  3CCR O;  3OW2 N;  1YIJ L;  1Q86 M;  3CCE O;  1VQK O;  3CMA O;  1Q81 M;  3CCQ L;  1Q86 P;  1YIJ O;  4QDL A;  1VQ5 L;  1Q81 P;  4P6I C;  3CPW K;  2YZS A;  4N06 A;  3G71 L;  3CC7 L;  3CCJ L;  1VQ5 O;  5FCL A;  2QA4 L;  3CCR L;  1YJN L;  3CCJ O;  1QVG K;  3CC7 O;  1VQM L;  5DLJ A;  4WJ0 A;  1YHQ L;  2QA4 O;  1S72 L;  1N8R P;  1KD1 M;  4XTK A;  3CCU L;  3OW2 K;  1JJ2 N;  1YJN O;  1VQM O;  1VQO L;  1YJW O;  1YHQ O;  1S72 O;  1NJI M;  1KD1 P;  3CCU O;  1VQ4 L;  3CC2 L;  1VQL L;  3CCV L;  1VQO O;  1M1K M;  3CD6 L;  1YI2 L;  1VQ4 O;  3CC2 O;  1VQL O;  3CCV O;  2OTL L;  1M1K P;  3CME O;  3CD6 O;  1YI2 O;  5DS6 A;  1M90 M;  3GOD A;  1W2B N;  2OTL O;  1K8A M;  1KQS N;  1YJW L;  3CCM L;  1VQP L;  1M90 P;  3G6E L;  1JJ2 K;  3CCS L;  1K9M M;  1Q82 M;  3CCM O;  3I55 L;  1VQP O;  5DS5 A;  1QVF N;  1QVF K;  3G6E O;  1KC8 M;  3CCS O;  1K9M P;  1VQN L;  1Q82 P;  1VQ6 O;  3I55 O;  1NJI P;  3CXC N;  3CME L;  3CXC K;  1KC8 P;  1VQN O;  5DS4 A;  3CCL L;  3CC4 L;  4W8K A;  1W2B K;  1KQS K;  3CCL O;  1VQ9 L;  2QEX L;  3G4S L;  3CC4 O;  3NKD A;  1K8A P;  5DQZ A;  1YIT L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...